The URL can be used to link to this page

01/16/2025Thursday, January 16, 2025 6:00 PM City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 Main Library - Council Chambers City Council Meeting Agenda January 16, 2025City Council Meeting Agenda Welcome. We are glad to have you join us. If you wish to address the Council, please complete a Comment Card. Comment Cards are on the right-hand side of the dais by the City Clerk. When recognized, please hand your card to the Clerk, approach the podium and state your name. Persons speaking before the City Council shall be limited to 3 minutes unless otherwise noted under Public Hearings. For other than "Citizens to be heard regarding items not on the Agenda," a spokesperson for a group may speak for 3 minutes plus an additional minute for each person in the audience that waives their right to speak, up to a maximum of 10 minutes. Prior to the item being presented, please obtain the form to designate a spokesperson from the City Clerk. Up to 60 minutes of public comment will be allowed for an agenda item. No person shall speak more than once on the same subject unless granted permission by the City Council. The City of Clearwater strongly supports and fully complies with the Americans with Disabilities Act (ADA). Please advise us at least 48 hours prior to the meeting if you require special accommodations at 727-562-4090. Assisted Listening Devices are available. Kindly refrain from using cell phones and electronic devices during the meeting. Citizens wishing to provide comments on an agenda item are encouraged to do so in advance through written comment. The City has established the following two options: 1) eComments via Granicus - eComments is integrated with the published meeting agenda. Individuals may review the agenda item details and indicate their position on the item. You will be prompted to set up a user profile to allow you to comment, which will become part of the official public record. The eComment period is open from the time the agenda is published. All comments received by 5:00 p.m. the day before the meeting will become part of the official record. 2) Email – Individuals may submit written comments or videos to ClearwaterCouncil@myclearwater.com. All comments received by 5:00 p.m. the day before the meeting will become part of the official record. 1. Call to Order 2. Invocation 3. Pledge of Allegiance 4. Special recognitions and Presentations (Proclamations, service awards, or other special recognitions. Presentations by governmental agencies or groups providing formal updates to Council will be limited to ten minutes.) 4.1 January Service Awards 4.2 North Beach Update 5. Approval of Minutes 5.1 Approve the minutes of the December 19, 2024 City Council Meeting as submitted in written summation by the City Clerk. Page 2 City of Clearwater Printed on 1/14/2025 January 16, 2025City Council Meeting Agenda 6. Consent Agenda The Consent Agenda contains normal, routine business items that are very likely to be approved by the City Council by a single motion. These items are not discussed, and may all be approved as recommended on the staff reports. Council questions on these items were answered prior to the meeting. The Mayor will provide an opportunity for a Councilmember or a member of the public to ask that an item be pulled from the Consent Agenda for discussion. Items pulled will receive separate action. All items not removed from the Consent Agenda will be approved by a single motion of the council. 6.1 Approve a four-year funding agreement in the amount not to exceed $130,625.22 between the Pinellas Suncoast Transit Authority (PSTA) and the City of Clearwater for expanded Ferry Services and authorize the appropriate officials to execute same. (consent) 6.2 Authorize City of Clearwater Interim Economic Development Director to enter into negotiations with the Clearwater Urban Leadership Coalition (CULC) for the leasing of certain real properties located at 1321 N. Martin Luther King, Jr. Avenue, 1317 N. Martin Luther King, Jr. Avenue, and 1106 Tangerine Street along with certain property owned by the City of Clearwater Community Redevelopment Agency (CRA) located at 1325 N. Martin Luther King, Jr. Avenue to CULC. (consent) 6.3 Approve a purchase order to Cale America, d/b/a Flowbird, of Clearwater, FL, for the purchase of direct replacement of 50 multi-space parking kiosks, in an amount of $334,810.15, pursuant to Clearwater Code of Ordinances Section 2.563 (1)(d), non-competitive purchase; authorize the trade-in of the damaged meters in accordance with Code of Ordinance Section 2.623(7)(e), trade-in, and authorize the appropriate officials to execute same. (consent) 6.4 Approve a Guaranteed Maximum Price proposal from Bandes Construction Company, Inc. of Dunedin, FL, to build the Traffic Maintenance Center and an office, in the amount of $195,957.00 pursuant to Request for Qualifications (RFQ) 51-24 and authorize the appropriate officials to execute same. (consent) 6.5 Declare furniture and related items in the Municipal Services Building (MSB) surplus as part of the MSB Renovations project (23-0035-EN), authorize disposal pursuant to Clearwater Code of Ordinances Sections 2.623(3) and (4), and authorize the appropriate officials to execute same. (consent) 6.6 Authorize the final rental and settlement payments to United Rentals North America, Inc. in the not-to-exceed amount of $254,188.40 for the rental and loss of eight diesel-powered portable pumps utilized by the City of Clearwater, from June 1, 2024 through November 30, 2024, pursuant to Clearwater Code of Ordinances Section 2.563(1)(c), Piggyback; declare the eight flood damaged motors and pumps as surplus pursuant to Section 2.623 (8) and authorize the appropriate officials to execute same. (consent) Page 3 City of Clearwater Printed on 1/14/2025 January 16, 2025City Council Meeting Agenda 6.7 Approve an amendment to the Master Services Agreement Re: Participants (Participation Amendment) between the City of Clearwater, Bank of America, N.A. for itself and as assignee of Banc of America Merchant Services, LLC (Bank), and Central Florida Expressway Authority (Lead Merchant) for the provision of merchant services beginning December 12, 2024 and renewing annually in June until CFX terminates the agreement, and authorize the appropriate officials to execute same. (consent) 6.8 Approve a Lease Agreement between Clearwater Ferry and the City for ferry vessels purchased under FDOT JPA Agreement G2S84 and authorize the appropriate officials to execute same. (consent) 6.9 Declare list of vehicles and equipment surplus and authorize disposal through auction pursuant to Clearwater Code Section 2.623(6) and (8) and authorize the appropriate officials to execute the same. (consent) 6.10 Approve the collective bargaining agreement as negotiated between the City of Clearwater and International Association of Fire Fighters Bargaining Unit for Fiscal years 2024/2025, 2025/2026, 2026/2027 and authorize the appropriate officials to execute same. (consent)  6.11 Authorize an agreement with DEX Imaging LLC dba TotalPrint USA (TotalPrint USA), of Tampa, FL for citywide copier and printer services in an annual not to exceed amount of $200,000.00, for the initial term January 1, 2025 through December 31, 2025, with three, one-year renewal options pursuant to RFP 56-24, and authorize the appropriate officials to execute same. (consent) 6.12 Authorize a purchase order to Hadronex Inc. DBA SmartCover of Escondido, California, for renewal of the SmartCare program which provides maintenance and service of the City’s SmartCover sewer level monitoring system for term December 1,2024 through January 01, 2026, in the not-to-exceed amount of $50,000.00 pursuant to Clearwater Code of Ordinances Section 2.563(1)(d), non-competitive purchase, and authorize the appropriate official to execute same. (consent) 6.13 Approve a Work Order to McKim and Creed for engineering services through construction for the installation of a solar photovoltaic (PV) system on top of the Chlorine Contact Chambers (CCC) at the Northeast Water Reclamation Facility (NE WRF), Project 24-0039-UT, in the amount of $221,407.00 pursuant to RFQ 34-23, Engineer of Record (EOR) Consulting Services and authorize the appropriate officials to execute same. (consent) 6.14 Schedule a work session on Monday, July 7, 2025 at 1:30 p.m. and a council meeting on Thursday, July 10, 2025 at 6:00 p.m. (consent) Public Hearings - Not before 6:00 PM Page 4 City of Clearwater Printed on 1/14/2025 January 16, 2025City Council Meeting Agenda 7. Administrative Public Hearings - Presentation of issues by City staff - Statement of case by applicant or representative (5 min.) - Council questions - Comments in support or opposition (3 min. per speaker or 10 min maximum as spokesperson for others that have waived their time) - Council questions - Final rebuttal by applicant or representative (5 min.) - Council disposition 7.1 Continue to February 6, 2025: Provide direction on the proposed Development Agreement between AP Beach Properties, LLC (the property owner) and the City of Clearwater for property located at 405 Coronado Drive, providing for the allocation of 100 units from the Hotel Density Reserve under Beach by Design; and confirm a second public hearing in City Council Chambers before City Council on February 20, 2025 at 6:00 p.m., or as soon thereafter as may be heard. (HDA2024-09001) 7.2 Authorize a Guaranteed Maximum Price (GMP) proposal from Creative Contractors, Inc., of Clearwater, FL, for the Long Center Renovation project (21-0026-PR) in the amount of $14,504,354.00 increasing the purchase order total to $14,590,729.00; authorize an increase to Wannemacher Jensen Architects (WJA) of St Petersburg, FL for supplemental work order 2 in the amount of $298,380.00, increasing the purchase order to $1,117,296.00 pursuant to RFQ 08-23, and authorize the appropriate officials to execute same. 7.3 Amend Clearwater Code of Ordinances Sections 2.413 and 2.418 to change the disability process for members of the pension plan and pass Ordinance 9813-25 on first reading. 7.4 Adopt Resolutions 25-02 and 25-03 relating to Council rules. 8. Second Readings - Public Hearing 8.1 Adopt Ordinance 9802-25 on second reading, annexing certain real property whose post office address is 1755 St. Anthony Drive, Clearwater, Florida 33759, into the corporate limits of the city and redefining the boundary lines of the city to include said addition. Page 5 City of Clearwater Printed on 1/14/2025 January 16, 2025City Council Meeting Agenda 8.2 Adopt Ordinance 9803-25 on second reading, amending the future land use element of the Comprehensive Plan of the city to designate the land use for certain real property whose post office address is 1755 St. Anthony Drive, Clearwater, Florida 33759, upon annexation into the City of Clearwater, as Residential Urban (RU). 8.3 Adopt Ordinance 9804-25 on second reading, amending the Zoning Atlas of the city by zoning certain real property whose post office address is 1755 St. Anthony Drive, Clearwater, Florida 33759, upon annexation into the City of Clearwater, as Low Medium Density Residential (LMDR). 9. City Manager Reports 10. City Attorney Reports 11. Closing comments by Councilmembers (limited to 3 minutes) 12. Closing Comments by Mayor 13. Adjourn Page 6 City of Clearwater Printed on 1/14/2025 Cover Memo City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 File Number: ID#24-1534 Agenda Date: 1/16/2025 Status: Agenda ReadyVersion: 1 File Type: Special recognitions and Presentations (Proclamations, service awards, or other special recognitions. Presentations by government agencies or groups providing formal updates to Council will be limited to ten minutes.) In Control: Council Work Session Agenda Number: 4.1 SUBJECT/RECOMMENDATION: January Service Awards SUMMARY: 5 Years of Service: Owen Reich Police Braxton Jones Parks & Recreation Marvin Garcia Police Matthew High Police 10 Years of Service: Richard Phillips General Services Erin Marks Library Laura DelValle Public Communications 15 Years of Service: Lisa Bonfantino Public Works 20 Years of Service: Alexander West Public Utilities Leonard Cox Public Utilities 25 Years of Service: Leo Mazzullo General Services Michael Lockwood Parks & Recreation STRATEGIC PRIORITY: The city of Clearwater celebrates its employees and the Superior Public Service they provide to our citizens. The city strives to attract and retain top-quality personnel through the maintenance of a competitive compensation program. The service awards are a testament to the city and our high performing government. Page 1 City of Clearwater Printed on 1/14/2025 Cover Memo City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 File Number: ID#24-1586 Agenda Date: 1/16/2025 Status: Agenda ReadyVersion: 1 File Type: Special recognitions and Presentations (Proclamations, service awards, or other special recognitions. Presentations by government agencies or groups providing formal updates to Council will be limited to ten minutes.) In Control: Council Work Session Agenda Number: 4.2 SUBJECT/RECOMMENDATION: North Beach Update Page 1 City of Clearwater Printed on 1/14/2025 Cover Memo City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 File Number: ID#25-0006 Agenda Date: 1/16/2025 Status: Agenda ReadyVersion: 1 File Type: MinutesIn Control: City Council Agenda Number: 5.1 SUBJECT/RECOMMENDATION: Approve the minutes of the December 19, 2024 City Council Meeting as submitted in written summation by the City Clerk. Page 1 City of Clearwater Printed on 1/14/2025 City Council Meeting Minutes December 19, 2024 Page 1 City of Clearwater City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 Meeting Minutes Thursday, December 19, 2024 6:00 PM Main Library - Council Chambers City Council Draft City Council Meeting Minutes December 19, 2024 Page 2 City of Clearwater Roll Call Present: 5 - Mayor Bruce Rector, Vice Mayor David Allbritton, Councilmember Ryan Cotton, Councilmember Michael Mannino and Councilmember Lina Teixeira Also Present: Jennifer Poirrier – City Manager, Daniel Slaughter – Assistant City Manager, David Margolis – City Attorney, Rosemarie Call – City Clerk and Nicole Sprague – Deputy City Clerk. To provide continuity for research, items are listed in agenda order although not necessarily discussed in that order. Unapproved 1. Call to Order – Mayor Rector The meeting was called to order at 6:00 p.m. 2. Invocation – Apostle Norma Fontaine Philbert from Garden of Grace Ministries 3. Pledge of Allegiance 4. Special recognitions and Presentations (Proclamations, service awards, or other special recognitions. Presentations by governmental agencies or groups providing formal updates to Council will be limited to ten minutes.) – Given. 4.1 December Service Awards The December 2024 Employee of the Month Award was presented to Matthew Anderson, Parks and Recreation. 4.2 Domestic Violence Awareness Month Proclamation, October 2024 - John Long, VP of Abuse Services for Hope Villages 4.3 Keep Pinellas Beautiful - Megan Jackson, Program Coordinator 4.4 North Beach Update 5. Approval of Minutes 5.1 Approve the minutes of the December 5, 2024 city council meeting as submitted in written summation by the City Clerk. Councilmember Cotton moved to approve the minutes of the December 5, 2024 city council meeting as submitted in written summation by the City Clerk. The motion was duly seconded and Draft City Council Meeting Minutes December 19, 2024 Page 3 City of Clearwater carried unanimously. 6. Consent Agenda – Approved as submitted, less Item 6.12. 6.1 Ratify and confirm a not-to-exceed amount of $561,163.00 for restoration and mitigation work for Fire Station 46, Beach Police Substation, Lifeguard Tower 0, Beach Marina Building, and variety of other structures to SERVPRO of Largo as the general contractor for the remediation and recovery services performed. (consent) 6.2 Ratify and confirm a not-to-exceed amount of $1,958,684.86 for the mitigation work for BayCare Ballpark (Phillies Stadium), consisting of an estimated amount of $1,500,000.00 to SERVPRO of Montgomery as the general contractor for mitigation work, $175,000.00 to Garland Solution Options for roofing repairs, $33,784.86 to Bates Electric for electric repairs, and $249,900.00 to Turbo Link International, inc. for equipment and padding replacement for the stadium. (consent) 6.3 Approve staff recommendations regarding policies for the use of ten event days at The BayCare Sound and authorize the appropriate officials to execute same. (consent) 6.4 Authorize a Guaranteed Maximum Price proposal with Bandes Construction Company, Inc. of Dunedin, FL for professional services in connection with the temporary repairs needed for Pier 60 in the amount of $270,312.00.00 pursuant to Request for Qualifications (RFQ) 51-24 and authorize the appropriate officials to execute same. (consent) 6.5 Authorize a Guaranteed Maximum Price proposal to Khors Construction, Inc. of Pinellas Park, Florida, for the construction of a 1,700-square foot maintenance, office and restroom building at Joe DiMaggio Sports Complex located at 2450 Drew Street in the amount of $562,433.29 pursuant to Request for Qualifications (RFQ) 51-24 and authorize the appropriate officials to execute same. (consent) 6.6 Approve a Contract for the Purchase of Real Property located at First St, East Lot’s 1 and 2 by the City of Clearwater Parks Department from A Investments Development Corp. for the purchase price of $1,240,000.00 and $15,000 closing expenditures, not to exceed $1,255,000.00, as recorded in O.R. Book(s) 21923, Page 910, Book 14426, Page 14 and 17, Book 17947, Page 1794, Book 12632, Page 1261, and Book 21989, Page 2463 all part thereof the Public Records Plat Book 9, Page 52 of Pinellas County, FL, and authorize the appropriate officials to execute same. (consent) 6.7 Authorize a purchase order increase and extension to David Nelson Construction Company of Palm Harbor, Florida for 2021 Stormwater Repairs on a unit price basis in the not-to-exceed amount of $3,000,000.00 through December 31, 2025, pursuant to ITB 20-0029-EN, and authorize the appropriate officials to execute same. (consent) Draft City Council Meeting Minutes December 19, 2024 Page 4 City of Clearwater 6.8 Authorize a professional service agreement and purchase order with CPH Consulting, LLC of Tampa, FL as a Public Works Department Program Consultant (24-0049-EN) in the not-to-exceed amount of $350,000.00 for a five-year term pursuant to Request for Qualification (RFQ) 37-24 and authorize the appropriate officials to execute same. (consent) 6.9 Authorize a professional service agreement and increase to purchase order with Broaddus and Associates, of Tampa, FL for the Public Works Department (PWD) Program Consultant (24-0048-EN) in the amount of $350,000.00 bringing the not-to-exceed amount to $445,000.00 for a five-year term pursuant to Request for Qualification (RFQ) 37-24 and authorize the appropriate officials to execute same. (consent) 6.10 Authorize a Purchase Order to Keystone Excavators, Inc. of Oldsmar, FL, for the reconstruction of Parking Lot 36 located at 4 Rockaway Street in the amount of $765,424.75 pursuant to Clearwater Code of Ordinances Sections 2.563(1)(c), Piggyback, and 2.563 (1)(d), Impractical, and authorize the appropriate officials to execute same. (consent) 6.11 Approve agreements with Black and Veatch (B and V) of Tampa, FL, CHA Consulting, Inc. (CHA) of Tampa, FL, and Freese and Nichols of Tampa, FL, for Project Management Services in a cumulative not-to-exceed amount of $5,022,732.00 for a three-year term, with one, three-year renewal option in a cumulative not-to-exceed amount of$5,022,732.00, for a total not-to-exceed of $10,045,464.00, pursuant to RFP 22-24, and authorize the appropriate officials to execute the same. (consent) 6.12 Authorize purchase orders to H and H Liquid Sludge Disposal, Inc of Branford, FL as the primary awardee, and T Wayne Hill of Mulberry, FL as a secondary awardee for the hauling and disposal of biosolids in the cumulative not-to-exceed amount of $7,500,000.00, beginning January 17, 2025 through January 16, 2028, with two, one-year renewal options in the annual not-to-exceed amount of $2,500,000.00 pursuant to Invitation to Bid (ITB) 02-25 and authorize the appropriate officials to execute same. (consent) See below. 6.13 Appoint Indira Yengera to the Sister Cities Advisory Board, as the Youth Member, to a term expiring October 31, 2028. (consent) 6.14 Appoint Tanya Landry to the Library Board with an unexpired term through February 28, 2025. (consent) Councilmember Teixeira moved to approve the Consent Agenda as Draft City Council Meeting Minutes December 19, 2024 Page 5 City of Clearwater submitted, less Item 6.12, and authorize the appropriate officials to execute same. The motion was duly seconded and carried unanimously. 6.12 Authorize purchase orders to H and H Liquid Sludge Disposal, Inc of Branford, FL as the primary awardee, and T Wayne Hill of Mulberry, FL as a secondary awardee for the hauling and disposal of biosolids in the cumulative not-to-exceed amount of $7,500,000.00, beginning January 17, 2025 through January 16, 2028, with two, one-year renewal options in the annual not-to-exceed amount of $2,500,000.00 pursuant to Invitation to Bid (ITB) 02-25 and authorize the appropriate officials to execute same. (consent) Invitation to Bid 02-25 for Biosolids Management Services was issued on October 18, 2024. In response to the solicitation, the City received three responsive bid submittals meeting the requirements outlined in the bid specifications. H&H Liquid Sludge Disposal, Inc. has been identified as the lowest responsive and most responsible bidder. The City of Clearwater’s three Water Reclamation Facilities (WRFs) produce biosolids, a residual product that requires proper hauling and disposal. Contractors are tasked with providing two primary services: 1. Transporting Biosolids (Dewatered Cake) to a Residuals Management Facility (RMF). 2. Hauling Liquid Biosolids (Approximately 5% Total Solids) from the East WRF to the Northeast WRF and/or the Marshall Street WRF. The disposal of biosolids is governed by state and federal regulations, making strict compliance with the regulations essential. To meet the requirements of the Florida Department of Environmental Protection (FDEP) and address the recent need for an emergency procurement contract-due to one of our contracted vendors being unable to renew their agreement because of capacity constraints-approval is requested for both a primary and a secondary award. This approach aims to prevent future reliance on emergency measures and ensure continuity if the primary vendor is unable to fulfill their obligations. • H&H Liquid Sludge Disposal, Inc. (Branford, FL) o Primary for Base Bid Items 1, 2, 3, and 4 o Primary for Alternate Bid Items 1, 2, 3, and 4 • T. Wayne Hill (Mulberry, FL) o Secondary for Base Bid Items 1, 2, 3, and 4 APPROPRIATION CODE AND AMOUNT: Funding for the current year’s portion of this purchase order is available in Public Utilities cost code 530300, contractual services. Future year funding will be requested as part of the annual budget process. The Public Utilities Draft City Council Meeting Minutes December 19, 2024 Page 6 City of Clearwater Department is funded by Water and Sewer Utility Enterprise Fund revenues. STRATEGIC PRIORITY: Biosolids disposal is required by law and is part of environmental stewardship, superior public service, and community wellbeing. One individual spoke in opposition. Vice Mayor Allbritton moved to authorize purchase orders to H and H Liquid Sludge Disposal, Inc of Branford, FL as the primary awardee, and T Wayne Hill of Mulberry, FL as a secondary awardee for the hauling and disposal of biosolids in the cumulative not-to-exceed amount of $7,500,000.00, beginning January 17, 2025 through January 16, 2028, with two, one-year renewal options in the annual not-to-exceed amount of $2,500,000.00 pursuant to Invitation to Bid (ITB) 02-25 and authorize the appropriate officials to execute same. The motion was duly seconded and carried unanimously. Public Hearings - Not before 6:00 PM 7. Administrative Public Hearings 7.1 Accept the 2024 Local Housing Incentive Strategy (LHIS) Report developed by the Affordable Housing Advisory Committee (AHAC). (APH) Florida Statute Section 420.9076 states that counties and cities receiving State Housing Initiatives Partnership (SHIP) program funds are required to appoint an Affordable Housing Advisory Committee (AHAC). The statute further provides that the committee be made up of members from specific industries or groups as identified in the statute. The requirement was largely met through the use of the City’s existing seven-member Neighborhood and Affordable Housing Advisory Board (NAHAB). City staff recommended council appointment of four additional committee members. The City Council adopted Resolution No. 24-11 that created and appointed the 2024 AHAC. The duties of the AHAC included reviewing policies and procedures, ordinances, land development regulations and the City’s adopted comprehensive plan and recommending specific actions or initiatives to encourage or facilitate affordable housing. Per state statute, at a minimum, the AHAC is required to review and consider recommendations on the following: 1) The processing of approvals of development orders or permits, as defined in F.S.163.3164 (7) and (8), for affordable housing projects is expedited to a greater degree than other projects. Draft City Council Meeting Minutes December 19, 2024 Page 7 City of Clearwater 2) The modification of impact-fee requirements, including reduction or waiver of fees and alternative methods of fee payment for affordable housing. 3) The allowance of flexibility in densities for affordable housing. 4) The reservation of infrastructure capacity or housing for very low-income persons, low-income persons, and moderate-income persons. 5) The allowance of affordable accessory residential units in residential zoning districts. 6) The reduction of parking and setback requirements for affordable housing. 7) The allowance of flexible lot configurations, including zero-lot-line configurations for affordable housing. 8) The modification of street requirements for affordable housing. 9) The establishment of a process by which a local government considers, before adoption, policies, procedures, ordinances, regulations, or plan provisions that increase the cost of housing. 10) The preparation of a printed inventory of locally owned public lands suitable for affordable housing. 11) The support of development near transportation hubs and major employment centers and mixed-use developments. In addition to these eleven required criteria, the 2023 AHAC continued five additional types of incentives in the following areas: 12)Adaptive reuse 13) Land Development Code 14) Communication and Marketing of Affordable Housing 15) Financing 16) Partnerships Throughout the fall of 2024, consultant Wade Trim, along with Economic Development and Housing Department staff and Planning and Development Department staff, facilitated discussion at four meetings of the AHAC. The meetings centered around reviewing the 2023 LHIS to discuss whether any changes should be made as well as to consider new strategies to incentivize development of affordable housing. The LHIS encompasses the definition, vision, strategic focus areas and incentive recommendations in order to facilitate the development and preservation of affordable housing in the City of Clearwater. The AHAC convened on four separate occasions to develop and identify the value of affordable housing, identify the principles for Clearwater’s affordable housing and develop/confirm a vision statement to be included as part of the LHIS. The AHAC members focused on the values that affordable housing brings to the City of Clearwater. The AHAC recommended the continuation, with slight modifications in some cases, of recommendations made by prior AHAC committees. This year’s committee recommended several language changes Draft City Council Meeting Minutes December 19, 2024 Page 8 City of Clearwater to incorporate more affirmative language in the document. The committee also made several recommendations that will require additional staff resources. The following list contains excerpts incorporating substantive changes from the previous report to produce the 2024 LHIS Report: 1.2 Create a process and definitive project requirement checklist for affordable housing projects for each level of review and stage of permitting, starting with an “affordable housing project” checkbox on application form(s) as applicable. 5.4 Consider educational and financial incentives that reduce barriers to the rehabilitation and construction of accessory dwelling units, such as information about the permitting process specific to accessory dwelling units, rebates, or other fee reductions. 14.1 Conduct an educational campaign, in conjunction with regular City communications, to rebrand affordable housing as workforce or attainable housing that supports the diverse needs of residents through a variety of unit/product types compatible with the City’s neighborhoods. (Expand terminology to include “attainable housing”) 16.1 Partner with lenders, realtors, title companies, inspectors, and contractors through regular outreach to increase knowledge of the City’s housing assistance programs, provide guidelines and training to improve compliance, and facilitate opportunities for qualified contractors to bid projects. The LHIS report is due annually. The staff recommendation is for City Council to accept the 2024 LHIS Report. Staff will submit the report to the Florida Housing Finance Corporation no later than December 31, 2024. Per State Statute, the city shall update its Local Housing Assistance Plan to incorporate the recommended incentives it desires to implement. This year’s LHIS update includes recommendations that were approved by the AHAC on December 3rd, 2024. STRATEGIC PRIORITY: 2.4 - Supports equitable housing programs that promote household stability and reduce the incidence of homelessness within Clearwater. Councilmember Mannino moved to accept the 2024 Local Housing Incentive Strategy (LHIS) Report developed by the Affordable Housing Advisory Committee (AHAC). The motion was duly seconded and carried unanimously. 7.2 Approve the annexation, initial Future Land Use Map designation of Residential Urban (RU) and initial Zoning Atlas designation of Low Medium Density Residential (LMDR) District for 1755 St. Anthony Drive and pass Ordinances 9802-25, 9803-25, and Draft City Council Meeting Minutes December 19, 2024 Page 9 City of Clearwater 9804-25 on first reading. (ANX2024-10008) This voluntary annexation petition involves a 0.150-acre property consisting of one parcel of land occupied by a detached dwelling. The property is located on the east side of St. Anthony Drive, approximately 340 feet south of St. Croix Drive. The applicant is requesting annexation in order to receive sanitary sewer and solid waste service from the city. The property is located within an enclave and is contiguous to existing city boundaries on all sides. It is proposed that the property be assigned a Future Land Use Map designation of Residential Urban (RU) and a Zoning Atlas designation of Low Medium Density Residential (LMDR). The Planning and Development Department determined that the proposed annexation is consistent with the provisions of Community Development Code Section 4-604.E as follows: • The property currently receives water service from Pinellas County. The closest sanitary sewer line is located behind the subject property to the east in a utility easement. The applicant has paid the city's sewer impact and assessment fees and is aware of the additional costs to extend city sewer service to this property. Collection of solid waste will be provided by the city of Clearwater. The property is located within Police District III and service will be administered through the district headquarters located at 2851 McMullen Booth Road. Fire and emergency medical services will be provided to this property by Station #48 located at 1700 North Belcher Road. The city has adequate capacity to serve this property with sanitary sewer, solid waste, police, fire and EMS service. The property will continue to receive water service from Pinellas County. The proposed annexation will not have an adverse effect on public services and their levels of service; and • The proposed annexation is consistent with and promotes the following objective and policy of Clearwater 2045, the city’s Comprehensive Plan: Objective PI 9.1 Continue to work with Pinellas County in the orderly annexation of the city’s existing enclaves. Policy PI 9.1.2 Continue to process voluntary annexations for single-family residential properties upon request. • The proposed Residential Urban (RU) Future Land Use Map category is consistent with the current Countywide Plan designation of the property. This designation primarily permits residential uses at a density of 7.5 units per acre. The proposed zoning district to be assigned to the Draft City Council Meeting Minutes December 19, 2024 Page 10 City of Clearwater property is the Low Medium Density Residential (LMDR) District. The use of the subject property is consistent with the uses allowed in the district and the property exceeds the district’s minimum dimensional requirements. The proposed annexation is therefore consistent with the Countywide Plan and the city’s Comprehensive Plan and Community Development Code; and • The property proposed for annexation is contiguous to existing city boundaries on all sides; therefore, the annexation is consistent with Florida Statutes Chapter 171.044. STRATEGIC PRIORITY: This annexation petition supports the Deliver Effective and Efficient Services by Optimizing City Assets and Resources goal of the city’s Strategic Plan by reducing enclaves and delivering city services to properties within the city’s service boundary. This petition also supports Ensure Exceptional Communities and Neighborhoods Where Everyone Can Thrive goal by better unifying neighborhoods and reducing issues with multiple jurisdictions. Ordinances 9802-25, 9803-25, and 9804-25 were presented and read by title only. Councilmember Cotton moved to approve the annexation, initial Future Land Use Map designation of Residential Urban (RU) and initial Zoning Atlas designation of Low Medium Density Residential (LMDR) District for 1755 St. Anthony Drive and pass Ordinances 9802-25, 9803-25, and 9804-25 on first reading. The motion was duly seconded and upon roll call, the vote was: Ayes: 5 - Mayor Rector, Vice Mayor Allbritton, Councilmember Cotton, Councilmember Mannino and Councilmember Teixeira 7.3 Continue to a date uncertain: Approve amendment to the Community Development Code to establish standards for artificial turf, require landscaped areas in front yards for residentially zoned properties, clarify the use of nonliving landscape materials, and make other associated updates, and pass Ordinance 9805-25 on first reading. (TA2024-07002) The Community Development Board met on November 19, 2024, and voted to continue TA2024-07002 to their January 21, 2025 meeting with a workshop to discuss the ordinance at the December 17, 2024 meeting. Draft City Council Meeting Minutes December 19, 2024 Page 11 City of Clearwater No action taken. 7.4 City of Clearwater Red-Light Camera Annual Report In accordance with the July 2024 legislative changes to Florida State Statute 316.0083 - Mark Wandall Traffic Safety Program - the annual report detailing the results of all red-light cameras (traffic infraction detectors) within the City of Clearwater will be presented to the Clearwater City Council. As part of the City of Clearwater's Traffic Safety Improvement Program, Red Light Cameras were installed at three intersections to reduce the occurrence of red-light running crashes and the injuries or fatalities associated with these incidents. The City of Clearwater identified three intersections with elevated rates of red-light violations and related crashes, based on data from 2009 to 2010. Initially, Redflex Inc. managed the program. In June 2021, following the completion of an acquisition, Redflex Inc. became a wholly owned subsidiary of Verra Mobility. The "Warning" and "Public Education" campaign commenced on July 1, 2012, and concluded on July 30, 2012. The "Notice of Violation" period began on July 31, 2012, at 12:01 AM. At the January 18, 2024, City Council meeting, the Council approved a 5-year renewal agreement with Verra Mobility for Red Light Cameras. The day-to-day operations of the program are handled by a part-time/permanent Police Service Technician (PST). Since the program's inception and still ongoing, the Clearwater Police Department monitors Red Light cameras at the following intersections: Gulf to Bay Boulevard and Belcher Road - Eastbound Gulf to Bay Boulevard and Belcher Road - Westbound Fort Harrison Avenue and Chestnut Street - Eastbound In July 2024, the Legislature revised reporting requirements under Florida State Statue 316.0083 Mark Wandall Traffic Safety Program. Municipalities must prepare an annual report of the results of all red-light cameras (traffic infraction detectors) that must be placed on the agenda. Draft City Council Meeting Minutes December 19, 2024 Page 12 City of Clearwater The summary report includes data gathered by the City, in conjunction with City’s red light camera vendor, Verra Mobility, during the reporting period of July 1, 2023 through June 30, 2024. STRATEGIC PRIORITY: High Performing Government, specifically strategic objective 1.4 to foster safe and healthy communities in Clearwater through first-class public safety and emergency response services. Police Chief Eric Gandy provided PowerPoint presentation. One individual spoke in opposition. One individual submitted an email expressing concerns with the program (see page 17). In response to questions, Chief Gandy said he is not aware of the State providing funding to assist with red-light programs. There is no desire by law enforcement agencies to implement school speed enforcement cameras in Pinellas County. He said the City receives 50.8% of the fine associated with uniform traffic citations. The citations are issued for the purpose of changing behavior. Less than 1% of the 600,000 vehicles that go through the intersection are given a citation. There are over 50 red-light cameras in Tampa. He said Clearwater is the only municipality with a red-light camera program within Pinellas County. There have been some issues associated with the company that bought Redflex; staff is learning the new back-end software the vendor recently purchased. Chief Gandy said the noticing issues have been related to vehicle owners not properly updating their vehicle registration. 7.5 Approve the 2025 State Legislative Agenda. Councilmember Teixeira moved to approve the 2025 State Legislative Agenda. The motion was duly seconded and carried unanimously. 7.6 Reaffirm that portions of the former Harborview Property are unnecessary for public purposes; that disposal of said land is in the best interest of the Public; authorizing conveyance of the land by warranty deed pursuant to the terms of the purchase and sale agreement; authorizing the appropriate officials to execute said deed; releasing any automatic reservation and right of entry in accordance with F. S. 270.11, authorize the appropriate officials to execute same, and adopt Resolution 24-20. Draft City Council Meeting Minutes December 19, 2024 Page 13 City of Clearwater On August 4, 2022, the City Council approved a Purchase and Sale Agreement for the former Harborview site, previously addressed as 320 Cleveland Street, and being re-addressed as 50 N. Osceola Ave. The PSA contemplates a Closing Date by December 31, 2024, barring unusual circumstances. The PSA requires the buyer to obtain all pre-development approvals, such as an approved site plan and building permit, and to provide the City with satisfactory evidence of adequate financing and construction agreements in place prior to closing. The proposed resolution complies with the current title commitment’s requirements and authorizes the appropriate officials to execute a warranty deed and other conveyance documents as necessary in order to convey marketable title in accordance with the terms of the Purchase and Sale Agreement, which will occur upon the satisfaction of all closing conditions. Purchaser Representative Katie Cole said an updated title commitment was received from the City's underwriter on Monday, as well as the updated survey. Closing is expected on December 31, 2024. Resolution 24-20 was presented and read by title only. Vice Mayor Allbritton moved to reaffirm that portions of the former Harborview Property are unnecessary for public purposes; that disposal of said land is in the best interest of the Public; authorizing conveyance of the land by warranty deed pursuant to the terms of the purchase and sale agreement; authorizing the appropriate officials to execute said deed; releasing any automatic reservation and right of entry in accordance with F. S. 270.11, authorize the appropriate officials to execute same, and adopt Resolution 24-20. The motion was duly seconded and upon roll call, the vote was: Ayes: 5 - Mayor Rector, Vice Mayor Allbritton, Councilmember Cotton, Councilmember Mannino and Councilmember Teixeira 8. Second Readings - Public Hearing 8.1 Adopt ordinance 9806-24 on second reading, amending Clearwater Code of Ordinances Chapter 22, Article II, Section 22.24, to correct the name of McKay Playfield to McKay Park; change the operating hours of McKay Park from closed between sunset to sunrise to closed between 9:00 p.m. and 7:00 a.m.; add six parks (Mercado, Bayshore Trail, North Betty Lane Neighborhood Park, Lake Chataqua Equestrian Park and Nature Preserve, McLennan Circle Park and Rainbow Drive Park); remove one park (Holt Avenue). Draft City Council Meeting Minutes December 19, 2024 Page 14 City of Clearwater Proposed Ordinance No. 9806-24 will correct the name of McKay Playfield to McKay Park as consistent with existing nomenclature which typically calls other similar Department facilities “Parks” and change the operating hours of same from closed between sunset to sunrise to closed between 9:00 p.m. and 7:00 a.m. The City is in the process of updating and renovating McKay Park with a new playground and six pickleball courts. These upgrades are the result of public input. That same public input also suggested that the current hours were too limiting with which the Department agrees. It should be noted that the immediate area is generally within the Old Florida character district of the Beach by Design planning area, Tourist (T) zoning district and the Resort Facilities High (RFH) future land use classification. The Old Florida District envisions the redevelopment of this area primarily with overnight accommodation and attached dwelling uses with some limited retail/commercial and mixed-use developments along Mandalay Avenue. The immediate vicinity is characterized by a variety of overnight accommodation, retails sales and service, restaurants, bars, and attached dwelling uses. The properties to the north are predominantly developed with attached dwellings, overnight accommodations, restaurants, retail sales and service and bars. The proposed hours of operation are anticipated to the compatible with the character of the surrounding area. The Department has determined that the proposed change in the hours of operation are consistent with Goals PPP 1 and 2 and Policies PPP 1.1.1 and 2.2.5 of the Parks & Public Places Element of the City’s Comprehensive Plan as well as the intent and purpose of the Open Space/Recreation zoning district of the City’s Community Development Section 2-1401 which provides that is to establish areas where public and private organizations can establish and operate passive and active open space and recreation facilities which are important to the quality of life and economic vitality of the City of Clearwater without adversely impacting the integrity of adjacent residential neighborhoods, diminishing the scenic quality of the City of Clearwater or negatively impacting the safe and efficient movement of people and things within the City of Clearwater. In addition, the proposed Ordinance will be updated to reflect five existing parks including Bayshore trail, North Betty Lane Neighborhood Park, Lake Chataqua Equestrian Park & Nature Preserve, McLennan Circle Park and Rainbow Drive Park and one new park, the Mercado. All five of the existing parks will be closed Sunset to Sunrise (open Sunrise to Sunset) while the Mercado will be closed between 9:00 p.m. and 6:00 a.m. Finally, the proposed Ordinance will remove the Holt Avenue Property as that land area has been incorporated into the Phillip Jones Park. STRATEGIC PRIORITY: Approval of the name and operating hours modifications support several Draft City Council Meeting Minutes December 19, 2024 Page 15 City of Clearwater Strategic Plan Objectives, including: • 1.2: Maintain public infrastructure, mobility systems, natural lands, environmental resources, and historic features through systematic management efforts. • 1.3: Adopt responsive levels of service for public facilities and amenities, and identify resources required to sustain that level of service. • 2.3: Promote Clearwater as a premier destination for entertainment, cultural experiences, tourism, and national sporting events. • 3.1: Support neighborhood identity through services and programs that empower community pride and belonging. • 3.2: Preserve community livability through responsible development standards, proactive code compliance, and targeted revitalization. Ordinance 9806-24 was presented and read by title only. Councilmember Mannino moved to adopt Ordinance 9806-24 on second and final reading. The motion was duly seconded and upon roll call, the vote was: Ayes: 5 - Mayor Rector, Vice Mayor Allbritton, Councilmember Cotton, Councilmember Mannino and Councilmember Teixeira 9. City Manager Reports The City Manager thanked staff for an extraordinary year. The team did a great job and she looks forward to the upcoming year. 10. City Attorney Reports The City Attorney wished all a Merry Christmas and a Happy Hannukah. 11. Other Council Action 11.1 Temporary Suspension of Council Rules The City Attorney said he is working on the resolution, as directed by Council, to present at the next work session. The question before Council tonight is whether to extend the temporary pause that is in effect for another 30 days. Two individuals supported town hall discussions. One individual spoke in opposition. Discussion ensued with comments made that there is no constitutional right to have an agenda item at a business meeting to discuss whatever Draft City Council Meeting Minutes December 19, 2024 Page 16 City of Clearwater a citizen wants to discuss and that quarterly town halls around the city would be a great opportunity for Council to hear from citizens. A comment was made that citizens should be given an opportunity to speak before the Council. Councilmember Mannino moved to extend the temporary suspension of Council Rules, that portion related to Citizens to be Heard on Items not on the Agenda, to January 30, 2025. The motion was duly seconded and carried with the following vote: Ayes: 4 - Mayor Rector, Vice Mayor Allbritton, Councilmember Mannino and Councilmember Teixeira Nays: 1 - Councilmember Cotton 12. Closing comments by Councilmembers (limited to 3 minutes) Councilmembers wished all a Merry Christmas, a Happy Hanukkah, a safe New Year, and wished the City Manager and Assistant City Manager Slaughter a Happy Birthday. Vice Mayor Allbritton said he was saddened to hear Clearwater native and volunteer William B. Wallace passed away and offered condolences to his loved ones. Councilmember Teixeira reviewed recent events. 13. Closing Comments by Mayor Mayor Rector reviewed recent and upcoming events, wished all a Merry Christmas, and wished William Monfort, the oldest living veteran in Florida, a Happy Birthday. 14. Adjourn The meeting adjourned at 7:17 p.m. Mayor City of Clearwater Attest City Clerk Draft Cover Memo City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 File Number: ID#24-1560 Agenda Date: 1/16/2025 Status: Consent AgendaVersion: 1 File Type: Action ItemIn Control: City Manager's Office Agenda Number: 6.1 SUBJECT/RECOMMENDATION: Approve a four-year funding agreement in the amount not to exceed $130,625.22 between the Pinellas Suncoast Transit Authority (PSTA) and the City of Clearwater for expanded Ferry Services and authorize the appropriate officials to execute same. (consent) SUMMARY: In the ongoing effort to relieve traffic congestion, address parking challenges, and provide alternative forms of transportation, PSTA has worked in collaboration with city staff in Clearwater and Dunedin to obtain a grant to expand ferry services. PSTA has obtained a grant to support this endeavor. The City of Clearwater already has an agreement with the Clearwater Ferry to provide ferry services between these two locations for 10-hours on Friday, Saturday and Sunday. As part of the grant administered by PSTA, PSTA and the city staff seek to expand ferry services to include 10-hours of service on Thursday from the Clearwater Downtown Marina and the Clearwater Beach Marina. The Clearwater Ferry was selected by PSTA through a competitive process to provide the expanded ferry service. PSTA has a separate agreement with the Clearwater Ferry to provide expanded ferry services, and the Thursday service is contracted by PSTA with the Clearwater Ferry in a separate agreement. The annual cost associated to expand service coverage on Thursdays would be $65,312.61, with the PSTA grant paying 50%, or $32,656.30, of the cost and the City of Clearwater covering the other 50%. Based on the agreement, the City of Clearwater would have a not to exceed responsibility for no more than $32,656.31 per fiscal year. PSTA has agreed to pay the City of Clearwater $100,000 to help offset the subsidies the City has already paid the Clearwater Ferry for expanded service and equipment, resulting in a net cost of $7,656.30 per year to add the Thursday service. The term of the agreement would be from date of approval through September 30, 2028. There is a one-time, three-year renewal option. APPROPRIATION CODE AND AMOUNT: A first quarter amendment will establish special program 181-M2503, Clearwater Ferry - PSTA, to account for revenues and expenditures associated with this agreement. STRATEGIC PRIORITY: 4.4 Develop accessible and active transportation networks that enhance pedestrian safety and reduce citywide greenhouse gas emissions. Page 1 City of Clearwater Printed on 1/14/2025 Clearwater Ferry Red line and Blue Line 10 hour Per Day Service The purpose of this chart is to show what Clearwater is paying out of their funds. City of Clearwater Contributions FY 25 FY 26 CAPITAL CONTRIBUTION: Vessel (November Delivery)200,000.00$ OPERATING CONTRIBUTION: Redline 10 Hour Per Day (Friday - Sunday) Grant Match 25,500.00$ 11,390.00$ Redline 10 Hour Per Day (Thursday) PSTA Grant Match 32,656.31$ 32,656.31$ Total Operating Contribution 58,156.31$ 44,046.31$ Total City Contribution to CLW Ferry 258,156.31$ 44,046.31$ FDOT Grant Grant Match Assumptions: Clearwater: Clearwater is currently paying for the Friday - Sunday Service Clearwater will be adding Thursday Service Under the PSTA Grant Clearwater Thursday Service is $65,312.61. The grant will pay $32,656.30 and Clearwater will pay $32,656.31 per year of service. Dunedin: Dunedin will contract for Thursday and Fri - Sunday Service Thursday Service Total Cost =58,840.61$ Fri-Sunday Service Total Cost = 189,195.63$ Total Dunedin Service Cost =248,036.24$ 50% Grant Match =124,018.12$ PSTA GRANT AND LOCAL MATCH CONTRIBUTIONS TO MATCH SERVICE Funding Source FY 25 FY 26 FDOT PSTA Service Grant 156,674.43$ 156,674.43$ City of Clearwater for PSTA Match 32,656.31$ 32,656.31$ City of Dunedin for PSTA Match 124,018.12$ 124,018.12$ Total Match 156,674.43$ 156,674.43$ Note: The cost per hour of service remains the same for FY 25-27. FY 28 and beyond is subject to renewal based on funding and the price negotiated. FY 27 FY 28 Total 200,000.00$ 3,438.00$ 40,328.00$ 32,656.31$ 32,656.31$ 130,625.22$ 36,094.31$ 32,656.31$ 170,953.22$ 36,094.31$ 32,656.31$ 370,953.22$ 655,000.00$ 655,000.00$ 1,310,000.00$ Clearwater Thursday Service is $65,312.61. The grant will pay $32,656.30 and Clearwater will pay $32,656.31 per year of service. FY 27 FY 28 Total 156,674.43$ 156,674.43$ 626,697.70$ 32,656.31$ 32,656.31$ 130,625.22$ 124,018.12$ 124,018.12$ 496,072.48$ 156,674.43$ 156,674.43$ 626,697.70$ Note: The cost per hour of service remains the same for FY 25-27. FY 28 and beyond is subject to renewal based on funding and the price negotiated. CLEARWATER FERRY FUNDING AGREEMENT THIS CLEARWATER FERRY FUNDING AGREEMENT (“Agreement”)is entered into effective , 2024 (“Effective Date”) by and between the PINELLAS SUNCOAST TRANSIT AUTHORITY, an independent special district, with its principal place of business located at 3201 Scherer Drive, St. Petersburg, FL 33716 (“PSTA”), and the CITY OF CLEARWATER, FLORIDA, a municipal corporation, with its principal place of business located at 600 Cleveland Street, Clearwater, Florida 33756 (“City of Clearwater”),(collectively, the “Parties”). WHEREAS, pursuant to that certain Clearwater Ferry Operation Agreement (“Operation Agreement”) with Clearwater Ferry Services, LLC (“Vendor”), which is attached to this Agreement as Exhibit A, PSTA has procured the use of ferry services to the public in and around the City of Clearwater (“Ferry Services”); and WHEREAS, the Operation Agreement provides that PSTA will make certain funding contributions to Vendor in exchange for ferry services; and WHEREAS, the Parties, recognizing the benefits that the Ferry Services provided by Vendor will bring, desire to make a contribution to PSTA toward PSTA’s financial obligations under the Operation Agreement, on the terms and conditions set forth in this Agreement; and WHEREAS, PSTA will not enter into the Operation Agreement without the shared contributions of the City of Clearwater, as contemplated by this Agreement. NOW THEREFORE, in exchange for good and valuable consideration, the receipt and sufficiency of which is hereby acknowledged, the Parties hereby agree as follows: 1.RECITALS AND EXHIBITS. The above recitals and attached exhibits are true and correct and incorporated herein by reference. 2.CONTRIBUTION. City of Clearwater will contribute toward PSTA’s financial obligations under the Operation Agreement for the Ferry Services beginning with the fiscal year beginning October 1, 2024 and ending September 30, 2025 (“FY 2025”) in exchange for Ferry Services for 10-hours a day on every Thursday between the Clearwater Beach Marina and the Clearwater Downtown Marina. 3.PAYMENT. PSTA shall send an invoice to the City of Clearwater no later than the 15th day of the month following the service which will be based on vendor revenue hours approved by PSTA. The contributions made under this Agreement and sent via invoice will be paid directly to PSTA on the 15th day of the month following receipt of each invoice. In any event, the total contribution amount from the City of Clearwater shall not exceed $237,886 for the life of the agreement, or $57,073 annual average. 4.ANNUAL APPROPRIATIONS: FAILURE TO MAKE PAYMENT. In the event that the City of Clearwater determines that sufficient budgeted funds are not available to appropriate for payments due to PSTA under this Agreement, the City of Clearwater shall notify PSTA of such occurrence and this Agreement shall terminate on the last Page 2 of 4 day of the then current fiscal period, and the City of Clearwater shall not owe PSTA any further contribution towards PSTA’s financial obligations under the Operation Agreement. However, in the event this Agreement is terminated, such termination may result in the termination of the Ferry Services. For purposes of this Section, the term “fiscal period” means the period between October 1st and September 30th. 5.EFFECTIVE DATE; CONFLICTS. This Agreement shall take effect on the Effective Date and shall continue through September 30, 2028, the expiration or termination of the Operation Agreement, however terminated, or expiration or termination of this Agreement as provided herein, whichever occurs first. To the extent that this Agreement conflicts with the Operation Agreement, the provisions of this Agreement shall govern. This Agreement may be renewed for one additional three-year term upon the mutual written agreement of the Parties. 6.DOCKING LOCATION. The City of Clearwater will provide a docking location at the Clearwater Beach Marina and the Clearwater Downtown Marina for the Clearwater Ferry for the purpose of passenger pick-up and drop-off during the duration of this Agreement. 7.REPRESENTATIONS AND WARRANTIES. The Parties represent and warrant that they are authorized to enter into this Agreement without the consent or joinder of any other person or entity and that the individuals executing this Agreement have full power and authority to bind their respective parties hereto. Nothing contained herein shall be construed to limit or waive any of PSTA’s rights under the Operation Agreement. 8.INDEMNIFICATION. To the fullest extent permitted by law, each party agrees to assume liability for and indemnify, hold harmless and defend the other party, its mayor, commissioners, officers, board members, executives, employees, and agents from and against all liability and expense, including reasonable attorneys’ fees, in connection with any and all claims, demands, damages, actions, causes of action, and suits in equity of whatever kind or nature, including claims for breach of contract, personal injury, property damage, equitable relief, or loss of use arising out of its respective obligations under this Agreement, excluding only claims arising out of the negligence, recklessness, willful disregard for human life or property or wanton misconduct of the party to be indemnified hereunder. Pursuant to section 768.28(19), Florida Statutes, nothing contained herein shall be construed to require any party to indemnify or ensure the other party for the other party’s negligence or to assume any liability for the other party’s negligence. Nothing contained in this Agreement and specifically this indemnification provision is intended to nor shall it in any way be construed as an additional waiver of sovereign immunity beyond the expressed written contractual obligations of the respective parties contained within this Agreement. Excluded from any indemnification obligation are any claims for which either party is immune from suit under the doctrine of sovereign immunity or for any amount of a claim exceeding the limitations of liability established by section 768.28, Florida Statutes. The obligations contained in this paragraph shall survive the termination of this Agreement, Page 3 of 4 however terminated and shall not be limited by the amount of any insurance required to be obtained or maintained under this Agreement. PSTA shall not indemnify or hold harmless the City for any claims, damages, losses, liabilities, or expenses arising out of or resulting from the negligent acts or omissions of the Ferry Operator. This exclusion applies regardless of the cause or any contributory factors to such negligence. PSTA shall require the Ferry Operator to indemnify, defend and hold harmless the City from and against any and all claims, damages, losses, liabilities, or expenses arising out of or resulting from the acts or omissions of the Ferry Operator in connection with the operations of the ferry service. 9.ELECTRONIC SIGNATURES; COUNTERPARTS. This Agreement may be executed by electronic signature technology and such electronic signature shall act as the Parties’ legal signatures on this Agreement and shall be treated in all respects as an original handwritten signature. This Agreement may be executed in one or more counterparts, any one of which need not contain the signatures of more than one party, but all such counterparts taken together will constitute one and the same instrument. IN WITNESS WHEREOF, the Parties have caused this Agreement to be executed as of the date first above written. [SIGNATURE PAGE FOLLOWS] Page 4 of 4 ATTEST: PINELLAS SUNCOAST TRANSIT AUTHORITY _________________________ ________________________________ Rachael Cappolla Brad Miller, Chief Executive Officer Executive Assistant/Records Manager APPROVED AS TO FORM: ________________________ Alan S. Zimmet, General Counsel Countersigned: CITY OF CLEARWATER, FLORIDA ______________________________ __________________________________ Mayor City Manager Approved as to form: Attest: _________________________ _________________________________ City Attorney City Clerk For Cover Memo City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 File Number: ID#24-1621 Agenda Date: 1/16/2025 Status: Consent AgendaVersion: 1 File Type: Action ItemIn Control: Economic Development & Housing Agenda Number: 6.2 SUBJECT/RECOMMENDATION: Authorize City of Clearwater Interim Economic Development Director to enter into negotiations with the Clearwater Urban Leadership Coalition (CULC) for the leasing of certain real properties located at 1321 N. Martin Luther King, Jr. Avenue, 1317 N. Martin Luther King, Jr. Avenue, and 1106 Tangerine Street along with certain property owned by the City of Clearwater Community Redevelopment Agency (CRA) located at 1325 N. Martin Luther King, Jr. Avenue to CULC. (consent) SUMMARY: The purpose of this item is to select CULC as the recommended respondent for Letters of Interest 01-25 (LOI) and to authorize City of Clearwater staff to enter into negotiations with CULC to prepare a lease and operation agreement for the development and use of certain adjacent parcels located within the North Greenwood Community Redevelopment Agency boundaries. The City is the owner of the parcels located at 1321 N. Martin Luther King, Jr. Avenue, Clearwater, FL 33755; 1317 N. Martin Luther King, Jr. Avenue, Clearwater, FL 33755; and 1106 Tangerine Street, Clearwater, FL 33755 (collectively the “City Parcels”). The CRA is the owner of the parcel located at 1325 N. Martin Luther King, Jr. Avenue, Clearwater, FL 33755 (the “CRA Parcel”). All four of these parcels will be subject to the lease and operation agreement for a unified project. The City and CRA jointly issued the LOI for the lease and development of the City Parcels and the CRA Parcel as a mini outdoor mall/shipping container village. The parcels collectively have a total land area of 0.347 acres and are within the North Greenwood MLK Corridor. The City and CRA received one response to the LOI being the proposal from CULC. The LOI review committee (Committee) read the proposal and evaluated the project budget, a financial strategy, and a plan of redevelopment of the City Parcels and CRA Parcel. CULC is proposing to accommodate no less than fifteen businesses to occupy this space. In the event the parties can come to agreement on a lease and operation agreement, CULC will receive $500,000.00 from the CRA for this project. Certain points to be discussed with CULC in relation to the lease and operating agreement include: ·A potential 5-year initial lease with renewal options, with CULC responsible for all utilities, property taxes, building insurance, and maintenance. ·Potential deferment of rent until the Certificate of Occupancy is issued, after that rent will be adjusted to a rate acceptable to both the City and the CRA. ·CULC must obtain liability insurance acceptable to the CRA and City. ·The CRA’s participation in vetting businesses that will lease space within the development. ·A requirement that CULC submit quarterly reports on the project's progress and milestone for the next quarter. ·CULC’s potential partnership with M1 Containers, the design-build firm behind the Krate at the Grove project in Wesley Chapel, to oversee the construction of container-based spaces. ·The CRA will provide up to $500,000 in funding for eligible expenses directly related to the project, such as the purchase of containers, construction, design, and permitting, with disbursements tied to verified project milestones. CRA funds will not be used for any purposes prohibited by state statutes Page 1 City of Clearwater Printed on 1/14/2025 File Number: ID#24-1621 governing their use. The proposed project meets the requests outlined in the LOI and the Committee recommends selecting CULC as the winning respondent and authorizing city staff to enter into negotiations for the preparation of a lease and operation agreement. APPROPRIATION CODE AND AMOUNT: N/A USE OF RESERVE FUNDS: N/A STRATEGIC PRIORITY: 2.1 Strengthen public-private initiatives that attract, develop, and retain diversified business sectors. 2.2 Cultivate a business climate that welcomes entrepreneurship, inspires local investment, and supports Eco-friendly enterprises, and encourages high-quality job growth. Page 2 City of Clearwater Printed on 1/14/2025 CITY OF CLEARWATER AND COMMUNITY REDEVELOPMENT AGENCY OF CITY OF CLEARWATER NOTICE OF DISPOSITION OF REAL PROPERTY WITHIN THE NORTH GREENWOOD COMMUNITY REDEVELOPMENT AREA Pursuant to Fla. Stat. § 163.380, joint no�ce is hereby given by the Community Redevelopment Agency of the City of Clearwater (the “CRA”) and the City of Clearwater (the “City”) that sealed Leters of Interest (“LOIs”) will be received un�l 10:00 AM, Local Time, November 1st, 2024, from persons interested in purchasing and developing a mini- mall/shipping container village on the proper�es located at 1325 N. MLK Jr. Ave., Clearwater, FL 33755, , 1321 N. MLK Jr. Ave., Clearwater, FL 33755, 1317 N. MLK Jr. Ave., Clearwater, FL 33755, and 1106 Tangerine St., Clearwater, FL 33755 which bear the Parcel I.D. No.(s) 10-29-15-33534-003-0160, 10-29-15-33534-003-0170, 10-29-15-33534-003- 0180, and 10-29-15-33534-003-0190. SUBMIT LETTERS OF INTEREST TO: It is recommended that LOIs are submited electronically through our bids website at htps://www.myclearwater.com/business/rfp. Alterna�vely, proposers may mail or hand-deliver LOIs to the address below: Community Redevelopment Agency of Clearwater Atn: Economic Development & Housing Department/LOI 600 Cleveland Street, 6th Fl, Clearwater, FL 33755 No responsibility will atach to the City of Clearwater or the Community Redevelopment Agency of Clearwater, its employees, or agents for premature opening of a proposal that is not properly addressed and iden�fied. Email or fax submissions will not be accepted. Late submitals will not be considered. DESCRIPTION. The City of Clearwater and the CRA seek an interested party to develop and operate a mini outdoor mall/shipping container village at the N.E. quadrant of North Mar�n Luther King Jr. Ave and Tangerine St. The conceptual site plan should take into account design standards and community development code requirements. The combined proper�es have a total land area of .347 acres and are zoned Commercial and Medium Density Residen�al. LOIs are limited to 2,000 words or fewer, must include a detailed project budget, a financing strategy, and a plan for redevelopment. For ques�ons and more informa�on, please contact Eric San�ago by email at Eric.San�ago@myclearwater.com. The City and CRA shall consider all proposals received in a �mely manner. The City and CRA reserves the right to reject any or all LOIs, to waive technicali�es, to re-adver�se, and to otherwise conduct this request for LOIs in the manner it deems to be in the best interests of the public. Gloria Campbell, Executive Director Clearwater Urban Leadership Coalition 1419 N. Betty Lane Clearwater, FL 33755 Gloriadcampbell@gmail.com 727-434-0072 October 29, 2024 City of Clearwater Community Redevelopment Agency Attn: Economic Development & Housing Department 600 Cleveland Street, 6th Fl Clearwater, FL 33755 Subject: Letter of Interest for Long-Term Lease and Development of a Mini Mall/Shipping Container Village Dear Members of the Clearwater Community Redevelopment Agency and City of Clearwater, On behalf of the Clearwater Urban Leadership Coalition (CULC), I am thrilled to submit our Letter of Interest for the long-term lease and development of a vibrant mini mall/shipping container village within the North Greenwood Community Redevelopment Area. If successful, CULC will then petition to purchase project properties for a fair value. This project is not merely a proposal; it is a transformative opportunity to rejuvenate the MLK corridor, serve the public interest, serve as a business incubator, and closely align with the goals outlined in the North Greenwood Community Redevelopment Area Plan. A Vision for Transformation Imagine a bustling marketplace where local entrepreneurs can thrive, cultural expressions are celebrated, and the community unites in meaningful ways. We envision the mini mall/shipping container village as a cornerstone for revitalizing North Greenwood-a dynamic destination that attracts visitors from near and far. Ml Containers will serve as the design-build firm for this project, bringing their expertise and innovation to create a unique space that reflects our community's spirit. As the project manager, CULC will oversee the development, ensuring that every aspect meets the highest standards of quality and community relevance. Support for the Project The Clearwater Urban Leadership Coalition's Board of Directors is in full support of this initiative. Their commitment underscores the urgency and importance ofrevitalizing the North Greenwood area, particularly the MLK corridor. Additionally, we are pleased to note that the former City Manager and the City Counci l were in full support of this project during their tenure. Their advocacy and guidance have paved the way for us to move forward with this exciting initiative, and we are eager to build on the foun dation they have established. Funding Commitment To realize the development of this project, the Coalition wishes to secure a commitment of $500,000 from the Community Redevelopment Agency. The City Council in 2023, came to a consensus to set aside $500,000 for a container village in North Greenwood. This funding will be instrumental in covering development costs and ensuring the successful launch of the mini mall/shipping container village. Preliminary Schedule Once we receive approval from the Community Redevelopment Agency and the City of Clearwater, the Coalition will immediately begin pursuing the necessary permits for the project. We will collaborate closely with the City's Planning and Development Department to submit site and building plans that are fully compliant with City codes. Our goal is to obtain approval through a Development Order, allowing us to commence construction as soon as possible. We anticipate that these initial steps, including permitting and planning, will occur within the first quarter of 2025. Through our partnership with MI Containers, we have already started conversations with the City's Planning and Development Department through their Building Plan Review Committee (BPRC) to begin the design of the project in compliance with the City's development standards. Why This Project Matters 1. Revitalizing the MLK Corridor: This development will breathe new life into Martin Luther King Jr. Avenue, a historically significant area that has faced economic challenges. By establishing an attractive and bustling destination, we will transform this corridor into a vibrant hub of activity and engagement. 2. Economic Empowerment: Our mini mall will serve as a launchpad for local entrepreneurs, providing affordable retail spaces tailored for small businesses, artisans, and food vendors. This initiative aims to stimulate economic growth and create job opportunities that directly benefit our residents. 3. Public Interest and Community Benefits: This project is firmly rooted in the public interest. By enhancing the area and offering new opportunities for local businesses, we will improve the quality of life for residents and foster a greater sense of community pride. 4. Alignment with the North Greenwood Community Redevelopment Area Plan: Our proposed mini mall/shipping container village aligns seamlessly with the objectives outlined in the North Greenwood Community Redevelopment Area Plan. By focusing on economic development, community engagement, and cultural preservation, we will contribute to the vision of a thriving North Greenwood. 5. Cultural Destination: We aspire to make this mini container project a destination for Clearwater and beyond. By featuring a diverse range of offerings, including local crafts, unique culinary experiences, and cultural events, we will create a marketplace filled with the sounds of music, the aromas of delicious food, and the vibrant colors of art from our community. 6. Community Engagement: This development will prioritize community engagement, hosting events, workshops, and cultural celebrations that highlight the rich heritage of North Greenwood. Our goal is to create a gathering spot for families, friends, and visitors, fostering connections that enhance the overall community spirit. 7. Sustainable Practices: Utilizing repurposed shipping containers aligns with our commitment to sustainability. This innovative approach not only reduces waste but also demonstrates our dedication to environn1entally friendly practices. By creating a space that values both commerce and ecological stewardship, we will inspire a culture of sustainability within our community. Commitment to Excellence The Clearwater Urban Leadership Coalition is fully committed to moving this project forward. We are ready and willing to enter into any necessary agreements to ensure its success. Additionally, we will actively seek out other partners, including nonprofits and community organizations, to bring additional capacity and excitement to this initiative. By collaborating with these partners, we can provide the support and resources that our tenants need to thrive. Building a Network of Support 1. Engaging Other Nonprofits: We recognize that collaboration is key to success. We will seek partnerships with other nonprofit organizations that align with our mission and your mission and can contribute expertise in areas such as business development, workforce training, and community wellness. By building a robust network of support, we will create a comprehensive ecosystem that fosters the growth and success of our tenants. 2. Capacity Building: The participation of additional partners will enhance our ability to provide resources and training to our tenants. By hosting workshops and providing mentorship programs, we can equip entrepreneurs with the skills they need to succeed. These efforts will not only benefit individual businesses but will also strengthen the overall economic fabric of our community. We intend to approach local high schools, technical schools, and colleges (St. Pete College) for partnerships that will tremendously increase capacity building and project success, almost like a business incubator. 3. Community Events and Collaborations: We plan to organize community events in collaboration with our partners that celebrate local culture and foster community engagement. These events will draw visitors to the mini mall and create opportunities for our tenants to showcase their products and services. By working together, we can create a vibrant atmosphere that attracts foot traffic and promotes local entrepreneurship. 4. Marketing and Promotion: Collaborating with other nonprofits will also enhance our marketing efforts. By pooling resources and leveraging each partner's networks, we can effectively promote the mini mall and its tenants, ensuring that they receive the visibility and support necessary for success. 5. Continuous Improvement: We will establ ish a feedback mechanism that allows our partners, tenants, and the community to share insights and suggestions. This ongoing dialogue will help us refine our programs and initiatives, ensuring that we remain responsive to the evolving needs of our community. Our Role as Project Manager As the project manager, and land Lessee, and owner of the mini containers (structures), the Clearwater Urban Leadership Coalition will take the lead in ensuring the successful execution of the mini mall/shipping container village. Our responsibilities will include: • Overseeing Development: We will work closely with Ml Containers and other stakeholders to manage the design and construction process, ensuring that the project is completed on time and within budget. • Implementing Operational Strategies: Once the mini mall is established, CULC will oversee its operation, ensuring that it serves as a welcoming and vibrant space for tenants and visitors alike. • Sustaining the Project: We are committed to the long-term sustainability of the mini mall. After the project is complete, the Coalition will sustain its operations through fundraising efforts, rents (low), securing ongoing financial support to maintain and grow the mini mall as a community asset. This sustainability plan will include engaging local businesses and community members in fundraising initiatives and developing partnerships with philanthropic organizations. Budget Overview To ensure the viability of this project, we have prepared a preliminary budget outline that highlights the essential components of development, operation, and sustainability. This budget will be refined as we move forward, considering input from partners and stakeholders. Preliminary Budget Estimate: Category Estimated Cost Site Preparation and $200,000 Development Construction (Ml Containers) $300,000 Utilities and Infrastructure $100,000 Marketing and Promotion $50,000 Operational Expenses (First Year) $150,000 Trainin2 and Support Pro2rams $50,000 Contin2ency Fund $50,000 Total Estimated Bud2et $1,000,000 This budget serves as a foundational framework for the project's financial planning. With $500,000 secured from the Community Redevelopment Agency, we will pursue additional grants, community contributions, and sponsorships to cover the remaining costs and ensure that the mini mall is financially sustainable. Partnering for Success To maximize the impact of this initiative, we are proud to partner with Ml Containers, who will serve as the design-build firm for this project. Their years of expertise and innovative approach will ensure that the mini mall is not only functional but also visually appealing-a space that reflects the community's spirit. • Pinellas County Economic Development will help guide us in navigating the regulatory landscape and accessing resources that support business development, ensuring our project aligns with broader economic goals for the region. • Amplify Clearwater will assist in marketing the mini mall and connecting us with local businesses and entrepreneurs eager to join our vision. Their strong network and advocacy for local businesses will be crucial in building a thriving community hub. Conclusion In conclusion, we are incredibly excited about the prospect of developing a mini mall/shipping container village in the North Greenwood Community Redevelopment Area. This project represents a unique opportunity to create a vibrant destination that celebrates the spirit of our community while promoting economic growth and cultural heritage. We sincerely appreciate your consideration of our Letter of Interest for a long-term lease of the property. The Clearwater Urban Leadership Coalition is committed to fostering collaboration with the City of Clearwater and the CRA, as well as seeking additional partnerships to bring this vision to fruition. Please feel free to contact me at 727-434-0072 or email me at Gloriadcampbell@gmail.com to discuss this proposal further. Thank you for your attention to this transfom1ative opportunity. Together, we can build a brighter future for North Greenwood, turning our shared vision into a reality! Sincerely, ~~ Gloria Campbell Executive Director Clearwater Urban Leadership Coalition The Grove@1105 Container Village Development of a Container Village Executive Summary The Grove @1105 is a groundbreaking initiative designed to revitalize the North Greenwood area of Clearwater, FL, through a unique container village experience. Our container village aims to create a vibrant hub for local entrepreneurs, artists , and craftsmen, providing them an avenue to showcase their talents while fostering a deep sense of community pride. By utilizing repurposed shipping containers, we not only embrace sustainability but also reflect the innovative spirit of the neighborhood. Our space will be steeped in cultural heritage, amplifying the voices of local businesses and offering visitors a memorable shopping experience that connects them to the community. Mission Our mission is to enrich the North Greenwood community by creating a dynamic retail environment that celebrates local entrepreneurship, cultural history, and community connectivity. The Grove @1105 is dedicated to fostering economic growth while providing a platform for diverse talent to flourish. Problem North Greenwood was originally known as , simply, "The Grove," nicknamed for the large citrus orchards planted there before the turn of the 20th century. The neighborhood's main street, a north-south hardtop running from Fairmont Street in north Clearwater to the city's southern limit near Belleair Road , was known as Greenwood Avenue for over 90 years, named for the bright green jumble of palmetto patches and tangerine trees the road once cut through . Over time , during segregation, the Greenwood neighborhood evolved into the main enclave for the City of Clearwater's African-American population, gradually transforming its character from agriculture to residential with neighborhood-accommodating retail and commercial businesses. Along the "pre-King" Greenwood Avenue corridor, the beloved main street was a hotbed of precious historic neighborhood character manifesting the epicenters of healthy social, commercial and economic life in a strong community. Solution The Grove @1105 directly addresses these issues by establishing a vibrant container mini mall that serves as an incubator for local businesses. By providing affordable retail spaces and a supportive community environment, we enable entrepreneurs to showcase their products while fostering a sense of pride and collaboration among residents. Clearwater Urban Leadership Coalition Our Community Reach Community Family Fun Night Community Family Fun Night is an annual event hosted by the Clearwater Urban Leadership Coalition which continues to draw residence from near and far to the North Greenwood Community. Th is year, we were pleased to host our 1 o th annual event which drew nearly 3000 attendees from all demographics who enjoyed the ultimate welcoming experience. The success of this event dispels the myth that North Greenwood could never become a destination place that residents would be eager to come to because of safety concerns. That is unfounded and in the 10 years we've not had one incident of criminal behavior. Here is a comment which came from a first-time attendee who shares her experience. "Thank you for suggesting that I attend the 10th Annual Community Family Fun Night in Clearwater. Wow!!! What a terrific event. I felt blessed to be there. There were people of every race and color. Kids, moms and dads, aunties and elders. The vibes were wonderful, loving, happy and high energy. It put my heart on wings." Barbara St. Clair We have built and continue to cultivate relationships with government agencies, corporations and community partners who see the value of investing in this community. We believe as we begin the redevelopment effort starting with the container village, we will welcome guests from near and far who appreciate the uniqueness of our cultural and all that it has to offer. Why we are the best fit for this project The relationship that we have built within the North Greenwood community and beyond, positions us with an advantage to successfully manage this project and work to bring out the very best in what this community has to offer, Primary Products & Services The Grove @1105 will feature a diverse range of products and services, including locally crafted goods, clothing, art, handmade beauty products, and food offerings from various cultural backgrounds. Additionally, we will host events, workshops, and performances that celebrate community culture and heritage, integrating education and entertainment into our retail experience. Our primary business model centers on leasing repurposed shipping containers to local businesses and artisans. We will generate revenue through rental fees while creating a vibrant ecosystem where cultural exchange and entrepreneurship thrive. Furthermore, we will host community events and workshops to promote engagement and expand our revenue streams. Industry Overview The retail industry is undergoing a transformation, with a growing emphasis on experiential shopping and community -driven initiatives. The demand for unique, locally-sourced products is rising as consumers become more conscious of supporting home-grown businesses. The container retail sector is gaining traction as it offers flexible, sustainable, and innovative solutions to urban business challenges, making it a fitting model for North Greenwood. Core Marketing Activities Our marketing strategy will utilize a variety of channels to promote The Grove @1105, including social media platforms, local partnerships with community organizations, pop-up events, and traditional advertising. We will engage potential customers through storytelling that highlights the cultural significance of the businesses within the complex. Collaborations with local artists and influencers will amplify our reach, drawing visitors to experience the vibrancy of the community. High-Level Financial Targets In our initial three years, The Grove @1105 aims to achieve a break-even point by the end of year two, with a target annual revenue growth of 20% thereafter. By attracting a diverse mix of local businesses and hosting community events, we anticipate generating multiple streams of revenue, ensuring the sustainability and growth of the project while contributing positively to the local r~R~Rfs¥or the Container Village The Grove @1105 will accommodate no less than 15 businesses. We currently have seven that are committed and are anxiously awaiting the completion of the development. There are additional businesses that have expressed interest in securing a space within the village. They will go through a vetting process with Amplify Clearwater to assure they are a good fit. Below are the seven business that are confirmed. • Wine Down • Juice it up • Loaded Potatoes • Tea 's & More • Sweet L's Bakery • Jamaican Restaurant • Joes Coffee Bar Key Partners M1 Company Container Village Developer Residential & Commercial Proiects II Q 2567 Ham Brown Road Kissimmee FL 34746 (+1) 323-627-4485 B armando@mlcompanyfl.com $ www.m1companyfl.com M1 M1~ HOMES ANUl'ACTURlHO CAf!_ABILITt.ES ST/1.TEME.NIT & ?A5T PERFORMAN·CE SHEET D ffe1entl1:11L01s 5C--"" yaar1 rJ o:f'T'Dne lrd h ~1n111CW1 l l'IIJUf I PA.ST PERFORMANCE & -·----RESIDENTIAL PRODUCTS ... , rod. 6 I CMlfc IUIM IIIAIIS; 0Ml&ll61.l3 M1 - L, ___ ~am••1111o11111111 FIIC OlgillllMtlan llllalber ..-r12151 Mobile One Capability Statement U i l Si e~: .a• • fl (APABIILITIES STATfMENT & PAST PERF,ORMANCE SHEET ul· uj i.: i.t.~: 20 U it!'. 14. O !:I • ~i I! t Krate Development of the Year (2022) Tampa Bay Krate Development of the Year (2022) Tampa Bay Other Key Partners Market 707 Housed in retrofitted shipping containers, Market 707 offers a unique street food and retail experience. This vibrant community space brings together local entrepreneurs serving delicious international street food and unique goods and services to create an urban food and shopping experience unlike any other. Marketing Kinard Robinson Founder/Chief Executive Officer Empowering Creative Banking Partners • Chase Bank • BBIF • 5/3 Bank • Prudential The Grove @1105 Container Village Stage View The Grove @ 1105 Container VIiiage Concept Drawings MLK View Tangerine View Modular Prototype 1 Modular Prototype 2 M1 Containers Project – Gloria Campbell - Clearwater Urban Leadership Coalition Layout of Containers 1 1325 N Martin Luther King Jr Ave, Clearwater, FL 33755 Cover Memo City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 File Number: ID#24-1442 Agenda Date: 1/16/2025 Status: Consent AgendaVersion: 1 File Type: Action ItemIn Control: Public Works Agenda Number: 6.3 SUBJECT/RECOMMENDATION: Approve a purchase order to Cale America, d/b/a Flowbird, of Clearwater, FL, for the purchase of direct replacement of 50 multi-space parking kiosks, in an amount of $334,810.15, pursuant to Clearwater Code of Ordinances Section 2.563 (1)(d), non-competitive purchase; authorize the trade-in of the damaged meters in accordance with Code of Ordinance Section 2.623(7)(e), trade-in, and authorize the appropriate officials to execute same. (consent) SUMMARY: The Parking Division has 94 Flowbird parking kiosks. The majority of those are located on Clearwater Beach to accept parking payments at our parking lots and on-street parking locations. Hurricane Helene damaged 65 of these kiosks and rendered them inoperable. These kiosks are essential for collecting parking fees at the beach as they account for approximately 70% of total parking payments On November 15, 2024, the City Manager approved the purchase of 15 replacement kiosks for $98,490.00 to address immediate needs at key locations. The approval also included trading in 15 damaged kiosks, totaling $8,850.00, which will be applied to the purchase, reducing the total cost to $89,640.00. Approval is now requested to purchase an additional 50 replacement kiosks to fully restore the City’s parking system at a cost of $334,810.15. It is further requested to authorization the trade in of the 50 damaged kiosks, following Section 2.623(7)(e) - Trade-in, with a total trade-in value of $50,775.00, reducing the final payment to $284,035.15. The purchase of these additional kiosks falls under City Code Section 2.563(1)(d) - Impractical, as the kiosks are standardized equipment. Flowbird is the sole provider of proprietary software and hardware compatible with the City’s existing system. Switching vendors would be impractical and costly, requiring new software, equipment, and infrastructure incompatible with the undamaged Flowbird kiosks. Additionally, such a change would void the City’s current warranty and back-office support agreement. Although not utilizing the piggyback exemption, the proposed pricing is based on the National Cooperative Purchasing Alliance (NCPA) Region XIV Education Service Center Contract #158971, which was recently awarded on November 15, 2024. APPROPRIATION CODE AND AMOUNT: 3357335-546300-D2402 $334,810.15 This purchase order will be coded to special program project 181-D2402, Helene, with reimbursement anticipated from FEMA. Parking Enterprise Fund revenues will cover the cost of the purchase until reimbursement is received. STRATEGIC PRIORITY: 1.2: Maintain public infrastructure, mobility systems, natural lands, environmental resources, and historic features through systematic management efforts. 1.3: Adopt responsive levels of service for public facilities and amenities, and identify resources required to sustain that level of service. 1.5: Embrace a culture of innovation that drives continuous improvement and successfully serves all out customers. 2.3: Promote Clearwater as a premiere destination for entertainment, cultural experiences, tourism, and national sporting events. Page 1 City of Clearwater Printed on 1/14/2025 File Number: ID#24-1442 4.2: Adopt renewable resource usage and waste reduction practices to ensure a vibrant City for current and future generations. Page 2 City of Clearwater Printed on 1/14/2025 Proposal for: City of Clearwater, FL By: Andreas Jansson andreas.jansson@flowbird.group (727) 471-4768 Quote valid to: November 22, 2024 Flowbird - Confidential Quotation For: City of Clearwater, FL Quote Issued: November 14, 2024 Quote Expires: November 22, 2024 Quote Name: Onstreet - City of Clearwater, FL - 10/2024 – 033065-2 - Hurricane Replacement Bill To: Contact: City of Clearwater, FL City of Clearwater, FL 100 South Myrtle Avenue #200 Jeremy Alleshouse Clearwater, Florida, 33758 HARDWARE PRODUCT NAME QTY NCPA UNIT PRICE Customer Discount TOTAL CWT S4 – NCPA (Option #4 - CWT Touch) coin/card)Collection system / Pedestal : Pedestal cashless Power supply : Solar panel 13W - USA Connection : 4G Payment : ID Tech Options : Lightbar Color : CWT RAL 9005 Locks : Upper door: Mechanical lock, Lower door: Mechanical lock NCPA Pricing – tab “CWT Meters” – line 56 37 $7,740 -$1,174 $242,942 CWT S4 – NCPA (Option #4 - CWT Touch) Collection system / Pedestal : Pedestal standard Power supply : Solar panel 13W - USA Connection : 4G Payment : ID Tech, Selector Options : Printer, Lightbar Color : CWT RAL 9005 Locks : Upper door: Mechanical lock, Lower door: Elec. lockMechanical lock NCPA Pricing – tab “CWT Meters” – line 56 13 $7,740 -$1,174 $85,358 Battery - 42Ah 37 $175.95 $6,510.15 Hardware Total $334,810.15 This quote is provided by Cale America Inc d/b/a Flowbird. Flowbird was created in 2018 as a result of the world- wide merger between the Cale Group and Parkeon Group. All prices stated are exclusive of taxes and shipping costs unless specifically itemized in this quotation. Customer is responsible for all taxes or providing proof of tax- exempt status. By accepting this order, Customer agrees to be bound by all applicable terms and conditions or terms of existing contract(s) between Customer and Flowbird for the same products and services, if any: Accepted by: ______________________________ Date: _____/_____/_____ Quote Acceptance Information Flowbird - Confidential Quotation For: City of Clearwater, FL Quote Issued: November 14, 2024 Quote Expires: November 22, 2024 Quote Name: Onstreet - City of Clearwater, FL - 10/2024 – 033065-C - Hurricane Replacement Bill To: Contact: City of Clearwater, FL City of Clearwater, FL 100 South Myrtle Avenue #200 Jeremy Alleshouse Clearwater, Florida, 33758 HARDWARE PRODUCT NAME QTY NCPA UNIT PRICE Customer Discount TOTAL Special Discount Config 1 Trade in of old meter (no battery), No Printer, No Coin, No Battery, Eco Friendly, PartSmart roll-over and warrant adjustment. 37 -$1,165 -$43,105 Special Discount Config 2 Trade in of old meter (no battery), No Battery, Eco Friendly, PartSmart roll-over and warrant adjustment. 13 -$590 -$7,670 Annual Total -$50,775 *** NOTE: Discount is one-time use to be applied for the order of 50 meters on quote 033065-2, Discount can only be used with order of quote 033065-2 *** TOTAL DISCOUNT TOTAL DISCOUNT -$50,775 This quote is provided by Cale America Inc d/b/a Flowbird. Flowbird was created in 2018 as a result of the world- wide merger between the Cale Group and Parkeon Group. All prices stated are exclusive of taxes and shipping costs unless specifically itemized in this quotation. Customer is responsible for all taxes or providing proof of tax- exempt status. By accepting this order, Customer agrees to be bound by all applicable terms and conditions or terms of existing contract(s) between Customer and Flowbird for the same products and services, if any: Accepted by: ______________________________ Date: _____/_____/_____ Quote Acceptance Information Region XIV Education Service Center 1850 Highway 351 Abilene, TX 79601-4750 325-675-8600 FAX 325-675-8659 November 8, 2024 Ronald Kroes CFO Flowbird America Inc. 40 Twosome Drive Moorestown, NJ 08057 Sent via email to: ronald.kroes@flowbird.group Re: Award of Contract #158971, Parking Meters, Software, Systems and Related Products and Services Dear Mr. Kroes: Region 14 Education Service Center is happy to announce that Flowbird America Inc. has been awarded Contract #158971 based on the proposal submitted to Region 14 ESC in response to RFP #24-S835 Parking Meters, Software, Systems and Related Products and Services. As stated in the RFP, Article VI. Signature Form, this contract award letter is the countersignature to Flowbird America Inc.’s response and provides Region 14’s acceptance of the response and establishes the contract. The contract is effective November 15, 2024. The contract may be renewed in accordance with the contract terms and conditions. We look forward to a long and successful partnership. If you have any questions or concerns, feel free to contact me at (325) 675-8600. Sincerely, Emily Jeffrey Region 14, Chief Financial Officer Docusign Envelope ID: 4F9A9DA2-52FE-47ED-BBC5-5B3F96D23D2B Region 14 Education Service Center (ESC) Contract # 158971 for Parking Meters, Software, Systems and Related Products and Services with Flowbird America Inc. Effective: November 15, 2024 The following documents comprise the executed contract between the Region 14 Education Service Center and Flowbird America Inc., effective November 15, 2024: I. Master Agreement, Signature Form and Award Letter II. Pricing III. Supplier’s Response to the RFP IV. Request for Proposal 24-S835, as modified V. Generic Services Agreement VI. Generic Sales Agreement Region XIV Education Service Center 1850 Highway 351 Abilene, TX 79601-4750 325-675-8600 FAX 325-675-8659 November 8, 2024 Ronald Kroes CFO Flowbird America Inc. 40 Twosome Drive Moorestown, NJ 08057 Sent via email to: ronald.kroes@flowbird.group Re: Award of Contract #158971, Parking Meters, Software, Systems and Related Products and Services Dear Mr. Kroes: Region 14 Education Service Center is happy to announce that Flowbird America Inc. has been awarded Contract #158971 based on the proposal submitted to Region 14 ESC in response to RFP #24-S835 Parking Meters, Software, Systems and Related Products and Services. As stated in the RFP, Article VI. Signature Form, this contract award letter is the countersignature to Flowbird America Inc. contract. The contract is effective November 15, 2024. The contract may be renewed in accordance with the contract terms and conditions. We look forward to a long and successful partnership. If you have any questions or concerns, feel free to contact me at (325) 675-8600. Sincerely, Emily Jeffrey Region 14, Chief Financial Officer Pricing as of July 18, 2024. Flowbird pricing is updated annually. The first update to the prices listed will be on January 1, 2026 and then annually thereafter. Price adjustments are based on changes to a variety of indices, including the Consumer Price Index. Pricing as of July 18, 2024. Flowbird pricing is updated annually. The first update to the prices listed will be on January 1, 2026 and then annually thereafter. Price adjustments are basedon changes to a variety of indices, including the Consumer Price Index. Pricing as of July 18, 2024. Flowbird pricing is updated annually. The first update to the prices listed will be on January 1, 2026 and then annually thereafter. Price adjustments are based on changes to a variety of indices, including the Consumer Price Index. Pricing as of July 18, 2024. Flowbird pricing is updated annually. The first update to the prices listed will be on January 1, 2026 and then annually thereafter. Price adjustments are basedon changes to a variety of indices, including the Consumer Price Index. Pricing as of July 18, 2024. Flowbird pricing is updated annually. The first update to the prices listed will be on January 1, 2026 and then annually thereafter. Price adjustments are based on changes to a variety of indices, including the Consumer Price Index. Pricing as of July 18, 2024. Flowbird pricing is updated annually. The first update to the prices listed will be on January 1, 2026 and then annually thereafter. Price adjustments are based on changes to a variety of indices, including the Consumer Price Index. Pricing as of July 18, 2024. Flowbird pricing is updated annually. The first update to the prices listed will be on January 1, 2026 and then annually thereafter. Price adjustments are based on changes to a variety of indices, including the Consumer Price Index. Pricing as of July 18, 2024. Flowbird pricing is updated annually. The first update to the prices listed will be on January 1, 2026 and then annually thereafter. Price adjustments are basedon changes to a variety of indices, including the Consumer Price Index. Pricing as of July 18, 2024. Flowbird pricing is updated annually. The first update to the prices listed will be on January 1, 2026 and then annually thereafter. Price adjustments are based on changes to a variety of indices, including the Consumer Price Index. Pricing as of July 18, 2024. Flowbird pricing is updated annually. The first update to the prices listed will be on January 1, 2026 and then annually thereafter. Price adjustments are based on changes to a variety of indices, including the Consumer Price Index. Pricing as of July 18, 2024. Flowbird pricing is updated annually. The first update to the prices listed will be on January 1, 2026 and then annually thereafter. Price adjustments are based on changes to a variety of indices, including the Consumer Price Index. Pricing as of July 18, 2024. Flowbird pricing is updated annually. The first update to the prices listed will be on January 1, 2026 and then annually thereafter. Price adjustments are based on changes to a variety of indices, including the Consumer Price Index. Pricing as of July 18, 2024. Flowbird pricing is updated annually. The first update to the prices listed will be on January 1, 2026 and then annually thereafter. Price adjustments are based on changes to a variety of indices, including the Consumer Price Index. Project Management, including Acceptance Testing NA NAPricing dependent on project scopeFlowbird Hub Configuration $28,264 15%Astreo TVM software configuration $46,250 15%Open Payment Processing Configuration $9,142 15% Mobile App and Customer Web Portal Configuration$25,02115%FrontDesk Web Retail Application Configuration$3,85415%Training NA NAPricing dependent on project scopeInstallation Services NA NAPricing dependent on project scopePricing as of July 18, 2024. Flowbird pricing is updated annually. The first update to the prices listed will be on January 1, 2026 and then annually thereafter. Price adjustments are based on changes to a variety of indices, including the Consumer Price Index. Cover Memo City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 File Number: ID#24-1608 Agenda Date: 1/16/2025 Status: Consent AgendaVersion: 1 File Type: Action ItemIn Control: Public Works Agenda Number: 6.4 SUBJECT/RECOMMENDATION: Approve a Guaranteed Maximum Price proposal from Bandes Construction Company, Inc. of Dunedin, FL, to build the Traffic Maintenance Center and an office, in the amount of $195,957.00 pursuant to Request for Qualifications (RFQ) 51-24 and authorize the appropriate officials to execute same. (consent) SUMMARY: The Traffic Management Center is essential to monitor traffic and, with the implementation of the ATMS, allows for the ability to manage changes in traffic patterns, modes, and volumes due to special events and expected growth and development in the city through remote monitoring and management of traffic signals. Additionally, it enables remote monitoring of traffic signals during major storm events. The City of Clearwater’s Traffic Management Center is currently located within the Municipal Services Building. However, due to the need for improved operational adjacencies, as well as the planned MSB renovation, the Traffic Management Center will be relocated to the Traffic Operations Building, located at the City’s Public Works Complex Building E. October 03, 2024, City Council approved the use of eighteen firms to serve as Construction Managers at Risk (CMAR) for Continuing Contracts under RFQ 51-24 and Bandes Construction Company, Inc. was selected as one of the approved firms. May 18, 2023, City Council approved a purchase order to Econolite Systems, Inc. for an Advance Traffic Management System (ATMS). The contractor will remodel Building E consisting of the removal of existing walls to expand the footprint of one office that will be converted into the Traffic Management Center, as well as the construction of an office on the sign shop floor. Bandes Construction Company, Inc. was selected to perform these services based on the firm’s experience and capabilities to perform the work. Construction will be completed within 90 days from issuance of the Notice to Proceed. APPROPRIATION CODE AND AMOUNT: ENRD240001-CONS-CNSTRC$195,957.00 Funding is available in Capital Improvement project ENRD240001, ATMS Infrastructure Upgrades, for the construction. This project will be funded by Local Option Gas Tax. STRATEGIC PRIORITY: 1.2: Maintain public infrastructure, mobility systems, natural lands, environmental resources, and historic features through systematic management efforts. 1.4 Foster safe and healthy communities in Clearwater through first-class public safety and emergency response services. Page 1 City of Clearwater Printed on 1/14/2025 Project: City of Clearwater Traffic Operations Building Remodel Date: 11/25/24 Scope of Work: Construction Manager Bandes Construction (CMAR) will provide construction services to remodel the existing traffic operation building per plans ans specifications provided by Long and Associates dated 9/24/24. The cost of these services totals $195,957and a breakdown will be provided in the accompanying Exhibit A. Drawing Log: G0.1 COVER SHEET G0.2 ABBREVIATIONS, SYMBOL LEGEND, & MATERIALS LEGEND ELECTRICAL INDEX - RAR ARCHITECTURAL INDEX - ES AD1.1 FIRST FLOOR DEMOLITION PLAN & REFLECTED CEILING PLAN A0.1 SITE PLAN A1.1 FIRST FLOOR PLAN & REFLECTED CEILING PLAN A6.1 SCHEDULES AND DETAILS MD1.1 DEMOLITION FLOOR PLAN M0.1 GENERAL NOTES, LEGEND & DETAILS M1.1 FLOOR PLAN M3.1 DETAILS M4.1 SCHEDULES ED2.1 LIGHTING DEMOLITION PLAN ED3.1 POWER AND SIGNAL DEMOLITION PLAN E0.1 LEGEND, DETAILS & GENERAL NOTES E2.1 LIGHTING PLAN E3.1 POWER AND SIGNAL PLAN E6.1 ELECTRICAL RISERS AND PANEL SCHEDULES E7.1 DETAILS E7.2 DETAILS Exclusions: -Conflicts with unknown utilities -Utility upgrades to existing infrastructure -Additional Testing 2 -Any Additional insurances required by the utility or AHJ -Prevailing Wadges - 3 rd Party inspections -Civil analysis Fees Warranty: -Bandes Provides a 1 year warranty from the date of substantial completion. Warranty excludes any defects in owner supplied material or acts of god. Schedule: -Construction timeline will be 60 days from Permit and agreed NTP date. Thank you for your consideration, Jeremy Brown 727-433-1631 – jeremy.brown@bandesconstruction.com PROJECT: Traffic OP. Bld ARCH : LONG & ASS LOCATION: Clearwater LQDT.DMG $ / DAY FLR AREA Remd: 1,384sf # FLOORS 1(One)BID DATE Nov.12th. 2024 BUDGET : $K SITEWORK : 1.0AC DURATION 60 DAYS. DESCRIPTION NAME Mat Lab Sub TOTAL DIVISION #1 1 GENERAL CONDITIONS BCC 0 0 36,125 36,125 2 SUPERVISION BCC 0 0 0 0 3 FEES N / A 0 0 0 0 4 TESTING N / A 0 0 0 0 DIVISION #2 0 0 0 0 1 DEMOLITION CRUE 0 0 5,740 5,740 2 SOIL POISON BCC 0 0 300 300 DIVISION #3 0 0 0 0 1 ELEC. TR & POUR BACK BCC 0 0 2,000 2,000 DIVISION #6 0 0 0 0 1 WOOD BLOCKING W / DWALL 0 0 0 0 DIVISION #7 0 0 0 0 1 INSULATION W / DWALL 0 0 0 0 2 CAULKING W / DWALL 0 0 0 0 DIVISION #8 0 0 0 0 1 HM / WD / HDWARE BCC 5,000 0 0 5,000 2 DOOR & HDWRE INST. SHELMA 0 0 990 990 3 WINDOWS / GLAZING BCC 0 0 700 700 DIVISION #9 0 0 0 0 1 DRY WALL Crue 0 0 32,200 32,200 2 ACT . CEILING Crue 0 0 7,700 7,700 3 FLOORING / CERAMIC ABBEY 0 0 2,815 2,815 4 PAINTING GANSTER 0 0 1,800 1,800 DIVISION #11 0 0 0 0 1 TV. INST BCC 0 0 500 500 DIVISION #15 0 0 0 0 1 FIRESPRINKLER BCC 0 0 2,000 2,000 2 PLUMBING N / A 0 0 0 0 3 HVAC ALL WEST 0 0 19,350 19,350 DIVISION #16 0 0 0 0 1 ELECTRIC FLA 0 0 31,520 31,520 SUB-TOTAL 5,000 0 143,740 148,740 BOND 1,496 BUILDER'S RISK INS 500 PERMIT FEES 0 DIRECT COST 150,736 OH & P (%)37,684 Contingency 5%7,537 TOTAL 195,957 BANDES CONSTRUCTION CO.INC. Page 3 EXCLUSIONS 1 Permit fees 2 Bonds 3 Phone / Data Cabling Page 4 BANDES CONSTRUCTION By: _________________________________ Jeremy Brown __________________________ Date CITY OF CLEARWATER, FLORIDA Approved as to form: Attest: ____________________________ By: _______________________________ David Margolis Rosemarie Call City Attorney City Clerk Countersigned: ____________________________ ___________________________________ Bruce Rector Jennifer Poirrier Mayor City Manager ____________________________ ___________________________________ Date Date EB 1828ARCHITECTURE/ENGINEERING:813/839-0506AR0015104LONG & ASSOCIATESTAMPA, FLORIDA 336114525 S. MANHATTAN AVE.ARCHITECTS / ENGINEERS, INC.INDEX OF DRAWINGSTO THE BEST OF THE ARCHITECT'S AND/OR ENGINEER'S KNOWLEDGE THESE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE-SAFETY STANDARDSDIGITAL SEALSSealEDWARD SMITH, A.I.A.AR 101138L&A PROJECT NO.Date:Phase:Drawn By:Checked By:Job No:9/24/2024 11:41:03 AM9/24/2024 11:41:03 AM100% CONSTRUCTION DOCUMENTSSEPTEMBER 24,2024100% CONSTRUCTION DOCUMENTSSEPTEMBER 24, 2024CLEARWATER TRAFFIC OPERATIONSBUILDING REMODEL24034CITY OF CLEARWATER1650 N. ARCTURAS AVE, CLEARWATER, FL 337651650 N. ARCTURAS AVE,CLEARWATER, FL 3376524034G0.1JCES100% CONSTRUCTION DOCUMENTS24034SEPTEMBER 24,2024COVER SHEETGENERAL INDEX - ES-EDWARD SMITH, STATE OF FLORIDA, REGISTERED ARCHITECT, LICENSE NO.AR 101138 & REGISTERED INTERIOR DESIGNER ID 6792 IS RESPONSIBLE FORALL SHEETS APPEARING ON THE COVER SHEET UNDER THE GENERALHEADINGG0.1 COVER SHEETG0.2 ABBREVIATIONS, SYMBOL LEGEND, & MATERIALS LEGENDELECTRICAL INDEX - RAR-ROBERT A. RACE II, STATE OF FLORIDA, PROFESSIONAL ENGINEER,LICENSE NO. PE 0051483 IS RESPONSIBLE FOR ALL SHEETS APPEARINGON THE COVER SHEET UNDER THE ELECTRICAL HEADINGED2.1 LIGHTING DEMOLITION PLANED3.1 POWER AND SIGNAL DEMOLITION PLANE0.1 LEGEND, DETAILS & GENERAL NOTESE2.1 LIGHTING PLANE3.1 POWER AND SIGNAL PLANE6.1 ELECTRICAL RISERS AND PANEL SCHEDULESE7.1 DETAILSE7.2 DETAILSARCHITECTURAL INDEX - ES-EDWARD SMITH, STATE OF FLORIDA, REGISTERED ARCHITECT, LICENSE NO. AR101138 &REGISTERED INTERIOR DESIGNER ID 6792 IS RESPONSIBLE FOR ALL SHEETS APPEARINGON THE COVER SHEET UNDER THE ARCHITECTURAL HEADINGAD1.1 FIRST FLOOR DEMOLITION PLAN & REFLECTED CEILING PLANA0.1 SITE PLANA1.1 FIRST FLOOR PLAN & REFLECTED CEILING PLANA6.1 SCHEDULES AND DETAILSMECHANICAL INDEX - WEB-WILLIAM E. BROWN, STATE OF FLORIDA, PROFESSIONAL ENGINEER,LICENSE NO. PE 57975 IS RESPONSIBLE FOR ALL SHEETS APPEARINGON THE COVER SHEET UNDER THE MECHANICAL HEADINGMD1.1 DEMOLITION FLOOR PLANM0.1 GENERAL NOTES, LEGEND & DETAILSM1.1 FLOOR PLANM3.1 DETAILSM4.1 SCHEDULESREGIONAL MAPLOCAL MAPPROJECT LOCATIONPROJECT LOCATIONNO. DATE ISSUES & REVISIONS1 09-24-24 100% CONSTRUCTIONDOCUMENTSEdward Smith, State of Florida, Registered Architect, License No. AR 101138This Item has been digitally signed and sealed by Edward Smith, AIA,on ______________ using a Digital Signature.Printed copies of this document are not considered signed and sealed and the signature must be verified on any electronic copies. 09/24/ 2024 C C C C CMU WALL, THICKNESS VARIES CMU WALL (RATED) STUD WALL, THICKNESS VARIES STUD WALL (RATED) EXISTING WALL TO REMAIN BRICK VENEER RIGID INSULATION CAVITY INSULATION INSULATION (BATT, BLANKET, OR FILL) WOOD (FINISHED) PLYWOOD (SMALL SECTION) PLYWOOD (LARGE SECTION) STEEL (LARGE SECTION) ROUGH LUMBER (CONTINUOUS) ROUGH LUMBER (INTERMITTENT) PRECAST CONC. OR CUT STONE CONCRETE COMPACTED FILL OR EARTH FINISHED GRADE NOTE: EXISTING BUILDING WALLS, DOORS, FIXTURES, EQUIPMENT, ETC. ARE GENERALLY SHOWN LIGHTER & WITHOUT MATERIAL HATCHING A 888 A PARTITION TYPE DOOR NUMBER, SEE SCHEDULE WINDOW TYPE EQUIPMENT TAG, SEE SCHEDULE INTERIOR ELEVATION1A99.9.9 1ASSEMBLY TYPE Number ASI # 88REVISION TAG NOTE TAG1 0COLUMN CENTERLINE 1 A101 1 A101 DETAIL SECTION 1 A101EXTERIOR ELEVATION FINISHED FLOOR ELEVATIONFFE 135' - 5 1/2" FINISHED FLOOR ELEVATION AFF 9' - 0" 101 ALIGN OF NEW PARTITION WITH TO/FROM THE CENTER LINE OF ALIGN OF NEW PARTITION TO TO/FROM COLUMN CENTER LINES NEW WALL CONSTRUCTION TO/FROM THE FINISHED FACE OF NEW WALL CONSTRUCTION ALIGN NEW PARTITION TO FINISH GWB OF COLUMN FLUSH BOTH SIDES OF COLUMN OF WINDOW MULLION ALIGN NEW PARTITION TO EXIST (VERIFY EXIST PARTITION CONSTRUCTION MATCHES NEW PARTITION CONSTRUCTION) B4TYPE 3 5/8" MTL STUDS @ 16" O.C. , 5/8" GYP BOTH SIDES, W/ 3 5/8" BATT INSULATION, 4" ABOVE CEILING CEILING BRACE TO ADJACENT WALL 4" MIN TYPCONFIRM VERTICAL STUD TO DECK @ 8' - 0" O.C. TYP. BRACE AS REQ'D PROVIDE LATERAL WALL BRACING AT 45° ANGLE TO ADJACENT WALLS PER MANUFACTURER RECOMMENDATIONS FOR LATERAL LOADS AS REQUIRED 3 5/8" MTL STUDS @ 16" O.C. , 5/8" GYP BOTH SIDE, W/ 4" BATT INSULATION, TO CEILING NEW WALL TIGHT AGAINST EXISTING CEILING C4TYPED6TYPE 6" MTL STUDS @ 16" O.C. , 5/8" GYP BOTH SIDES AND 3/4'' PLYWOOD ONE SIDE, W/ 6" BATT INSULATION, 4" ABOVE CEILING CEILING BRACE TO ADJACENT WALL 4" MIN TYPCONFIRM VERTICAL STUD TO DECK @ 8' - 0" O.C. TYP. BRACE AS REQ'D PROVIDE LATERAL WALL BRACING AT 45° ANGLE TO ADJACENT WALLS PER MANUFACTURER RECOMMENDATIONS FOR LATERAL LOADS AS REQUIRED E6TYPE 6'' MTL STUDS @ 16" O.C. , 5/8" GYP AND 3/4'' PLYWOOD ONE SIDE, W/ 6" BATT INSULATION, 4" ABOVE CEILING EXISTING WALL, SEE SECTION 5/8'' GYP BOARD CONT. EXSPOSED PORTION 5/8" GYP BOARD 3/4" PLYWOOD Q P O D N W V U ABBREVIATIONS L K J I A T S MATERIALS LEGEND X Y SYMBOL LEGEND SYMBOLDESCRIPTION C B F E G H M R DIMENSIONING CONVENTIONS GENERAL NOTES NOTES AREAANCHOR BOLTAIR CONDITIONINGALTERNATING CURRENT AABA/CACACCESS FLOORAMERICAN CONCRETE INSTITUTEACOUSTICALACOUSTICAL CEILING TILEAMERICANS WITH DISABILITIES ACTADDITIONALADJUSTABLEADJACENTABOVE FINISHED COUNTERABOVE FINISHED FLOORAIR HANDLING UNITAMERICAN INSTITUTE OF AMERICAN INSTITUTE OF ACOUSTICAL LININGALTERNATEALUMINUMAMPERE ANCHORANODIZEDACOUSTICAL PANELAPARTMENTAPPROXIMATEACID RESISTANTARCHITECTURAL / ARCHITECTASBESTOSAMERICAN SOCIETY OF & AIR-CONDITIONING ENGINEERSAMERICAN SOCIETY OF ASPHALTASSOCIATIONAMERICAN SOCIETY FOR AUTOMATICAUXILIARYAVENUEAMERICAN WOODWORKING INSTITUTE ACFLACIACOUSACTADAADDNLADJADJTAFCAFFAHUAIA AISC ALALTALUMAMP ANCANODAPAPTAPPARARCHASBASHRAE ASME ASPHASSOCASTM AUTOAUXAVEAWI BULLETIN BOARDBOARDBOTTOM FACEBITUMINOUS BLOCKBLOCKING BUILDING BACKBENCH MARKBEAMBOTTOMBASE PLATEBEARING BRITISH THERMAL UNITBRITISH THERMAL UNIT PER HOURBETWEEN BASEMENT BUILT UP ROOFINGBOTH WAYS BBBDBFBITBLDGBLKBLKGBKB/MBMBOTBPBRGBSMTBTUBTUHBTWNBURBW CABINETCENTER TO CENTERCEMENT CUBIC FEET PER SECONDCHANNELCONTROL JOINTCENTER LINECEILINGCLEARCONSTRUCTION MANAGERCONCRETE MASONRY UNITCLEAN OUTCOLUMN CONNECTIONCONSTRUCTIONCONTINUOUSCONTRACTOR COUPLINGCARPET CARBON STEELCERAMIC TILE CONDENSER UNITCUBIC YARD CENTER CERAMICCUBIC FEETCUBIC FEET PER MINUTE COMPUTER COMPUTER PROCESSING UNIT CONDUITCONCRETE CORRIDOR CABC/CCEMCERCFCFMCFSCHCJCLCLGCLRCMCMUCOCOLCOMPCNDCONCCONNCONSTCONTCONTRCORRCPLGCPTCPUCSCTCTRCUCY DEMOLITIONDENSITYDETAIL DIAMETERDIAGONALDIFFUSERDIMENSIONDISCONNECT DOWNDOORDOWNSPOUT DRINKING FOUNTAIN DITTO DOUBLE DEAD LOAD DRAWING STEEL CONSTRUCTION ARCHITECTS HEATING. REFRIGERATION MECHANICAL ENGINEERS TESTING & MATERIALS DBLDEMDENDETDFDIADIAGDIFFDIMDISCDLDODNDRDSDWG EACHEXPANSION BOLTEXHAUST FANEFFICIENCYEXTRA HAZARDELEVATIONELECTRIC / ELECTRICALEMERGENCYENERGY MANAGEMENT ENCLOSURE EXPLOSION PROOFEQUALEQUIPMENTESTIMATE / ESTIMATEDEXISTING TO REMAINEVAPORATIVE / EVAPORATOR EACH WAYELECTRIC WATER COOLERELECTRIC WATER HEATEREXFILTRATION EXHAUSTEXPANSION JOINTEXPANSIONEXISTING RELOCATEDEXISTINGEXTERIOR & CONTROL SYSTEM MODULUS OF ELASTICITY ENGINEERENGINEERING EEAEBEFEFFEHELELECEMERGEMCS ELEVATOR ENCLENGRENGRGEPEQEQPTESTETREVAPEVTREWEWCEWHEXFEXHEJEXPEXREXSTEXT FAFACPFBRKFCFDFDCFDNFDPRFEFECFFFFEFFFFGFHFHMSFHSFHWSFINFJTFLFLGFLSHGFLRFPFPGFPMFPSFOFOCFOFFOM FRFRMGFRTLFSFTFTGFURRFV FIRE ALARMFIRE ALARM CONTROL PANELFIRE BRICKFLEXIBLE CONNECTIONFLOOR DRAINFIRE DEPARTMENT CONNECTIONFOUNDATIONFIRE DAMPERFIRE EXTINGUISHERFIRE EXTINGUISHER CABINETFINISHED FLOORFINISHED FLOOR ELEVATIONFROM FINISHED FLOORFLANGED CONNECTIONFIRE HYDRANTFLAT HEAD MACHINE SCREWFIRE HOSE STATIONFLAT HEAD WOOD SCREWFINISH / FINISHEDFLUSH JOINTFLOORFLANGEFLASHINGFLUORESCENTFIRE PROTECTIONFIREPROOFINGFEET PER MINUTEFEET PER SECONDFLAT OVALFACE OF CONCRETEFACE OF FINISHFACE OF MASONRY FRAMEFRAMINGFIRE RETARDANT TREATED LUMBERFULL SIZEFEETFOOTINGFURRED / FURRINGFLUSH VALVE FOSFACE OF STUD FZRFREEZER GAGALGALVGBGCGIGLGLBKGPGPMGRGRDGRNDGSGSTGWBGYP GAGE / GAUGEGALLONGALVANIZEDGRAB BARGENERAL CONTRACTORGALVANIZED IRONGLASS / GLAZINGGLASS BLOCKGENERAL PURPOSEGALLONS PER MINUTEGROOVED CONNECTIONGRADEGROUNDGALVANIZED STEELGLAZED STRUCTURAL TILEGYPSUM WALL BOARDGYPSUM HBHCHCPHDHDNRHDWHGRHMHORIZHPHRHRSHSSHTHVAC HZ HOSE BIBBHOLLOW COREHANDICAPPEDHARDHARDENERHARDWAREHANGERHOLLOW METALHORIZONTALHORSEPOWERHOURHOURSHOLLOW STRUCTURAL STEELHEIGHTHEATING, VENTILATION, HERTZ / CYCLES PER SECOND IICIDIFININCLINFINFOINSULINTINV MOMENT OF INERTIAINTERCOMINSIDE DIAMETERINSIDE FACEINCHESINCLUDEDINFILTRATIONINFORMATIONINSULATIONINTERIORINVERTIRON PIPEIP AIR-CONDITIONING AMOUNTAMT LTWTLIGHTWEIGHT MASONRY OPENING NOISE REDUCTION NOT IN CONTRACT OUTSIDE DIAMETER PLASTIC LAMINATE POLYVINYL CHLORIDE POUNDS PER SQUARE INCHPOUNDS PER SQUARE FOOT POUNDS PER LINEAR FOOT POUNDS PER CUBIC FOOT PRESSURE TREATED POST INDICATOR VALVE QTYQT PA QUARRY TILE PUBLIC ADDRESS QUANTITY PLAM PVC PSF PLF PCF PREFAB PROJPRES PVMT PLYWD PSI PT PIV PREFABRICATED PROJECTIONPRESSURE PAVEMENT PLYWOOD OHD OPP HD PTD PNLBPNL PLAS PART PR OD OH PAINTED PAIR PANELPANELBOARD PLASTER PARTITION OVERHEADOVERHEAD DOOR OPPOSITE HAND NAT NRC NTP N/A NEG OPNG NO OC NIC NUMBER OPENING ON CENTER NATURAL NOTICE TO PROCEED NOT APPLICABLE NEGATIVE MAXIMUMMAX MULL MODMOV MISCMIRR MTL MEDMECH MM MIL MISCELLANEOUS MULLION MODELMOVABLE MILLIMETER(S) MILITARY MIRROR METAL MEDIUMMECHANICAL MATMAS MFRMFD MH MO MK LL LF MANHOLE MARK MATERIALMASONRY MANUFACTURERMANUFACTURED LIVE LOAD LINEAR FOOT VINYL TILEVT VOLTS VOLUME VINYL WALL COVERING WALL HUNG WALL TO WALL WALL CLEANOUT WEATHER PROTECTED WELDED WIRE FABRIC WINDOW WIDE FLANGE WOOD WITHOUTWITH WEIGHT WATER CLOSETWAINSCOT WD WWF WIN W/O WF W/ WT WTW WCO WAINS WH WP WC VOL VWC V UNLESS OTHERWISE NOTED UTILITYURINAL UNDERCUT UNDERGROUNDUNDERWRITER'S VELOCITY VARIABLE AIR VOLUME VAPOR RETARDER VERTICAL VINYL COMPOSITION TILE VINYL VENT THRU ROOF VACUUM TRANSFER TYPICAL TRANSFORMER TACK BOARD URL VPR VAV VEL VERT VCT VTR VIN UTY VAC UON ULUG UC XFR TYP XFMR TB KILOVOLT AMPERE KILOVOLTKV KVA LAMLAB LVG LTG LAV KO KIT KW LABORATORY LIGHTING LAVATORY LEAVING LAMINATE(D) KNOCKOUT KITCHEN KILOWATT(S) JTJB JSTJOINTJUNCTION BOX JOIST SASUPPLY AIR SWITCH SYMBOLSYMMETRICAL SYSTEM SUSPEND(ED) TELEVISION TELEPHONE THERMOSTAT THICK(NESS) TOILET TONGUE AND GROOVE TOP THRESHOLD TEMPERATURE TOP OF MASONRYTOP OF FOOTING TOP OF CURB TOP OF BEAM TOP OF STEELTOP OF SLAB TOP OF TOP AND BOTTOM TOP FACE THK T/ T/C T/FTG T/BM T/MAS T/STLT/SLAB TLT T&G TSHD T&B T/F T TEL TSTAT TEMP TV SYMBSYM SYS SUSPSW SHEET SOLID CORE SPEAKER SOUNDPROOF STANDARD SQUARESPRINKLER STAINLESS STEEL SQUARE FEET STRUCTURAL CLAY TILE SUPPLY STEAMSTEEL JOIST STORAGE STEEL STATION SPECIFICATION(S) SMOKE DETECTOR SIMILARSAWCUT JOINT SECONDARYSECTION SCHEDULE SPKR STA SCT SUP STL JSTSTM STL STOR STD SST SPRK SQ FT SPEC SQ SHT SNDP SIM SECT SC SD SCH SEC SJ JANJANITOR KNOCKDOWNKDKILOGRAMKG LBS LVR LS POUNDS LUMP SUM LOUVER LINLINEAR LHLEFT HAND MBENDING MOMENT MBF1OOO BOARD FEET MFGMANUFACTURING MBMARKER BOARD MEZZMEZZANINE MWMICROWAVE MRMOISTURE RESISTANT NECNATIONAL ELECTRIC CODE NOANOTICE OF ACCEPTANCE OPPOPPOSITE OZOUNCE OFOUTSIDE FACE OAOUTDOOR AIR PCSPIECES PLATEPL PPPOWER POLE SMALLSM SQUARE INCHSQ IN SQUARE YARDSQ YD STRUCTURALSTRUC TOLERANCETOL VINYL BASEVB WIDE(WIDTH)W YARDYD COEFFICIENT LABORATORY W/ SOUND TRANSMISSION CLASSSTC JJUNCTION KIP / 1000 LBK LLENGTH LGLARGE LOLOCLOCATIONLOCKOUT LT/GALIGHT GAGELTHLIGHT HAZARD LTLIGHT LLHLONG LEG HORIZONTALLLVLONG LEG VERTICAL MCMEDICINE CABINETMDMOTORIZED DAMPER MINMINIMUM MTDMOUNTEDMTMETAL THRESHOLD MPMIDPOINT MLMETAL LATH MSMOP SINK MTRMETER NFANET FREE AREA NTSNOT TO SCALE OROUND OAIOUTDOOR AIR INTAKE ORDINARY HAZARDODH OJOPEN WEB JOIST PCPHOTOCELLPRECAST CONCRETEPCC PHASEPH PREFORMED JOINT FILLERPJF PFDPREFORMED POSPOSITIVE PRESTRESSED CONCRETEPSC POST TENSIONED CONCRETEPTC PWRPOWER PER UNITPU PNTPOINT RIGHT ROUGH OPENING ROOF VENT ROOFING ROOM RADIUS RECIRCULATINGRECIPROCATING REINFORCE(D), REQUIRED REVISION RIGHT OF WAY RETURN GRILLE REVOLUTIONS PER MINUTE RETURN RETURN AIR RELATIVE HUMIDITY REGULAR RECEIVER RECEPTACLE RT RFG ROWRO RV RM REQD RPM REVRET RG RA RH RECIPRECIRC REINFREG RECPT REC RAD REFRIGERATORREFGREFERENCEREF REINFORCING RISER REQUIREMENTREQT REFLECTED CEILING PLANRCP REDUCERED ROOF DRAINRD ROOF TOP UNITRTU RAIN PROOFRP RAIN WATER COLLECTORRWC RAIN WATER LEADERRWL SSANITARY SQUARE FEETSF SHEATHINGSHTG STORM DRAINSDN SQUARE YARDSY SERVICESERV TOP OF PIPET/P TOP OF WALLT/W TOP OF PLATET/PL TOWEL RODTRTRANSOMTRAN TOILET PARTITIONTPTN TREADTRD THREADEDTHRD TIME CLOCKTC UNDER COUNTERUCR VOLTSVA VERIFY IN FIELDVIF VINYL FABRICVF WORK POINTWPT EXTRA HEAVYEXTRA STRONGXHVYXSTGDOUBLE EXTRA STRONGXXSTG SealEDWARD SMITH, A.I.A.AR 101138Date: Phase:Drawn By:Checked By:Job No: TO THE BEST OF THE ARCHITECT'S AND/OR ENGINEER'S KNOWLEDGE THESE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE-SAFETY STANDARDS4525wSouthManhattanAvenue,Tampa,FL33611-2305T:813.839.0506 F:813.839.4616 AR0015104 1828 CGC1511025wwlongandaaooscitessc.m.THIS DOCUMENT IS COPYRIGHT MATERIAL, ANY DISCLOSURE, UNAUTH0RIZED USE, DISSEMINATION OR DUPLICATIONWITHOUT THE EXPRESS WRITTEN CONSENT OF LONG & ASSOCIATES IS PROHIBITED ALL RIGHTS RESERVEDLONG & ASSOCIATESARCHITECTS | ENGINEERS, INCDIGITAL SEALS 9/24/2024 9:43:40 AM G0.2CLEARWATER TRAFFIC OPERATIONSBUILDING REMODELFORCITY OF CLEARWATER1650 N. ARCTURAS AVE, CLEARWATER, FL 33765JCES 100% CONSTRUCTION DOCUMENTS 24034SEPTEMBER 24, 2024 ABBREVIATIONS,SYMBOL LEGEND, & MATERIALS LEGEND A. B. C. D. E. F. G. H. I. ALL WORK SHALL BE PERFORMED IN STRICT ACCORDANCE WITH THE GENERAL CONDITIONS OF THE CONTRACT AND THE PROJECT SPECIFICATIONS, INCLUDING THE REQUIREMENTS OF DIVISION ONE. ALL WORK SHALL BE PERFORMED IN STRICT ACCORDANCE WITH THE REQUIREMENTS OF THE FLORIDA BUILDING CODE FBC EIGHTH EDITION 2023 AND 2023 FLORIDA FIRE PREVENTION CODE. IN SOME CASES, THE REQUIREMENTS SET FORTH IN THE CONSTRUCTION DRAWINGS AND SPECIFICATIONS EXCEED THE MINIMUM REQUIREMENTS OF THE CODE. THE CONSTRUCTION MANAGER / GENERAL CONTRACTOR SHALL COORDINATE THE SEQUENCING AND EXECUTION OF ALL TRADES IN STRICT CONFORMANCE WITH THE REQUIREMENTS OF ALL CONSTRUCTION DRAWINGS AND CONTRACT DOCUMENTS. THE CONSTRUCTION MANAGER / GENERAL CONTRACTOR SHALL MAINTAIN & PROTECT FROM DAMAGE ALL PORTIONS OF THE EXISTING FACILITY SCHEDULED TO REMAIN OR NOT INDICATED FOR DEMOLITION. ALL DAMAGED AREAS & ELEMENTS SHALL BE REPLACED TO MATCH EXISTING ADJACENT CONSTRUCTION IN ALL RESPECTS. PRIOR TO ANY DEMOLITION, THE CM, OWNER AND A/E SHALL WALK THROUGH THE PROJECT AND ESTABLISH A PUNCH LIST OF EXISTING CONDITIONS. ITEMS NOT IDENTIFIED AND LATER DAMAGED DUE TO CONSTRUCTION SHALL BE THE CONTRACTORS RESPONSIBILITY. FIELD VERIFY ALL DIMENSIONS PRIOR TO DEMOLITION WORK. COORDINATE AS REQ'D FOR NEW WORK. OWNER SHALL CAREFULLY REMOVE AND ABATE ASBESTOS. THE CONSTRUCTION MANAGER / GENERAL CONTRACTOR SHALL PROTECT THE PUBLIC FROM CONSTRUCTION ACTIVITIES AND PROVIDE FOR A SECURE CONSTRUCTION SITE. NO.DATE ISSUES & REVISIONS 1 09-24-24 100% CONSTRUCTIONDOCUMENTS PARTITION TYPES Edward Smith, State of Florida, Registered Architect, License No. AR 101138This Item has been digitally signed and sealed by Edward Smith, AIA,on ______________ using a Digital Signature.Printed copies of this document are not considered signed and sealed and the signature must be verified on any electronic copies. 09/24/ 2024 C C C C C AD1005AD1008 AD1008 LIMITS OF CONSTRUCTION 2422 SFSIGN FABRICATION 101 181 SFOFFICE 109 226 SFMEN 103 236 SFWOMEN 104 46 SFJANITOR 105 580 SFELECTRONIC REPAIR 102 171 SFOFFICE 108 156 SFOFFICE 107 360 SFBREAK 106 5' - 9"14' - 6 3/4"13' - 1 7/8"23' - 7 7/8"AX12006 AD1003 AD1003 13' - 5" 4746 SFWAREHOUSE 110 131 SFMECH 111 AX1009 AX1002 AX10013AX10013 AX12006 AX1002AX1002 AX1010 DRAWING KEY 101 A 101 NEW DOOR NEW WALL EXISTING DOOR TO REMAIN DOOR TAG WALL TAG EQUIPMENT / FURNITURE TAG EXISTING WALL TO REMAIN EXISTING DOOR TO BE DEMOLISHED EXISTING WALL TO BE DEMOLISHED EXISTING WINDOW TO REMAIN 2-HR FIRE RATED WALL ACOUSTICAL GRID AND TILE CEILING SYSTEM TO BE DEMOLISHED DEMOLITION REFLECTED CEILING PLAN LEGEND ACOUSTICAL GRID AND TILE CEILING SYSTEM TO REMAIN AND ACOUSTICAL PANEL2'x2' SUSPENDED CEILING GRID SUPPLY AIR DIFFUSER TRANSFER GRILLE CEILING VANCANCY SENSORVS RECESSED FLUORESCENT2'x4' LIGHT FIXTURE EXHAUST FAN REFLECTED CEILING PLAN LEGEND RECESSED FLUORESCENT2'x2' LIGHT FIXTURE EXISTING POWER POLE EXIT SIGN AD9026 AD9026 AD1012 AD9027AX1002 AX1009 AX1002 5' - 9"14' - 6 3/4" AX10013 LIMITS OF CONSTRUCTION AX1010 SealEDWARD SMITH, A.I.A.AR 101138Date: Phase:Drawn By:Checked By:Job No: TO THE BEST OF THE ARCHITECT'S AND/OR ENGINEER'S KNOWLEDGE THESE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE-SAFETY STANDARDS4525wSouthManhattanAvenue,Tampa,FL33611-2305T:813.839.0506 F:813.839.4616 AR0015104 1828 CGC1511025wwlongandaaooscitessc.m.THIS DOCUMENT IS COPYRIGHT MATERIAL, ANY DISCLOSURE, UNAUTH0RIZED USE, DISSEMINATION OR DUPLICATIONWITHOUT THE EXPRESS WRITTEN CONSENT OF LONG & ASSOCIATES IS PROHIBITED ALL RIGHTS RESERVEDLONG & ASSOCIATESARCHITECTS | ENGINEERS, INCDIGITAL SEALS 9/24/2024 9:43:37 AM AD1.1CLEARWATER TRAFFIC OPERATIONSBUILDING REMODELFORCITY OF CLEARWATER1650 N. ARCTURAS AVE, CLEARWATER, FL 33765JCES 100% CONSTRUCTION DOCUMENTS 24034SEPTEMBER 24, 2024 FIRST FLOORDEMOLITION PLAN & REFLECTED CEILING PLANSCALE: 1/8" = 1'-0"1 FIRST FLOOR DEMOLITION PLAN SCALE: 1/8" = 1'-0"2 REFLECTED CEILINGDEMOLITION PLAN KEYNOTE LEGEND NO.DESCRIPTION AD1003 CAREFULLY REMOVE EXISTING VCT FLOORING. CLEAN & CLEAR EXISTING FLOOR SLAB &PREPARE FOR NEW WORK AD1005 CAREFULLY REMOVE PORTION OF EXISTING WALL & PREPARE FOR NEW WORK. PATCH EXISTINGADJACENT WALL FINISH TO MATCH & SEE NEW WORK AD1008 CAREFULLY REMOVE STUD WALL PARTITIONS, DOORS, FRAMES, & MISC ITEMS, FLOOR TO DECK& PREPARE SPACE FOR NEW WORK. TYPICAL AS SHOWN AD1012 CAREFULLY REMOVE AND RETURN TO OWNER EXISTING LIGHT FIXTURES & PREPARE FOR NEWWORK. SEE ELECTRICAL DWGS AD9026 CAREFULLY REMOVE EXISTING ACT SYSTEM & CEILING FIXTURES & PREPARE FOR NEW WORKSEE ELECTRICAL & MECHANICAL DWGS AD9027 CAREFULLY REMOVE PORTION OF EXISTING ACT SYSTEM AS REQUIRED & CEILING FIXTURES &PREPARE FOR NEW WORK SEE ELECTRICAL & MECHANICAL DWGS AX1002 EXISTING ROOMS TO REMAIN. NO NEW WORK IN AREA. PROTECT & MAINTAIN ROOM CONTENTS,HVAC, UTILITIES, ETC AS REQ'D AX1009 PROTECT & MAINTAIN EXISTING WALL TO REMAIN, PATCH AS REQ'D TO MATCH AX1010 EXISTING FIRE RATED PARTITION TO REMAIN, PROTECT AND MAINTAIN AX10013 EXISTING ELECTRICAL POWER POLE TO REMAIN. PROTECT & MAINTAIN, SEE ELECTRICAL DWGS AX12006 EXISTING FURNITURE TO REMAIN, PROTECT AND MAINTAIN 0'4'8'16' N NO.DATE ISSUES & REVISIONS 1 09-24-24 100% CONSTRUCTIONDOCUMENTSEdward Smith, State of Florida, Registered Architect, License No. AR 101138This Item has been digitally signed and sealed by Edward Smith, AIA,on ______________ using a Digital Signature.Printed copies of this document are not considered signed and sealed and the signature must be verified on any electronic copies. 09/24/ 2024 LIMITS OF CONSTRUCTION CONTRACTOR ACCESS TO SITE N ARCTURAS AVEEXISTING GENERATOR TEMPORARY 6'-0" HIGH CHAIN LINK FENCE FOR CONTRACTOR STAGING & LAYDOWN AREA. CONTRACTOR TO COORDINATE WITH OWNER 1. THE CONTRACTOR SHALL RESTORE OR REPLACE ANY PUBLIC OR PRIVATE PROPERTY (SUCH AS HIGHWAY, DRIVEWAY, WALKWAY, AND LANDSCAPING), DAMAGED BY HIS WORK, EQUIPMENT, OR EMPLOYEES, TO A CONDITION AT LEAST EQUAL TO THAT EXISTING IMMEDIATELY PRIOR TO THE BEGINNING OF CONSTRUCTION. SUITABLE MATERIALS AND METHODS SHALL BE USED FOR SUCH RESTORATION. 2. ALL UNPAVED SURFACES DISTURBED AS A RESULT OF CONSTRUCTION ACTIVITIES SHALL BE GRADED, SODDED, & RESTORED TO A CONDITION EQUAL TO OR BETTER THAN THAT WHICH EXISTED BEFORE THE CONSTRUCTION. 3. THE CONTRACTOR SHALL BE RESPONSIBLE FOR THE REPAIR AND RESTORATION OF EXISTING PAVEMENT, PIPES, CONDUITS, SPRINKLER HEADS, CABLES, ETC., AND LANDSCAPED AREAS DAMAGED AS A RESULT OF THE CONTRACTOR'S OPERATIONS AND/OR THOSE OF HIS SUBCONTRACTORS AND SHALL RESTORE AT NO ADDITIONAL COST. GENERAL NOTES:SealEDWARD SMITH, A.I.A.AR 101138Date: Phase:Drawn By:Checked By:Job No: TO THE BEST OF THE ARCHITECT'S AND/OR ENGINEER'S KNOWLEDGE THESE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE-SAFETY STANDARDS4525wSouthManhattanAvenue,Tampa,FL33611-2305T:813.839.0506 F:813.839.4616 AR0015104 1828 CGC1511025wwlongandaaooscitessc.m.THIS DOCUMENT IS COPYRIGHT MATERIAL, ANY DISCLOSURE, UNAUTH0RIZED USE, DISSEMINATION OR DUPLICATIONWITHOUT THE EXPRESS WRITTEN CONSENT OF LONG & ASSOCIATES IS PROHIBITED ALL RIGHTS RESERVEDLONG & ASSOCIATESARCHITECTS | ENGINEERS, INCDIGITAL SEALS 9/24/2024 9:46:51 AM A0.1CLEARWATER TRAFFIC OPERATIONSBUILDING REMODELFORCITY OF CLEARWATER1650 N. ARCTURAS AVE, CLEARWATER, FL 33765JCES 100% CONSTRUCTION DOCUMENTS 24034SEPTEMBER 24, 2024 SITE PLAN SCALE: 1" = 30'-0"1SITE PLAN N NO.DATE ISSUES & REVISIONS 1 09-24-24 100% CONSTRUCTIONDOCUMENTSEdward Smith, State of Florida, Registered Architect, License No. AR 101138This Item has been digitally signed and sealed by Edward Smith, AIA,on ______________ using a Digital Signature.Printed copies of this document are not considered signed and sealed and the signature must be verified on any electronic copies. 09/24/ 2024 VS OS OS 120' - 0"82' - 0"4' - 0"F.V.23' - 7 7/8"10' - 0"12' - 3 3/4"6' - 9"15' - 9"A6.1 9 8 A6.1 107 102 6 A6.1B4 C4 C4 4"2095 SFSIGN FABRICATION 101 123 SFOFFICE 102 226 SFMEN 103 236 SFWOMEN 104 46 SFJANITOR 105 434 SFTRAFFIC MANAGEMENT CENTER 107 181 SFOFFICE 109 360 SFBREAK 106 646 SFELECTRONIC REPAIR 108101 102 18' - 10" E4 A9607 5' - 5"23' - 8 1/2"D6 5' - 9"4' - 1 3/4" AX12006 AX12006AX12006 A12009 A12009 CLR1' - 6"4' - 0" LIMITS OF CONSTRUCTION 4746 SFWAREHOUSE 110 131 SFMECH 111 AX1010 AX10013AX10013 A9530 A 4' - 0"6' - 0"A12009 DRAWING KEY 101 A 101 NEW DOOR NEW WALL EXISTING DOOR TO REMAIN DOOR TAG WALL TAG EQUIPMENT / FURNITURE TAG EXISTING WALL TO REMAIN EXISTING DOOR TO BE DEMOLISHED EXISTING WALL TO BE DEMOLISHED EXISTING WINDOW TO REMAIN 2-HR FIRE RATED WALL AND ACOUSTICAL PANEL2'x2' SUSPENDED CEILING GRID SUPPLY AIR DIFFUSER TRANSFER GRILLE CEILING VANCANCY SENSORVS RECESSED FLUORESCENT 2'x4' LIGHT FIXTURE EXHAUST FAN REFLECTED CEILING PLAN LEGEND RECESSED FLUORESCENT2'x2' LIGHT FIXTURE EXISTING POWER POLE EXIT SIGN A9529 A9530 3 A1.1 10' - 4 7/8"5' - 9"14' - 1 3/4"19' - 2 7/8" A9505 A9509 A5102 LIMITS OF CONSTRUCTION A9505 AX1010 EL B/CEILING 108' - 0"4"4"4 7/8" B/SOFFIT 107' - 6" ATTATCH TO ROOF STRUCTURE ABOVE SUSPENDED ACOUSTIC CEILING 5/8'' GYP WALL BOARD 3 5/8'' MTL STUD W/ 4'' BATT INSULATION SealEDWARD SMITH, A.I.A.AR 101138Date: Phase:Drawn By:Checked By:Job No: TO THE BEST OF THE ARCHITECT'S AND/OR ENGINEER'S KNOWLEDGE THESE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE-SAFETY STANDARDS4525wSouthManhattanAvenue,Tampa,FL33611-2305T:813.839.0506 F:813.839.4616 AR0015104 1828 CGC1511025wwlongandaaooscitessc.m.THIS DOCUMENT IS COPYRIGHT MATERIAL, ANY DISCLOSURE, UNAUTH0RIZED USE, DISSEMINATION OR DUPLICATIONWITHOUT THE EXPRESS WRITTEN CONSENT OF LONG & ASSOCIATES IS PROHIBITED ALL RIGHTS RESERVEDLONG & ASSOCIATESARCHITECTS | ENGINEERS, INCDIGITAL SEALS 9/24/2024 9:43:35 AM A1.1CLEARWATER TRAFFIC OPERATIONSBUILDING REMODELFORCITY OF CLEARWATER1650 N. ARCTURAS AVE, CLEARWATER, FL 33765JCES 100% CONSTRUCTION DOCUMENTS 24034SEPTEMBER 24, 2024 FIRST FLOOR PLAN &REFLECTED CEILING PLAN SCALE: 1/8" = 1'-0"1 FIRST FLOOR PLAN KEYNOTE LEGEND NO.DESCRIPTION A5102 NEW WALL MOUNTED AIR DEVICE, SEE MECH A9505 NEW LAY-IN LIGHTING FIXTURE, SEE ELECTRICAL A9509 MECHANICAL RETURN AIR GRILLES, REF MECHANICAL DRAWINGS A9529 NEW 2'X4' SUSPENDED CEILING SYSTEM A9530 NEW SOFFIT, SEE DETAIL A9607 NEW CARPET, SEE FLOOR FINISH SCHEDULE A12009 NEW FURNITURE, OWNER SUPPLIED AX1010 EXISTING FIRE RATED PARTITION TO REMAIN, PROTECT AND MAINTAIN AX10013 EXISTING ELECTRICAL POWER POLE TO REMAIN. PROTECT & MAINTAIN, SEE ELECTRICAL DWGS AX12006 EXISTING FURNITURE TO REMAIN, PROTECT AND MAINTAIN SCALE: 1/8" = 1'-0"2 REFLECTED CEILING PLAN NO.STATUS DESCRIPTION COMMENTS 101 B WALL MOUNTED TV 102 C TVF Series LED Video Wall 9' X 16' GENERAL EQUIPMENT LIST ITEM STATUS LEGENDA -- PROVIDED BY CONTRACTOR, INSTALLED BY CONTRACTORB -- PROVIDED BY OWNER, INSTALLED BY CONTRACTORC -- PROVIDED BY OWNER, INSTALLED BY OWNER SCALE: 1 1/2" = 1'-0"3 SOFFIT DETAIL 0'4'8'16' N NO.DATE ISSUES & REVISIONS 1 09-24-24 100% CONSTRUCTIONDOCUMENTS 0'4'8'16' N Edward Smith, State of Florida, Registered Architect, License No. AR 101138This Item has been digitally signed and sealed by Edward Smith, AIA,on ______________ using a Digital Signature.Printed copies of this document are not considered signed and sealed and the signature must be verified on any electronic copies. 09/24/ 2024 5 7/8" VERIFY WALL TYPE2"GYP BD PARTITION SOUND ATTENUATIONWHERE APPLICABLE HM FRAME APPROVED SEALANT CONT. ALL AROUND BOTH SIDES METAL STUD HEADER METAL STUD TRACK 5 7/8"VERIFY WALL TYPE2"HM FRAME METAL STUD ANCHORS 4" , UON FACE OF ADJACENT PARTITION WHERE APPLICABLE MULTIPLE METAL STUDS TO STRUCTURE ABOVE APPROVED SEALANT CONT. ALL AROUND BOTH SIDES GYP BD PARTITION SOUND ATTENUATION WHERE APPLICABLE EL T/SLAB 100' - 0" EL B/CEILING 108' - 0" EL B/HIGH CEILING 114' - 0"2' - 0"9' - 0"3' - 0"PROVIDE WALL BRACING TO ROOF PURLINS PER MANUFACTURER RECOMMENDATIONS FOR LATERAL LOADS AS REQUIRED 6" 600S200-43 MTL STUD @ 16" O.C. 6" BATT INSULATION 3/4" PLYWOOD PAINTED WITH FIRE RESISTANT INTUMESCENT PAINT. ALL SIDES TO BE PAINTED 5/8" GYPSUM BOARD4"EXISTING WALL EXISTING SLAB EXISTING WALL SEALANT CONT. BOTH SIDES 5/8'' GYP WALL BOARD 3 5/8'' MTL STUD 4'' BATT INSULATION EL T/SLAB 100' - 0" EL B/HIGH CEILING 114' - 0" 9'x16' LED WALL EQ15' - 11 3/4"EQ 3' - 0"9' - 0"2' - 0"4'' VINYL WALL BASE FINSHED FLOOR DOOR NUMBER, TYP SCHEDULESEE DOOR SEE DOOR SCHEDULE2"2"2"1 SEE SCHED A SCWD FLUSHSEE DOOR SCHEDULEDOOR LVT, VCT, OR CONC. SEE ROOM FINISH SCHEDULE VINYL CARPET TRIM SECURED TO CONC FLOOR CARPET GYP BD PARTITION SOUND ATTENUATIONWHERE APPLICABLE HM FRAME GLASS STOP GLASS 5 3/4"2"APPROVED SEALANT CONT. ALL AROUND GYP BD PARTITION SOUND ATTENUATION WHERE APPLICABLE DOUBLE METAL STUD TO STRUCTURE ABOVE HM FRAME METAL STUD JAMB ANCHORS APPROVED SEALANT CONT. ALL AROUND BOTH SIDES 2"VERIFY WITH WALL TYPE6"3' - 0"4' - 0"4' - 0" 2" A HM INT HOLLOW METAL FRAME 1/4'' CLEAR TEMPERED GLAZING FINISH SCHEDULE LEGEND ACT ACOUSTICAL CEILING TILECMUCONCRETE MASONRY UNITCONCCONCRETEEXPEXPOSEDEXSTEXISTINGGYPGYPSUM WALL BOARDPPAINTCPTCARPET TILEVVINYLVCTVINYL COMPOSITION TILE SealEDWARD SMITH, A.I.A.AR 101138Date: Phase:Drawn By:Checked By:Job No: TO THE BEST OF THE ARCHITECT'S AND/OR ENGINEER'S KNOWLEDGE THESE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE-SAFETY STANDARDS4525wSouthManhattanAvenue,Tampa,FL33611-2305T:813.839.0506 F:813.839.4616 AR0015104 1828 CGC1511025wwlongandaaooscitessc.m.THIS DOCUMENT IS COPYRIGHT MATERIAL, ANY DISCLOSURE, UNAUTH0RIZED USE, DISSEMINATION OR DUPLICATIONWITHOUT THE EXPRESS WRITTEN CONSENT OF LONG & ASSOCIATES IS PROHIBITED ALL RIGHTS RESERVEDLONG & ASSOCIATESARCHITECTS | ENGINEERS, INCDIGITAL SEALS 9/24/2024 9:43:36 AM A6.1CLEARWATER TRAFFIC OPERATIONSBUILDING REMODELFORCITY OF CLEARWATER1650 N. ARCTURAS AVE, CLEARWATER, FL 33765JCES 100% CONSTRUCTION DOCUMENTS 24034SEPTEMBER 24, 2024 SCHEDULES ANDDETAILS DOOR SCHEDULE DOOR FRAME DETAILS REMARKSNO.TYPE PAIR WIDTH HEIGHT MAT RATING FINISH HW TYPE MAT HEAD JAMB SILL 102 A 3' - 0"7' - 0"SCWD N/A NAT 1 HM 4/A6.1 3/A6.1 107 A 3' - 0"7' - 0"SCWD N/A NAT 1 HM 4/A6.1 3/A6.1 6/A6.1 SCALE: 3" = 1'-0"4 HEAD DETAIL SCALE: 3" = 1'-0"3 JAMB DETAIL SCALE: 3/4" = 1'-0"6WALL SECTION SCALE: 1 1/2" = 1'-0"8DETAIL SCALE: 1/4" = 1'-0"9INTERIOR ELEVATION DOOR SCHEDULE LEGEND ALUM ALUMINUMHM HOLLOW METALMFRMANUFACTURER'S FINISHNATNATURAL FINISHPPAINTPRPAIRSCWDSOLID CORE WOOD DOOR SCALE: 1/4" = 1'-0"1 DOOR FRAME TYPES SCALE: 1/4" = 1'-0"2 DOOR TYPES ROOM FINISH SCHEDULE NO.NAME FLOOR MAT/FIN BASEMAT NORTH WALLMAT EAST WALLMAT SOUTH WALLMAT WEST WALLMAT CEILING REMARKSMATHEIGHT 101 SIGN FABRICATION VCT EXST EXST EXST EXST EXST EXST ACT EXST 8'-0" 102 OFFICE VCT EXST V GYP/P GYP EXST GYP EXST GYP/P ACT EXST 8'-0" 103 MEN VCT EXST EXST EXST EXST EXST EXST ACT EXST 8'-0" 104 WOMEN VCT EXST EXST EXST EXST EXST EXST ACT EXST 8'-0" 105 JANITOR VCT EXST EXST EXST EXST EXST EXST ACT EXST 8'-0" 106 BREAK VCT EXST EXST EXST EXST EXST EXST ACT EXST 8'-0" 107 TRAFFIC MANAGEMENT CENTER CPT V GYP EXST GYP EXST GYP/P GYP/P ACT 14'-0"COORDINATE CEILING HEIGHT WITHEXISTING STRUCTURE 108 ELECTRONIC REPAIR VCT EXST EXST EXST GYP/P EXST EXST ACT EXST 8'-0" 109 OFFICE VCT EXST EXST EXST EXST EXST EXST ACT EXST 8'-0" 110 WAREHOUSE 111 MECH SCALE: 3" = 1'-0"7THRESHOLD DETAIL OTY DESCRIPTION CATALOG NUMBER FINISH MFR 3 EA HINGE 3CB1 4.5 X 4.5 652 IVE1EAWALL STOP WS406 / 407CCV 630 IVE1EAGASKETING 188SBK PSA BK ZER REUSE LOCK/LEVER HARDWARE FROM EXISTING REMOVED DOORS IN NEW DOORS DOOR HARDWARE NO.DATE ISSUES & REVISIONS 1 09-24-24 100% CONSTRUCTIONDOCUMENTS SCALE: 3" = 1'-0"10HM WINDOW HEAD DETAIL SCALE: 3" = 1'-0"11HM WINDOW JAMB DETAIL SCALE: 1/4" = 1'-0"5 WINDOW TYPES Edward Smith, State of Florida, Registered Architect, License No. AR 101138This Item has been digitally signed and sealed by Edward Smith, AIA,on ______________ using a Digital Signature.Printed copies of this document are not considered signed and sealed and the signature must be verified on any electronic copies. 09/24/ 2024 CODE COMPLIANCETHIS PROJECT COMPLIES WITH THE REQUIREMENTS OF THE FLORIDA BUILDING CODE 8TH EDITION (2023)DESIGN CONDITIONSTEMPERATURESFRESH AIRWINTER - INDOORS: 70° DBWINTER - OUTDOORS: 32° DBOFFICE SPACE - 5.0 CFM / PERSON + 0.06 CFM / FT²WORKSPACE - 7.5 CFM / PERSON + 0.12 CFM / FT² SUMMER - INDOORS: 75° DB, 62.5° WB (50% RH)SUMMER - OUTDOORS: 91° DB, 80° WBB.D.E.F.H.G.I.J.K.STANDARDS AND RECOMMENDATIONS.ALL DUCTS SHALL BE GROUNDED ACROSS FLEXIBLE CONNECTIONS.ALL RETURN AND EXHAUST DUCTWORK SHALL BE LOW PRESSURE (1" NEGATIVE), SEAL CLASS A.DUCTWORK SHALL BE GALVANIZED STEEL. CONSTRUCT AND INSTALL PER ASHRAE AND SMACNABEFORE FABRICATION, VERIFY AND COORDINATE ALL DIMENSIONS IN FIELD.SEE SMACNA STDS FOR WEIGHT, BRACING, REQUIREMENTS, ETC. OF DUCTWORK.FURNISH BUILDING ACCESS PANELS FOR ACCESS TO DEFLECTING AND BALANCING DEVICES IN DUCTS, FIRE DAMPERS, CONTROLS, ETC.DUCT SIZES AND OPENINGS THRU ROOFS, SLABS AND WALL PARTITIONS SHALL SUIT EQUIPMENT FURNISHED.SHOP AND COORDINATION DRAWINGS AT A 1/4"= 1'-0" SCALE. COORDINATE DIFFUSER AND REGISTER LOCATIONS WITH BUILDING STRUCTURE, LIGHTING LAYOUT ANDDUCTWORK LOCATIONS AND CLEARANCES SHALL BE COORDINATED WITH ALL OTHER TRADES. PREPARECEILING PLAN.ALL HVAC WORK SHALL BE IN ACCORDANCE WITH ALL APPLICABLE CODES AND NFPA REGULATIONS.A.L.M.N.O.Q.P.R.T.U.ALL DUCT SIZES SHOWN ARE CLEAR INSIDE (SHEET METAL) DIMENSIONS. ALLOW CLEARANCES FOR INSULATION REFER TO SPECIFICATIONS FOR INSULATION THICKNESSES.COMPLETE COORDINATION AND SHOP DRAWINGS AS SPECIFIED.MAINTENANCE OF ALL FANS, DAMPERS AND MECHANICAL EQUIPMENT.TO SUIT EQUIPMENT FURNISHED. PROVIDE FULL SIZE DRAIN & TRAP FOR EACH UNIT.ADDITIONAL COST TO THE OWNER. IN GENERAL KEEP ALL DUCTWORK AS HIGH AS POSSIBLE. PREPARE(INCLUDING DIVIDED DUCTS) AND TRANSITIONS AROUND OBSTRUCTIONS SHALL BE PROVIDED AT NOTHAT MAY BE REQUIRED TO AVOID ALL OTHER BUILDING ELEMENTS. COORDINATE LOCATIONS OF HOLES IN WALLS, SLABS AND FLOOR SLAB WITH GENERAL CONTRACTOR.INSURE THAT DUCTS PENETRATING FLOORS ARE PLACED WITHIN THE CLEAR SPACE BETWEEN JOISTS BELOW.DRAWINGS ARE DIAGRAMMATIC AND DO NOT SHOW ALL OFFSETS, BENDS, TRANSITIONS, DROPS, ETC.INSIDES OF DUCTS VISIBLE THROUGH GRILLES, REGISTERS OR DIFFUSERS SHALL BE PAINTED FLAT BLACK.ALL WORK SHALL BE COORDINATED WITH ALL OTHER TRADES INVOLVED. OFFSETS IN DUCTS AND PIPINGREFER TO MANUFACTURERS RECOMMENDATIONS REGARDING INSTALLATION OF EQUIPMENT.CONDENSATE DRAINS FROM AIR HANDLERS AND COILS SHALL BE COORDINATED FOR PROPER DRAINAGEACCESS DOORS IN DUCTWORK & CEILINGS SHALL BE FURNISHED WHERE REQUIRED FOR OPERATION &ALL EQUIPMENT, DUCTWORK, ETC. SHALL BE SUPPORTED AS REQUIRED. PROVIDE ADDITIONAL SUPPORTS AS REQUIRED TO PROVIDE VIBRATION-FREE, RIGID INSTALLATION.V.X.W.Y.AA.Z.BB.CC.AN ADJUSTABLE VOLUME DAMPER.ALL RECTANGULAR ELBOWS SHALL HAVE DOUBLE THICKNESS TURNING VANES.PROVIDE DAMPERS IN EACH SUPPLY, RETURN, AND EXHAUST BRANCH FOR BALANCING.ALL TAPS IN LOW PRESSURE DUCTS FOR DIFFUSERS AND DUCTWORK BRANCH TAKEOFFS SHALL HAVEALL TAPS FOR MEDIUM PRESSURE DUCTS RUNOUTS SHALL BE CONICAL OR BELLMOUTH (WITHOUT DAMPERS).ALL TAPS FOR LOW PRESSURE DUCT RUNOUTS SHALL BE AS INDICATED IN DRAWINGS AND DETAILS.DD.HVAC GENERAL NOTES:PROVIDE AUXILIARY SUPPORT CHANNELS FOR HEATERS, DUCTS, VAV BOXES, AND OTHERALL EXPOSED PIPING & DUCTWORK IN FINISHED SPACES SHALL BE FIELD PAINTED.SUSPENDED EQUIPMENT.ALL LOW VOLTAGE AUTOMATIC TEMPERATURE CONTROL AND EMCS WIRING SHALL BE CONCEALED INCONDUIT.INSTALLATION OF AUTOMATIC TEMPERATURE CONTROL AND EMCS COMMUNICATIONS CONDUIT SYSTEMWITHIN BUILDINGS (WHERE REQUIRED) SHALL BE THE RESPONSIBILITY OF DIVISION 23. INSTALLATIONOF AUTOMATIC TEMPERATURE CONTROL AND EMCS COMMUNICATION WIRING SHALL BE THERESPONSIBILITY OF DIVISION 23.S.PROVIDE FIRE DAMPERS AND ACCESS DOORS IN ALL DUCTS THRU RATED WALLS OR SLABS.FF.LOCATIONS OF DUCT MOUNTED SMOKE DETECTORS SHOWN ON THE DRAWINGS ARE REFERENCE LOCATIONSONLY. THE FINAL PLACEMENT OF THE DETECTOR IN THE DUCTWORK SHALL MEET THE REQUIREMENTSOF THE MANUFACTURER'S INSTALLATION INSTRUCTIONS. PROVIDE A PRESSURE DIFFERENTIAL TEST ANDTHE MANUFACTURER'S TEST KIT. A COPY OF ALL TEST DATA WILL BE MADE AVAILABLE AT THE FINAL INSPECTION.PROVIDE READILY ACCESSIBLE DUCT ACCESS DOOR FOR INSPECTION AND SERVICING THE DETECTOR. DIVISION 28 SHALL PROVIDE ALL WORK ASSOCIATED WITH THE INSTALLATION OF THIS DETECTOR.GG.MECHANICAL CONTRACTOR SHALL SIZE AND INSTALL REFRIGERANT PIPING PER MANUFACTURER'SRECOMMENDATIONS. REFRIGERANT PIPING SHALL BE TYPE "ACR" COPPER WITH BRAZED JOINTS.APPLY 3/4" CLOSED CELL INSULATION ON COMPRESSOR SUCTION LINE.EE.ALL RETURN GRILLES SHALL BE PROTECTED BY FILTERS UNTIL TEST AND BALANCE IS DONE.HH.LOCATE THERMOSTATS 48" ABOVE FINISHED FLOOR, UNLESS OTHERWISE NOTED, IN ACCORDANCE WITH ADA.II.ALL 3-PHASE MECHANICAL EQUIPMENT SHALL HAVE PHASE OUT DEVICES INSTALLED WITH AUTOMATIC RESET TO PROTECT THE UNITS IN THE EVENT POWER WERE TO SINGLE PHASE.ALL DUCTS SHALL BE METAL EXTERIOR WRAPPED WITH FOIL-FACED BLANKET. LINED DUCT SHALL NOT BE USED. EXPOSED AREAS SEALED WITH MASTIC, DUCT BOARD, TAPE AND STAPLED EVERY EIGHT (8) INCHES.ALL OUTDOOR EQUIPMENT IS TO BE TIED DOWN /ANCHORED TO MEET COMPONENT CLADDING PRESSURES INDICATED ON THE DRAWINGS. PROVIDE SIGNED AND SEALED CALCULATIONS BY A SPECIALTY ENGINEER CURRENTLY REGISTERED IN THE STATE OF FLORIDA DURING THE SHOP REVIEW.C.SCHECK VALVERELIEF VALVEFLEX DUCT CONNECTORTWTSFMPSTEMPERATURE SENSOR, AVERAGING TYPETEMPERATURE SENSOR, IMMERSION TYPEHUMIDITY SENSOR, DUCT MOUNTEDCO2 SENSOR, DUCT MOUNTEDMMVIBRATION SWITCHCEILINGCLGDL DOOR LOUVERDOWNDNEFEXHAUST FANEMCSENERGY MGMT & CONTROL SYSTEMFDFD-XFLOOR DRAINFIRE DAMPERGRILLEHBGRHOSE BIBBOBDPLACESPLOPPOSED BLADE DAMPERPRV POWER ROOF VENTROOMRMSDSMOKE DETECTORSWITCHSWVVAVVARIABLE AIR VOLUMEXFRTRANSFERSWITCH (KEYED) - NIGHT OVERRIDEUCAD-XADAIR DEVICE NO "X"ACCESS DOOR (DUCT AND EQUIPMENT)COMPRCOMPRESSORCLEANOUTCOCONDENSING UNITCUDIRECT EXPANSIONDXEND SWITCHESFORWARD CURVEFCRPMREVOLUTIONS PER MINUTEBTUHCDBRITISH THERMAL UNITS PER HOURCEILING DIFFUSERCENTDBCENTRIFUGALDRY BULB (°F)EACHEAEFFEFFICIENCYELEXTEXTERNALELEVATIONGATE VALVEUNION (DIELECTRIC IF REQUIRED)DOMESTIC COLD WATERFoFEETFTDEGREES FAHRENHEITGPMFPMFEET PER MINUTEGALLONS PER MINUTECYCLEHZHPINCHESKWINKILOWATTSHORSEPOWERMAXIMUMMAXMDNECKNKMOTORIZED DAMPER PRESSURE GAUGE WITH NEEDLE VALVETHERMOMETER IN SEPARABLE WELLTHERMO WELLSTRAINERGLOBE VALVEPUMPMANUAL VOLUME DAMPERMOTORIZED DAMPER, OPPOSED BLADEMOTORIZED DAMPER, PARALLEL BLADEOAPOUTSIDE AIRDIFFERENCE IN PRESSUREPSIREGISTERREGRAPOUND PER SQUARE INCH (GAUGE)RETURN AIRSA SUPPLY AIRSPSTATIC PRESSURE90 ELBOW WITH TURNING VANESFLEX DUCTRETURN/TRANSFER AIR REGISTER OR GRILLESUPPLY DUCT SECTIONSUPPLY AIR DIFFUSER OR GRILLEDIRECTION OF BLOW1-WAY, 2-WAY, 3-WAY OR 4-WAYRETURN AIR DUCT SECTIONDPDIFFERENTIAL PRESSURENOT TO SCALENTSTYPICALUCTYPVOLTSUONUNDERCUT DOORUNLESS OTHERWISE NOTEDVDVTRWBVOLUME DAMPER (MANUAL)WET BULB (°F)VENT THRU ROOFWGWATER GAUGESHTSWITCH - TIMERHUMIDISTATTHERMOSTATSMOKE DETECTORPHASEOOROUND, DIAMETERDOOR LOUVER (12x12 UON )UNDERCUT DOOR (1" UON )AFFABOVE FINISHED FLOORBDDBODBACKDRAFT DAMPERBOTTOM OF DUCTREFRIGERANT SUCTIONREFRIGERANT LIQUIDRSRLREFRIGERANT HOT GASRHTEMPERATURE SENSOR WELLFLOW METERPRESSURE SENSOR TAPBALL VALVEHOSE END DRAIN VALVEATCAUTOMATIC TEMPERATURE CONTROLFLAT OVALCUBIC FEET PER MINUTECFMSTAINLESS STEELSSNCNOISE CRITERIAMCB MAIN CIRCUIT BREAKERMBH1,000 BRITISH THERMAL UNITS PER HOURMANUFACTURERMFGEXHAUST REGISTER OR GRILLECSRCURRENT SENSING RELAYLEGENDSDIFFERENTIAL PRESSUREDPTEMPERATURETEMPRSROOM SENSOREXHAUST AIR DUCT SECTIONFDFIRE DAMPER - VERTICALVDMANUAL VOLUME DAMPERMANUAL BUTTERFLY VALVESMOTORIZED SMOKE DAMPER, PARALLEL BLADESealWILLIAM E. BROWN, P.E.PE 57975Date:Phase:Drawn By:Checked By:Job No:TO THE BEST OF THE ARCHITECT'S AND/OR ENGINEER'S KNOWLEDGE THESE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE-SAFETY STANDARDS4525wSouthManhattanAvenue,Tampa,FL33611-2305T:813.839.0506 F:813.839.4616 AR0015104 1828 CGC1511025wwlonganda ao oscites sc.m.THIS DOCUMENT IS COPYRIGHT MATERIAL, ANY DISCLOSURE, UNAUTH0RIZED USE, DISSEMINATION OR DUPLICATIONWITHOUT THE EXPRESS WRITTEN CONSENT OF LONG & ASSOCIATES IS PROHIBITED ALL RIGHTS RESERVEDLONG & ASSOCIATESARCHITECTS | ENGINEERS, INCDIGITAL SEALS9/24/2024 11:35:52 AMM0.1CLEARWATER TRAFFIC OPERATIONSBUILDING REMODELFORCITY OF CLEARWATER1650 N. ARCTURAS AVE, CLEARWATER, FL 33765WZWEB100% CONSTRUCTION DOCUMENTS24034SEPTEMBER 24, 2024GENERAL NOTES,LEGEND & DETAILSNO. DATE ISSUES & REVISIONS1 09-24-24 100% CONSTRUCTIONDOCUMENTSWilliam E. Brown, State of Florida, Professional Engineer, License No. PE 57975This Item has been digitally signed and sealed by William E. Brown, PE,on ______________ using a Digital Signature.Printed copies of this document are not considered signed and sealed and the signature must be verified on any electronic copies. 09/24/ 2024 TTCU-2 CU-1EXIST EXISTMD4005110WAREHOUSE106BREAK105JANITOR104WOMEN103MEN101SIGN FABRICATION102ELECTRONIC REPAIR109OFFICE107OFFICE108OFFICE111MECHMX4004MD4013MD4002MD4002MX4003MD1501MX4006LIMITS OF CONSTRUCTIONSealWILLIAM E. BROWN, P.E.PE 57975Date:Phase:Drawn By:Checked By:Job No:TO THE BEST OF THE ARCHITECT'S AND/OR ENGINEER'S KNOWLEDGE THESE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE-SAFETY STANDARDS4525wSouthManhattanAvenue,Tampa,FL33611-2305T:813.839.0506 F:813.839.4616 AR0015104 1828 CGC1511025wwlonganda ao oscites sc.m.THIS DOCUMENT IS COPYRIGHT MATERIAL, ANY DISCLOSURE, UNAUTH0RIZED USE, DISSEMINATION OR DUPLICATIONWITHOUT THE EXPRESS WRITTEN CONSENT OF LONG & ASSOCIATES IS PROHIBITED ALL RIGHTS RESERVEDLONG & ASSOCIATESARCHITECTS | ENGINEERS, INCDIGITAL SEALS9/24/2024 11:35:52 AMMD1.1CLEARWATER TRAFFIC OPERATIONSBUILDING REMODELFORCITY OF CLEARWATER1650 N. ARCTURAS AVE, CLEARWATER, FL 33765WZWEB100% CONSTRUCTION DOCUMENTS24034SEPTEMBER 24, 2024DEMOLITION FLOORPLANSCALE:1/8" = 1'-0"1DEMOLITION FLOOR PLAN0'4'8'16'KEYNOTE LEGENDNO. DESCRIPTIONMD1501 CAREFULLY REMOVE WALL MOUNTED THERMOSTAT. PROTECT AND SAVE FOR INSTALLATIONAT NEW LOCATION.MD4002 REMOVE EXISTING TRANSFER GRILLS AND FLEX DUCT.MD4005 EXISTING SUPPLY AIR DEVICE TO BE DEMOLISHED (TYP.) REMOVE ALL ASSOCIATED DUCTWORKTO POINTS INDICATED. PREPARE FOR NEW WORK.MD4013 REMOVE EXISTING OVERHEAD DUCTWORK TO POINTS INDICATED (TYP.) PREPARE FORINSTALLATION OF NEW DUCTWORK.MX4003 EXISTING AHU TO REMAIN.MX4004 EXISTING DUCT TO REMAIN.MX4006 EXISTING AIR DEVICE TO REMAIN (TYP.)NNO. DATE ISSUES & REVISIONS1 09-24-24 100% CONSTRUCTIONDOCUMENTSWilliam E. Brown, State of Florida, Professional Engineer, License No. PE 57975This Item has been digitally signed and sealed by William E. Brown, PE,on ______________ using a Digital Signature.Printed copies of this document are not considered signed and sealed and the signature must be verified on any electronic copies. 09/24/ 2024 TTT400 CFMEXISTAC-1380 CFMEXIST385 CFMEXIST375 CFMEXISTOFFICE109ELECTRONIC REPAIR108OFFICE102SIGN FABRICATION101MEN103WOMEN104BREAK106JANITOR105TRAFFIC MANAGEMENT CENTER107380 CFMEXISTMX4003MX4005CU-3AD-1400 CFMAD-1230 CFMCU-1CU-2EXISTEXISTAHU-1EXISTAHU-2EXIST380 CFMAD-210ø10ø12ø24x18MX1504M1505M15068øAD-2AD-2MECH111WAREHOUSE110AD-4ø8LIMITS OF CONSTRUCTIONLIMITS OF CONSTRUCTION22x22 DOWN TO AD-2SealWILLIAM E. BROWN, P.E.PE 57975Date:Phase:Drawn By:Checked By:Job No:TO THE BEST OF THE ARCHITECT'S AND/OR ENGINEER'S KNOWLEDGE THESE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE-SAFETY STANDARDS4525wSouthManhattanAvenue,Tampa,FL33611-2305T:813.839.0506 F:813.839.4616 AR0015104 1828 CGC1511025wwlonganda ao oscites sc.m.THIS DOCUMENT IS COPYRIGHT MATERIAL, ANY DISCLOSURE, UNAUTH0RIZED USE, DISSEMINATION OR DUPLICATIONWITHOUT THE EXPRESS WRITTEN CONSENT OF LONG & ASSOCIATES IS PROHIBITED ALL RIGHTS RESERVEDLONG & ASSOCIATESARCHITECTS | ENGINEERS, INCDIGITAL SEALS9/24/2024 11:35:52 AMM1.1CLEARWATER TRAFFIC OPERATIONSBUILDING REMODELFORCITY OF CLEARWATER1650 N. ARCTURAS AVE, CLEARWATER, FL 33765WZWEB100% CONSTRUCTION DOCUMENTS24034SEPTEMBER 24, 2024FLOOR PLANSCALE:1/8" = 1'-0"1FLOOR PLAN0'4'8'16'KEYNOTE LEGENDNO. DESCRIPTIONM1505 REINSTALLED WALL MOUNTED THERMOSTAT AT NEW LOCATION, COORDINATE WITH OWNER.M1506 WALL MOUNTED THERMOSTAT, COORDINATE LOCATION WITH OWNER.MX1504 EXISTING TEMPERATURE CONTROL THERMOSTAT TO REMAIN. PROTECT DURINGCONSTRUCTION.MX4003 EXISTING AHU TO REMAIN.MX4005 EXISTING LAY-IN DIFFUSER. BALANCE TO CFM INDICATED IN PLANS (TYP).NNO. DATE ISSUES & REVISIONS1 09-24-24 100% CONSTRUCTIONDOCUMENTSWilliam E. Brown, State of Florida, Professional Engineer, License No. PE 57975This Item has been digitally signed and sealed by William E. Brown, PE,on ______________ using a Digital Signature.Printed copies of this document are not considered signed and sealed and the signature must be verified on any electronic copies. 09/24/ 2024 SEALING STIP &FASTNER PROVIDED BY MANUFACTURERSUPPLY OR RETURNGRILL22 GAUGE GALVANIZED STEEL ANGLE, SECURE TO DUCT , DROP WITH SHEET METALFASTNERS, TYP.GALVANIZED STEEL SUPPORT STRAP, TYPICAL ON BOTH SIDES OF DUCTWALLDUCTMOUNTING FOOT BY UNIT MFR (TYP)GRADESECURE UNIT TO EQUIPMENT PAD WITH SS THREADED FASTENERSMINI-SPLIT SYSTEMCONDENSING UNITSERVICE VALVE REFRIGERANT PIPING BY UNIT MFREQUIPMENT PADNOTE: ANCHOR UNIT TO PAD TO WITHSTAND WIND LOADS AS INDICATED ON DRAWINGS IN ACCORDANCE WITH MANUFACTURER'S RECOMMENDATIONS.NOTE: ROUTE REFRIGERANT PIPING UP THE EXTERIOR OF THE WALL AND THROUGH TO THE WALL-MOUNTED EVAPORATOR. PROVIDE REFRIGERANT LINE INSULATION PER MFR. RECOMMENDATIONS. PROVIDE PAINTED, GALVANIZED SHEET METAL COVER FOR PIPING AND WIRING."W" AND LENGTH "L"SUPPORT FROMRADIUSCEILING &CONNECTIONS FORPROVIDE RIGID DUCTCEILING &GALV STEEL SUPPORT STRAPOF DIFFUSERINSULATE BACK AND NECKSEALING STRIPSUPPLY AIR DEVICEAIR DEVICE MFRFASTENER BYGALV STEEL ANGLESEALING STRIPDEVICE MFRFASTENER BY AIRBACK PLATERIGID DUCT DROP"W" x "L"STRUCTURESEAL DROP TO DIFFUSERRIGID DUCT DROP"W" x "L"BEND RADIUS MUST EQUALOR EXCEED FLEXIBLE DUCTDIASTRUCTURESUPPORT FROMWITHOUT TURNING VANES90° RECTANGULAR ELLGALV STEEL SUPPORT STRAPTYP EACH SIDE OF DUCTAIR DEVICE OF WIDTHRETURN OR EXHAUST"X" x "L"SECURE TO ELL 2 PLACES EA STRAPCEILING &SUPPORT SYSTEMSUPPORT SYSTEM"W" AND LENGTH "L"RETURN OR EXHAUSTCEILING &AIR DEVICE OF WIDTHSECURE TO ELL 2 PLACES EA STRAP"X" x "L"WITHOUT TURNING VANESTYP EACH SIDE OF DUCTGALV STEEL SUPPORT STRAP90° RECTANGULAR ELLSURFACE MOUNTED RETURN OR EXHAUST AIR DEVICES22 GUAGE GALV STEEL ANGLE,TYP - SECURE TO DUCTDROP WITH SHEET METALFASTENERS, TYPSURFACE MOUNTED SUPPLY AIR DEVICERADIUSBEND RADIUS MUST EQUALOR EXCEED FLEXIBLE DUCTDIADUCTS LOCATED ABOVEINACCESSIBLE CEILINGSNOTE:NOTES:INSULATION OMITTED FOR CLARITY.LAY-IN AND PANEL MOUNTED RETURN OR EXHAUST AIR DEVICES1.2.PAINT INSIDE OF DUCTWORK THATIS VISIBLE THROUGH AIR DEVICEFLAT BLACK.FLAT BLACK.IS VISIBLE THROUGH AIR DEVICEPAINT INSIDE OF DUCTWORK THAT2.1.INSULATION OMITTED FOR CLARITY.NOTES:LAY-IN AND PANEL MOUNTED SUPPLY AIR DEVICESNOTE:INACCESSIBLE CEILINGSDUCTS LOCATED ABOVEPROVIDE RIGID DUCTCONNECTIONS FORINSULATE BACK AND NECKOF DIFFUSERGALV STEEL SUPPORT STRAPSUPPLY AIR DEVICE"W"SUPPORTSUPPORTSYSTEM"D"SYSTEMNECK AND SECURE WITHSHEET METAL FASTENERSMIN 2 EACH SIDE"W"HEIGHT TO SUIT"X" AS INDICATEDHEIGHT TO SUIT"X" AS INDICATED"D"SUPPORT FROMSTRUCTURESUPPORT FROMSTRUCTURESealWILLIAM E. BROWN, P.E.PE 57975Date:Phase:Drawn By:Checked By:Job No:TO THE BEST OF THE ARCHITECT'S AND/OR ENGINEER'S KNOWLEDGE THESE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE-SAFETY STANDARDS4525wSouthManhattanAvenue,Tampa,FL33611-2305T:813.839.0506 F:813.839.4616 AR0015104 1828 CGC1511025wwlonganda ao oscites sc.m.THIS DOCUMENT IS COPYRIGHT MATERIAL, ANY DISCLOSURE, UNAUTH0RIZED USE, DISSEMINATION OR DUPLICATIONWITHOUT THE EXPRESS WRITTEN CONSENT OF LONG & ASSOCIATES IS PROHIBITED ALL RIGHTS RESERVEDLONG & ASSOCIATESARCHITECTS | ENGINEERS, INCDIGITAL SEALS9/24/2024 11:35:53 AMM3.1CLEARWATER TRAFFIC OPERATIONSBUILDING REMODELFORCITY OF CLEARWATER1650 N. ARCTURAS AVE, CLEARWATER, FL 33765WZWEB100% CONSTRUCTION DOCUMENTS24034SEPTEMBER 24, 2024DETAILSSCALE:NTS2WALL MOUNTED GRILLESCALE:NTS3MINI-SPLIT CONDENSING UNIT MOUNTINGSCALE:NTS1AIR DEVICE CONNECTION DETAILSNO. DATE ISSUES & REVISIONS1 09-24-24 100% CONSTRUCTIONDOCUMENTSWilliam E. Brown, State of Florida, Professional Engineer, License No. PE 57975This Item has been digitally signed and sealed by William E. Brown, PE,on ______________ using a Digital Signature.Printed copies of this document are not considered signed and sealed and the signature must be verified on any electronic copies. 09/24/ 2024 DUCTLESS SPLIT SYSTEM SCHEDULENOTES1. PROVIDE WITH SINGLE POINT POWER, INTEGRAL THERMOSTAT AND PERMANENT CLEANABLE FILTER.2. DISCONNECT BY DIVISION 26.3. PROVIDE WITH HURRICANE RATED EQUIPMENT PAD.4. STARTUP AND FIRST YEAR WARRANTY BY THE MANUFACTURER. 2ND THRU 5TH YEAR WARRANTY ON PARTS AND REFRIGERANT ONLY.5. ROUTE CONDENSATE PIPING AND ROUTE TO DRAIN AT EXTERIOR OF BUILDING IN GRASS AREA.TAGMOCPCOOLINGMAX COIL AIRFLOWSEERCOMPMCAFAN FLANOTES:MODELMANUFACTURERCOMPRLAVOLTSPHASEAC-1/ CU-3ALL2630,000 BTU/HR77520.0190.4MITSUBISHI7.0208/2301PKA-A30KA8/PUY-A30-NHA7AIR DEVICE SCHEDULEMARKSERVICETYPE FACEBORDERFACE SIZENECK SIZEAIR VOLUMEMAX SP LOSSMAX NCMATERIALFINISHMFRMODELREMARKSAD-1SUPPLYSQUARE CONELAY-IN24x24SEE PLANS SEE PLANS0.1020ALUMINUMWHITEPRICEASCD1, 2SCHEDULE NOTES:1. FLEX DUCT SIZE TO MATCH NECK SIZE, MINIMUM LENGTH OF FLEX SHALL BE 6'-0" TO A MAXIMUM OF 10'-0", BALANCE OF DUCT SHOWN ON PLAN SHALL BE RIGID STEEL DUCT SAME AS NECK SIZE, EXTERNALLY INSULATED.2. PROVIDE RUNOUT BRANCH DUCT TO AIR DEVICE SAME SIZE AS AIR DEVICE NECK UNLESS OTHERWISE NOTED ON PLANS.3. FURNISH WITH OPPOSED BLADE DAMPERS FOR SIDEWALL OR DUCT MOUNTED APPLICATIONS.AIR DEVICE GENERAL NOTES:A. ALL UNITS FOR LAY-IN T-BAR GRILLE SHALL BE PROVIDED WITH TYPE 3 BORDER CEILING MODULE (24X24).B. ALL AIR DEVICES SHALL HAVE PAINTED WHITE FINISH.C. ALL 24X24 FACE AIR DEVICES INSTALLED IN HARD CEILINGS SHALL BE PROVIDED WITH T-BAR FRAME FOR PLASTER OR GYPSUM CEILINGSD. PROVIDE SQUARE TO ROUND TRANSITIONS AS REQUIRED FOR COORDINATION OF DUCT AND AIR DEVICE NECK.E. COORDINATE FRAME TYPE WITH LATEST ARCHITECTURAL REFLECTED CEILING PLAN.F. INSULATE THE TOPS OF ALL SUPPLY AIR DEVICES, REFER TO SPECIFICATIONS.G. AIR DEVICES LOCATED IN HARD CEILINGS SHALL BE EQUIPPED WITH AN OPPOSED BLADE DAMPER ADJUSTABLE FROM FACE OF DEVICE.H. ALL DIFFUSERS 4-WAY THROW UNLESS OTHERWISE NOTED.I. AIR DEVICES USED FOR THE TRANSFER OF AIR DO NOT REQUIRE O.B.D. OR FILTER.SUPPLYAD-3LOUVERED FACEWALL MOUNTED12x8SEE PLANS SEE PLANS0.1020ALUMINUMWHITEPRICE6201, 2, 3TRANSFEREGG CRATELAY-IN24x24SEE PLANS SEE PLANS0.1020ALUMINUMWHITEPRICE801, 2AD-2TRANSFER24x16 SEE PLANS SEE PLANS0.1020ALUMINUMWHITEPRICE6301, 2, 3AD-4LOUVERED FACEWALL MOUNTEDSealWILLIAM E. BROWN, P.E.PE 57975Date:Phase:Drawn By:Checked By:Job No:TO THE BEST OF THE ARCHITECT'S AND/OR ENGINEER'S KNOWLEDGE THESE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE-SAFETY STANDARDS4525wSouthManhattanAvenue,Tampa,FL33611-2305T:813.839.0506 F:813.839.4616 AR0015104 1828 CGC1511025wwlonganda ao oscites sc.m.THIS DOCUMENT IS COPYRIGHT MATERIAL, ANY DISCLOSURE, UNAUTH0RIZED USE, DISSEMINATION OR DUPLICATIONWITHOUT THE EXPRESS WRITTEN CONSENT OF LONG & ASSOCIATES IS PROHIBITED ALL RIGHTS RESERVEDLONG & ASSOCIATESARCHITECTS | ENGINEERS, INCDIGITAL SEALS9/24/2024 11:35:53 AMM4.1CLEARWATER TRAFFIC OPERATIONSBUILDING REMODELFORCITY OF CLEARWATER1650 N. ARCTURAS AVE, CLEARWATER, FL 33765WZWEB100% CONSTRUCTION DOCUMENTS24034SEPTEMBER 24, 2024SCHEDULESNO. DATE ISSUES & REVISIONS1 09-24-24 100% CONSTRUCTIONDOCUMENTSWilliam E. Brown, State of Florida, Professional Engineer, License No. PE 57975This Item has been digitally signed and sealed by William E. Brown, PE,on ______________ using a Digital Signature.Printed copies of this document are not considered signed and sealed and the signature must be verified on any electronic copies. 09/24/ 2024 OSOSED202ED202ED203DENOTES FIXTURE TO BE REMOVEDED202ED205ED201ABa aaa b b bbbb b bbbbED204bERERED2053bb b ba3a 3bED206ED207ED206SIGN FABRICATION101ELECTRONIC REPAIR102OFFICE109OFFICE108OFFICE107BREAK106JANITOR105WOMEN104MEN103LIMITS OF CONSTRUCTIONSealROBERT A. RACE II, P.E.PE 51483Date:Phase:Drawn By:Checked By:Job No:TO THE BEST OF THE ARCHITECT'S AND/OR ENGINEER'S KNOWLEDGE THESE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE-SAFETY STANDARDS4525wSouthManhattanAvenue,Tampa,FL33611-2305T:813.839.0506 F:813.839.4616 AR0015104 1828 CGC1511025wwlonganda ao oscites sc.m.THIS DOCUMENT IS COPYRIGHT MATERIAL, ANY DISCLOSURE, UNAUTH0RIZED USE, DISSEMINATION OR DUPLICATIONWITHOUT THE EXPRESS WRITTEN CONSENT OF LONG & ASSOCIATES IS PROHIBITED ALL RIGHTS RESERVEDLONG & ASSOCIATESARCHITECTS | ENGINEERS, INCDIGITAL SEALS9/24/2024 3:44:02 PMED2.1CLEARWATER TRAFFIC OPERATIONSBUILDING REMODELFORCITY OF CLEARWATER1650 N. ARCTURAS AVE, CLEARWATER, FL 33765FGPRAR100% CONSTRUCTION DOCUMENTS24034SEPTEMBER 24, 2024LIGHTING DEMOLITIONPLANKEYNOTE LEGENDNO. DESCRIPTIONED201 TYP, LIGHT FIXTURE BRANCH CIRCUITS ARE CIRCUITED TO PANEL "A". FIELD VERIFYCIRCUITING, AND UPDATE PANELBOARD DIRECTORY CARD ACCORDINGLY.ED202 TYP, REMOVE FIXTURE AND CONTROL CIRCUIT BACK TO SOURCE. PROTECT AND MAITAINEXISTING BRANCH CIRCUIT FOR SUBSQUENT EXTENSION TO NEW FIXTURES IN ROOM.ED203 REMOVE LIGHT SWITCH, OUTLET BOX AND CONDUIT.ED204 REMOVE EXISTING EMERGENCY LIGHT FIXTURE AND INSTALL NEW FIXTURE IN SAMELOCATION. SEE DWG E2.1 FOR NEW FIXTURE REQUIREMENTS.ED205 TYP, EXISTING TO REMAIN LIGHT FIXTURES IN ROOM. PROTECT AND MAINTAIN INOPERATION, UON.ED206 RELOCATE LIGHT FIXTURE WHERE SHOWN. EXTEND BRANCH CIRCUIT AS REQUIRED.ED207 PROTECT AND MANTAIN EXISTING LIGHTING CONTROL OCCUPANCY SENSORS. FIELDVERIFY SENSOR LOCATIONS.SCALE:1/8" = 1'-0"1LIGHTING DEMOLITION PLANLIGHTING GENERAL NOTESN0'4'8'16'A. EXTEND EXISTING LOCAL LIGHTING BRANCH CIRCUIT TO SERVE NEW LIGHTS AS REQUIRED.B. RELOCATE EXISTING OBSTRUCTIONS ABOVE CEILING AS REQUIRED TO INSTALL LIGHT FIXTURES WERE SHOWN ON LIGHTING PLAN. FIELD VERIFY WORK SCOPE.C. LEGALLY DISPOSE OF ALL NON-USED LIGHT FIXTURES.D. RE-WORK EXISTING LIGHT BRANCH CIRCUITS AS REQUIRED TO MAINTAIN CIRCUITS FOR EXISTING LIGHTS TO REMAIN IN OPERATION.CIRCUITING.)E. ELECTRICAL CONTRACTOR SHALL BE RESPONSIBLE FOR COORDINATION OF INSTALLATION AND DEMOLITION WORK WITH OTHER TRADES TO AVOID CONFLICTS. ELECTRICAL EQUIPMENT SCHEDULED FOR DEMOLITION SHALL BE PRESENTED TO OWNER FIRST RIGHT OF REFUSAL. SHOULD OWNER REFUSE, ALL EQUIPMENT SHALL BE DISPOSED OF IN SAFE LEGAL MANNER.F. DEMOLITION DRAWINGS ARE BASED ON FIELD OBSERVATION AND EXISTING RECORD DOCUMENTS. REPORT DISCREPANCIES TO THE ENGINEER BEFORE DISTURBING EXISTING INSTALLATION. FIELD VERIFY.G. REMOVE ALL CONDUIT AND CONDUCTORS SUPPLYING DEMOLISHED EQUIPMENT TO PANEL OF ORIGIN.H. ALL EXISTING TO REMAIN CIRCUITRY SHALL BE MAINTAINED AFTER THE DEMOLITION OF EQUIPMENT. PROVIDE CONDUIT, JUNCTION BOXES, CONDUCTORS, ETC. TO MAINTAIN CIRCUITS TO EXISTING TO REMAIN DEVICES AND EQUIPMENT.I. SUPPORT ALL EXISTING CONDUITS ABOVE CEILING THAT ARE NOT SUPPORTED. WHEN CEILINGS ARE REMOVED, AND NEW CEILINGS ARE INSTALLED, FIELD VERIFY WORK SCOPE.J. RE-WORK ALL EXISTING BRANCH CIRCUITS AS REQUIRED TO MAINTAIN CIRCUITS OUTSIDE OF REMODELED AREA. PATCH/PAINT WALLS AS REQUIRED.K. UPDATE PANELBOARD DIRECTORY CARD TO REFLECT LOADS REMOVED.NO. DATE ISSUES & REVISIONS1 09-24-24 100% CONSTRUCTIONDOCUMENTSRobert A. Race II, State of Florida, Professional Engineer, License No. PE 51483This Item has been digitally signed and sealed by Robert A. Race II, PE,on ______________ using a Digital Signature.Printed copies of this document are not considered signed and sealed and the signature must be verified on any electronic copies. 09/24/ 2024 CCCCTTCPANEL "A"PANEL "B"ATSDUKE DEMAND METEREMERGENCY STANDBY GENERATOREXISTING MDF CABINETDDCTELEPHONE BOARDJJMER ERERERERERER ERER ERMED305ED302ED304ED303ED302ED303LIMITS OF CONSTRUCTIONTTTED306DUKE ENERGY POWER POLEED307PSealROBERT A. RACE II, P.E.PE 51483Date:Phase:Drawn By:Checked By:Job No:TO THE BEST OF THE ARCHITECT'S AND/OR ENGINEER'S KNOWLEDGE THESE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE-SAFETY STANDARDS4525wSouthManhattanAvenue,Tampa,FL33611-2305T:813.839.0506 F:813.839.4616 AR0015104 1828 CGC1511025wwlonganda ao oscites sc.m.THIS DOCUMENT IS COPYRIGHT MATERIAL, ANY DISCLOSURE, UNAUTH0RIZED USE, DISSEMINATION OR DUPLICATIONWITHOUT THE EXPRESS WRITTEN CONSENT OF LONG & ASSOCIATES IS PROHIBITED ALL RIGHTS RESERVEDLONG & ASSOCIATESARCHITECTS | ENGINEERS, INCDIGITAL SEALS9/24/2024 3:44:02 PMED3.1CLEARWATER TRAFFIC OPERATIONSBUILDING REMODELFORCITY OF CLEARWATER1650 N. ARCTURAS AVE, CLEARWATER, FL 33765DTRAR100% CONSTRUCTION DOCUMENTS24034SEPTEMBER 24, 2024POWER AND SIGNALDEMOLITION PLANKEYNOTE LEGENDNO. DESCRIPTIONED302 TYPICAL, REMOVE POWER/DATA OUTLETS. REMOVE DATA CABLING BACK TO SOURCE.REMOVE RECEPTACLE BRANCH CIRCUITS BACK TO LOCAL J-BOX ABOVE CEILING FORSUBSEQUENT EXTENSION TO NEW DEVICES.ED303 TYPICAL, EXISTING WALL TO BE REMOVED. REMOVE ALL ELECTRICAL DEVICES, OUTLETBOXES, WIRING AND CONDUIT BACK TO SOURCE. REMOVE ALL DATA CABLING BACK TOSOURCE. PROTECT AND MAINTAIN BRANCH CIRCUITS FOR SUBSEQUENT EXTENSION TONEW DEVICES AS SHOWN ON CONSTRUCTION POWER & SIGNAL PLAN. FOR BRANCHCIRCUITS NOT USED, REMOVE WIRING BACK TO SOURCE PANEL, TURN-OFF BREAKER ANDUPDATE PANEL DIRECTORY CARD TO READ "SPARE". FIELD VERIFY WORK SCOPE.ED304 PROTECT AND MANTAIN SECURITY SYSTEM MOTION DETECTOR.ED305 REMOVE AND STORE SECURITY MOTION DETECTOR. RE-INSTALL DETECTOR NEAR SAMELOCATION WHEN NEW CEILING IS INSTALLED. COORDINATE INSTALLATION WITH OWNER.ED306 APPROXIMATE ROUTING OF EXISTING BLDG SERVICE LATERAL CIRCUIT. FIELD VERIFY.PROTECT AND MAINTAIN.ED307 EXISTING CIRCUIT. FIELD VERIFY CIRCUIT ROUTING AND SIZE.POWER GENERAL NOTESSCALE:1/8" = 1'-0"1POWER AND SIGNALDEMOLITION PLANA. COORDINATE ALL ROUGH-IN LOCATIONS WITH ARCHITECTURAL ELEVATIONS AND DRAWINGS, SHOP DRAWINGS AND OTHER TRADES.B. VERIFY ALL COUNTER HEIGHTS PRIOR TO ROUGH-IN.C. GENERAL ELECTRICAL NOTES ON DRAWING E0.1 APPLY TO THIS DRAWING.D. ALL RECEPTACLES LOCATED WITHIN SIX FEET OF SINKS SHALL BE GFCI TYPE WHETHER NOTED OR OTHERWISE.E. 120V BRANCH CIRCUITS EXCEEDING 100 FEET SHALL BE #10 AWG THROUGHOUT LENGTH OF CIRCUIT.F. SEE MECHANICAL DRAWINGS FOR EXACT LOCATIONS OF EQUIPMENT SUCH AS, EXHAUST FANS, VAV UNITS, ETC.G. COORDINATE ALL WORK WITH OTHER TRADES AND THE PROJECT SCHEDULE.H. UL-LISTED ASSEMBLIES SHALL BE INSTALLED AT ALL PENETRATIONS OF RATED WALLS. JUNCTION BOXES LOCATED WITHIN RATED WALLS SHALL BE WRAPPED WITH FIRE STOP PUTTY PADS. ALL WORK SHALL BE CONCEALED UNLESS OTHERWISE NOTED.I. ALL RECEPTACLES SHALL BE LABELED WITH PANELBOARD NAME AND CIRCUIT NUMBER.J. COORDINATE POWER CONNECTIONS AND FIELD WIRING REQUIREMENTS TO EQUIPMENT WITH EQUIPMENT SHOP DRAWINGS, SUBMITTALS AND INSTALLERS.K. COORDINATE CONDUIT ROUTING AND OUTLET BOX INSTALLATION IN CASEWORK WITH SHOP DRAWINGS.L. TYP, INSTALL FLUSH OUTLET BOXES FOR NEW DEVICES AND FISH-IN FLEXIBLE METAL CONDUIT IN WALLS FROM CEILING SPACE TO OUTLETS WHERE POSSIBLE. IF NOT POSSIBLE PROVIDE SURFACE RACEWAY SYSTEM TO ACCOMODATE DEVICES AND WIRING. PAINT RACEWAYS TO MATCH WALL COLOR WHERE SYSTEM IS INSTALLED.M. EXISTING EQUIPMENT, DEVICE AND CIRCUITING SHOWN ARE BASED ON OWNER'S AS-BUILT DRAWINGS PROVIDED TO A/E. FIELD VERIFY EQUIPMENT AND DEVICE LOCATIONS AND CIRCUITING. NOT ALL DEVICES ARE SHOWN. FIELD VERIFY QUANTITY.N0'4'8'16'NO. DATE ISSUES & REVISIONS1 09-24-24 100% CONSTRUCTIONDOCUMENTSRobert A. Race II, State of Florida, Professional Engineer, License No. PE 51483This Item has been digitally signed and sealed by Robert A. Race II, PE,on ______________ using a Digital Signature.Printed copies of this document are not considered signed and sealed and the signature must be verified on any electronic copies. 09/24/ 2024 XA. METHODS, MATERIALS, AND PROVISIONS OF DIVISION 26 SPECIFICATIONS, GENERAL CONDITIONS AND DIVISION 1 SPECIFICATION SECTIONS ARE AN INTEGRAL PART OF THE BID AND CONSTRUCTION DOCUMENTS AND MUST BE RIGIDLY ADHERED TO.B. ALL WORK SHALL BE PERFORMED IN ACCORDANCE WITH THE FLORIDA BUILDING CODE 2023 EDITION. IN SOME CASES, PROJECT DRAWINGS AND SPECIFICATIONS EXCEED MINIMUM CODE REQUIREMENTS.C. PROVIDE CONSTRUCTION POWER AND LIGHTING FROM BUILDING SOURCE. MEET OR EXCEED NFPA AND OSHA STANDARDS FOR ELECTRICAL DISTRIBUTION AND SAFETY ON CONSTRUCTION SITES.D. ALL WIRE AND CABLE SHALL BE COPPER WITH THWN/THHN, 600 VOLTS INSULATION. MINIMUM CONDUCTOR SIZE SHALL BE #12 AWG FOR POWER AND LIGHTING CIRCUITS, AND MINIMUM #14 FOR SIGNAL CIRCUITS. BRANCH & FEEDER ABOVE GROUND - THHN (90 DEGREES C) BRANCH & FEEDER BELOW GROUND - THWN (75 DEGREES C)E. #10 AWG AND SMALLER WIRE CONNECTORS SHALL BE 600 VOLTS ELECTRICAL SPRING CONNECTORS (IDEAL 451/452) OR (3M E12/512). #8 AWG AND LARGER WIRE CONNECTORS SHALL BE THE SPLIT BOLT TYPE WITH INSULATION OF VINYL MASTIC PADS AND VINYL PLASTIC TAPE (3M 2200/2210 AND SUPER 33+).F. TYPICAL, ALL POWER AND LINE VOLTAGE WIRE AND CABLE SHALL BE INSTALLED IN CONDUIT. MINIMUM CONDUIT SIZE SHALL BE 1/2" AND CONDUIT SHALL BE CONCEALED IN FINISHED AREAS AND PROTECTED IN UNFINISHED AREAS. SEE SPECIFICATIONS FOR LOW VOLTAGE REQUIREMENTS.G. ELECTRICAL METALLIC TUBING SHALL BE USED IN FINISHED AREAS WITH STEEL COMPRESSION COUPLINGS AND FITTINGS. E.M.T. MAY ALSO BE USED IN UNFINISHED AREAS WHERE PROTECTED IN COLUMN WEBS OR UP IN JOIST SPACE.H. RIGID GALVANIZED STEEL CONDUIT SHALL BE INSTALLED WHERE CONDUITS ARE SUSCEPTIBLE TO PHYSICAL DAMAGE AND RIGID ALUMINUM CONDUIT SHALL BE INSTALLED IN ALL EXTERIOR LOCATIONS ABOVE GROUND.I. STEEL BONDING TYPE LOCKNUTS SHALL BE INSTALLED WHERE CONDUITS ENTER PANELBOARD. ENCLOSURES, WIREWAYS, STARTERS, SWITCH ENCLOSURES, JUNCTION BOXES AND ALL METALLIC ENCLOSURE ALL METALLIC ENCLOSURE BOXES. ALL E.M.T. FITTINGS SHALL BE COMPRESSION TYPE.J. INSTALL INTUMESCENT FIRE SEAL AT ALL SLEEVE/CONDUIT PENETRATIONS THROUGH FIRE RATED WALLS TO MAINTAIN RATING OF WALLS.K. GREEN COLORED INSULATED GROUNDING CONDUCTOR(S) SHALL BE INCLUDED IN ALL RACEWAY AND RACEWAY SYSTEMS. SIZES UP THROUGH #6 SHALL BE SOLID COLOR.L. CIRCUIT DIRECTORIES FOR PANELBOARD SHALL BE MACHINE PRINTED. HAND WRITTEN SHALL BE UNACCEPTABLE.M. ALL J-BOX COVERS SHALL BE MARKED WITH BRANCH CIRCUIT NUMBERS CONTAINED THEREIN. SIGNAL SYSTEM JUNCTION BOXES SHALL BE COLOR CODED.N. UL LISTED ASSEMBLIES SHALL BE INSTALLED AT ALL PENETRATIONS OF RATED WALLS. JUNCTION BOXES AND OUTLET BOXES LOCATED WITHIN RATED WALLS SHALL BE WRAPPED WITH FIRE STOP PUTTY PADS. INCLUDE PUTTY PADS IN SHOP DRAWINGS SUBMITTALS. SEE ARCHITECTURAL DRAWINGS FOR WALL RATINGS.GENERAL NOTES:JUNCTION BOX.208/120V PANELBOARD.QUADRUPLEX RECEPTACLE, NEMA TYPE 5-2OR, CENTERLINE MOUNTED 18" AFF IN FINISHED AREAS AND 42" AFF IN UNFINISHED AREAS UON.SYMBOLDESCRIPTIONLEGENDCONDUIT CONCEALED IN FINISHED AREAS OR EXPOSED IN UNFINISHED AREAS. SHORT SLASH LINES INDICATE UNGROUNDED CONDUCTORS. LONG SLASH LINES INDICATE NEUTRAL CONDUCTOR. X MARK INDICATE GROUNDING CONDUCTOR. NO SLASH LINES OR MARKS INDICATES A MINIMUM OF THREE (3) CONDUCTORS IN A RACEWAY. CONDUCTOR SIZE INDICATED IF OTHER THAN #12 AWG.CONDUIT CONCEALED IN OR BELOW FLOOR SLAB OR CONDUIT CONCEALED 36" MINIMUM BELOW FINISHED GRADE.HOMERUN TO PANELBOARD (i.e. PANELBOARD LD3 CIRCUITS 1 AND 3 OR POLE SPACES 1 AND 3).GROUNDING ELECTRODE.CONDUIT STUB-OUT WITH CAP.NOTE:NOT ALL SYMBOLS SHOWN IN THIS LEGEND MAY NECESSARILY APPEAR IN THESE DOCUMENTS. ADDITIONAL SYMBOLS MY BE DEFINED ELSEWHERE IN SPECIFIC DRAWINGS.J#10PRP-1,3WEATHERPROOF, OUTDOORWPEQUIPMENT GROUNDING CONDUCTORMOUNTEDMTDEGCCEILING, MOUNTED FLUSHABOVE FINISHED FLOORAFFCONDUITCNDCLGSURGE PROTECTION DEVICESPDUNLESS OTHERWISE NOTEDUONSURFACE OR RECESSED LED LIGHT FIXTURE. FLAT PANEL LED LIGHT FIXTURE. CAPITAL LETTER INDICATES FIXTURE TYPE.AWALL MOUNTED ILLUMINATED EXIT SIGN. SHADED QUADRANT INDICATESFACE SIDE. X1WALL MOUNTED EMERGENCY LIGHT. LETTER INDICATES FIXTURE TYPE.NCEILING MOUNTED ILLUMINATED EXIT SIGN. SHADED QUADRANT INDICATESFACE SIDE. LETTER INDICATES FIXTURE TYPE.SINGLE POLE SWITCH CENTERLINE MOUNTED 42" AFF. SMALL LETTER INDICATESCONTROLLED OUTLET. SWITCH CONNECTED TO THE EMERGENCY POWER SYSTEMSHALL HAVE RED BODY COLOR.DIMMER SWITCH MOUNTED 42" AFF. SEE SPECIFICATION.VACANCY SENSOR/WALL SWITCH, OFF - AUTO - ON. MOUNT42" AFF. SEE SPECIFICATIONS.DaCEILING MOUNTED LIGHTING VACANCY SENSOR.SSVSTHREE WAY SWITCH CENTERLINE MOUNTED 42" AFF.3SEREXISTING TO REMAIN.CEILING MOUNTED LIGHTING OCCUPANCY SENSOR.OSCEILING MOUNTED EMERGENCY LIGHT. LETTER INDICATES FIXTURE TYPE.NLIGHT FIXTURE SCHEDULE NOTES:ALL FIXTURES SHALL BE FUSED.VERIFY ALL CATALOG NUMBERS TO CONFIRM TRIM REQUIREMENTS AND DESCRIPTION.PROVIDE ALL HANGER BARS, ALL-THREAD RODS AND ACCESSORIES FOR A COMPLETE INSTALLATION.PROVIDE OWNER WITH TWO SPARE LED FIXTURE DRIVERS FOR FIXTURE TYPE A.LUMINAIRE SCHEDULEREMARKSMOUNTINGCATALOG NO.TYPEDESCRIPTIONMANUFACTURERLAMPA,A12'X2' LED TROFFERLED3422 LUMENS3500K80 CRI, 27.9 WATTSRECESSED2X2 FLAT PANEL, 3422 LUMENS. 120,000 HOUR L70 RATED LIFE, 5 YEAR WARRANTY. FIXTURE TYPE "A1" SAME AS "A" EXCEPT IT HAS 2001 LUMENS (22CGTX‐20‐L840) OPTION.EMERGENCY LUMINAIREWALL OR CEILING MOUNTN2 LED HEADS580 LUMENS2.4 WATTSEMERGENCY UNIT EQUIPEMENT, 2 HEAD FULLY ADJUSTABLE 580 LUMENS/HEAD, WHITE THERMOPLASTIC HOUSINGEXIT SINGLE FACEUNIVERSALX1LED80 CRI, 2.01 WATTSTHERMOPLASTIC UL924 CODE COMPLIANT, RED/GREEN FIELD SELCECTABLE LETTERS. NICAD EMERGENCY BATTERY.COOPER LIGHTING22-CGTX-35-L840SELHP-100-R3APC-7-RGCOOPER LIGHTINGCOOPER LIGHTINGSealROBERT A. RACE II, P.E.PE 51483Date:Phase:Drawn By:Checked By:Job No:TO THE BEST OF THE ARCHITECT'S AND/OR ENGINEER'S KNOWLEDGE THESE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE-SAFETY STANDARDS4525wSouthManhattanAvenue,Tampa,FL33611-2305T:813.839.0506 F:813.839.4616 AR0015104 1828 CGC1511025wwlonganda ao oscites sc.m.THIS DOCUMENT IS COPYRIGHT MATERIAL, ANY DISCLOSURE, UNAUTH0RIZED USE, DISSEMINATION OR DUPLICATIONWITHOUT THE EXPRESS WRITTEN CONSENT OF LONG & ASSOCIATES IS PROHIBITED ALL RIGHTS RESERVEDLONG & ASSOCIATESARCHITECTS | ENGINEERS, INCDIGITAL SEALS9/24/2024 3:44:02 PME0.1CLEARWATER TRAFFIC OPERATIONSBUILDING REMODELFORCITY OF CLEARWATER1650 N. ARCTURAS AVE, CLEARWATER, FL 33765FGPRAR100% CONSTRUCTION DOCUMENTS24034SEPTEMBER 24, 2024LEGEND, DETAILS &GENERAL NOTESNO. DATE ISSUES & REVISIONS1 09-24-24 100% CONSTRUCTIONDOCUMENTSRobert A. Race II, State of Florida, Professional Engineer, License No. PE 51483This Item has been digitally signed and sealed by Robert A. Race II, PE,on ______________ using a Digital Signature.Printed copies of this document are not considered signed and sealed and the signature must be verified on any electronic copies. 09/24/ 2024 VSOSOSb b bb b ba a aA AAAAA A AADbDa3a 3b3bERERaaab b bbbb b bbbbb b bNNNNE203E201E202E201E201X1A1 A1A1A1LIMITS OF CONSTRUCTIONEREROFFICE102TRAFFIC MANAGEMENT CENTER107SIGN FABRICATION101ELECTRONIC REPAIR108OFFICE109BREAK106WOMEN104MEN103JANITOR105PANEL "A"PANEL "B"NEW PANEL "TRP"TELEPHONE BOARDSealROBERT A. RACE II, P.E.PE 51483Date:Phase:Drawn By:Checked By:Job No:TO THE BEST OF THE ARCHITECT'S AND/OR ENGINEER'S KNOWLEDGE THESE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE-SAFETY STANDARDS4525wSouthManhattanAvenue,Tampa,FL33611-2305T:813.839.0506 F:813.839.4616 AR0015104 1828 CGC1511025wwlonganda ao oscites sc.m.THIS DOCUMENT IS COPYRIGHT MATERIAL, ANY DISCLOSURE, UNAUTH0RIZED USE, DISSEMINATION OR DUPLICATIONWITHOUT THE EXPRESS WRITTEN CONSENT OF LONG & ASSOCIATES IS PROHIBITED ALL RIGHTS RESERVEDLONG & ASSOCIATESARCHITECTS | ENGINEERS, INCDIGITAL SEALS9/24/2024 3:44:03 PME2.1CLEARWATER TRAFFIC OPERATIONSBUILDING REMODELFORCITY OF CLEARWATER1650 N. ARCTURAS AVE, CLEARWATER, FL 33765FGPRAR100% CONSTRUCTION DOCUMENTS24034SEPTEMBER 24, 2024LIGHTING PLANKEYNOTE LEGENDNO. DESCRIPTIONE201 TYP, PROVIDE NEW WALL MOUNTED EMERGENCY FIXTURE.E202 PROVIDE CEILING MOUNTED EMERGENCY LIGHT FIXTURE.E203 PROVIDE NEW EXIT LIGHT.LIGHTING GENERAL NOTESN0'4'8'16'SCALE:1/8" = 1'-0"1LIGHTING PLANA. EXTEND EXISTING LOCAL LIGHTING BRANCH CIRCUITS TO SERVE NEW LIGHTS AS REQUIRED.B. RELOCATE EXISTING OBSTRUCTIONS ABOVE CEILING AS REQUIRED TO INSTALL LIGHT FIXTURES WERE SHOWN ON LIGHTING PLAN. FIELD VERIFY WORK SCOPE.C. RE-WORK EXISTING LIGHT BRANCH CIRCUITS AS REQUIRED TO MAINTAIN CIRCUITS OUTSIDE OF REMODELED AREA.D. SWITCH DEVICE COLOR AND COVERPLATES SHALL MATCH EXISTING.E. PAINT/PATCH WALLS AS REQUIRED TO CONCEAL NEW FLUSH MOUNTED OUTLET BOXES AND CONCEALED CONDUITS IN EXISTING WALLS.F. NEW LIGHTING SHALL BE LED WITH VACANCY SENSOR CONTROLS IN ACCORDANCE WITH FLORIDA 2023 BUILDING CODE 8TH EDITION.G. EXISTING EQUIPMENT, DEVICE AND CIRCUITING SHOWN ARE BASED ON OWNER'S AS-BUILT DRAWINGS PROVIDED TO A/E. FIELD VERIFY EQUIPMENT AND DEVICE LOCATIONS AND CIRCUITING.H. REFER TO THE SPECIFICATIONS, LEGEND AND GENERAL NOTES ON LIGHT FIXTURE SCHEDULE DRAWINGS E0.1 AND E0.2.I. COORDINATE ALL WORK WITH THE PROJECT AND PHASING SCHEDULES, OTHER TRADES AND THE OWNER.J. U.L.. LISTED ASSEMBLIES SHALL BE INSTALLED AT ALL PENETRATIONS OF RATED WALLS. JUNCTION BOXES LOCATED WITHIN RATED WALLS SHALL BE WRAPPED WITH FIRE STOP PUTTY PADS.K. ALL WORK SHALL BE CONCEALED UNLESS OTHERWISE NOTED.L. TYPICAL, LIGHT FIXTURES SHALL BE INDEPENDENTLY SUPPORTED FROM THE OVERHEAD STUCTURE BY CEILING GRID TYPE WIRES CONNECTED TO TWO OPPOSITE CORNERS.M. FIXTURE WHIPS SHALL NOT LAY ON THE CEILING TILES.N. PROVIDE JUNCTION BOXES AS REQUIRED. PROVIDE ADDITIONAL FLEX WHIPS ABOVE JUNCTION BOXES TO EACH INDIVIDUAL FIXTURE. FLEX SHALL NOT EXCEED 6'-0" AND SHALL HAVE #12 AWG CONDUCTORS. FIXTURES SHALL NOT BE DAISY CHAINED. PROVIDE #10 AWG HOMERUN CONDUCTORS FOR ALL 120 VOLT BRANCH CIRCUITS EXCEEDING 100 FEET IN LENGTH TO MINIMIZE VOLTAGE DROP.O. EXTEND AN UNSWITCHED CONDUCTOR TO FIXTURES WITH EMERGENCY BATTERIES AND TO EXIT LIGHTS.P. ALL CONTROL AND DEVICES AND POWER SUPPLIES SHALL BE LOCATED ABOVE THE CEILING DIRECTLY OVER THE CONTROL SWITCHES WHICH SHALL BE LABELED WITH ASSOCIATED FUNCTIONS. NO. DATE ISSUES & REVISIONS1 09-24-24 100% CONSTRUCTIONDOCUMENTSRobert A. Race II, State of Florida, Professional Engineer, License No. PE 51483This Item has been digitally signed and sealed by Robert A. Race II, PE,on ______________ using a Digital Signature.Printed copies of this document are not considered signed and sealed and the signature must be verified on any electronic copies. 09/24/ 2024 CC CCCCCCCCCPANEL "A"PANEL "B"DUKE DEMAND METERNEW PANEL "TRP"NEW IDF CABINETJEXISTING AHU'S17#10TRP-1,3,5TRP-81310131314 14 14EMERGENCY STANDBY GENERATORATSDDCEXISTING MDF RACKNOTE:ALL NEW DEVICES ARE CIRCUITED TO PANELBOARD "TRP", UON.#10TELEPHONE BOARD10BACKBOARD17DESKER ERER ERMMERERERERTRP-6#10ERJJ#10TRP-7,9,11JPLANER 16'x9' VIDEO WALLERTV84"84"13131012121515151716E307E303E301E304E304E306E305E30218E308E308E304NEW CU-130 NEMA-3RNFB-39E310E311NEW AC-1mB-39#10#10E309E312E308J#10TRP-19,21LIMITS OF CONSTRUCTIONEXISTING CU EXISTING CUE314E313PE315CCCCCCCCTYP, 1 1/4" CONDUIT CONCEALED IN WALL AND STUBBED OUT ABOVE CEILING WITH END BUSHING.CEILINGTRP-1 TRP-3 TRP-5 TRP-7 TRP-9 TRP-11 TRP-19 TRP-21TYP, PROVIDE DEEP DOUBLE GANG OUTLET BOX WITH 1 1/4" KNOCKOUTS AND BLANK COVER PLATESAWCUT/PATCH/PAINT WALL AS REQUIRED TO INSTALL FLUSH OUTLET BOXES AND CONCEALED CONDUITSCOORDINATE OUTLET ROUGH-IN LOCATIONS WITH PLANAR VIDEO WALL INSTALLER AND EQUIPMENT SHOP DRAWINGSNOTE:RECEPTACLEDATA OUTLETSealROBERT A. RACE II, P.E.PE 51483Date:Phase:Drawn By:Checked By:Job No:TO THE BEST OF THE ARCHITECT'S AND/OR ENGINEER'S KNOWLEDGE THESE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE-SAFETY STANDARDS4525wSouthManhattanAvenue,Tampa,FL33611-2305T:813.839.0506 F:813.839.4616 AR0015104 1828 CGC1511025wwlonganda ao oscites sc.m.THIS DOCUMENT IS COPYRIGHT MATERIAL, ANY DISCLOSURE, UNAUTH0RIZED USE, DISSEMINATION OR DUPLICATIONWITHOUT THE EXPRESS WRITTEN CONSENT OF LONG & ASSOCIATES IS PROHIBITED ALL RIGHTS RESERVEDLONG & ASSOCIATESARCHITECTS | ENGINEERS, INCDIGITAL SEALS9/24/2024 3:44:03 PME3.1CLEARWATER TRAFFIC OPERATIONSBUILDING REMODELFORCITY OF CLEARWATER1650 N. ARCTURAS AVE, CLEARWATER, FL 33765DTRAR100% CONSTRUCTION DOCUMENTS24034SEPTEMBER 24, 2024POWER AND SIGNALPLANKEYNOTE LEGENDNO. DESCRIPTIONE301 PROVIDE 2" CONDUIT ROUTED ABOVE CEILING FROM BACKBOARD BEHIND EXISTING MDFRACK TO NEW IDF CABINET AS SHOWN. COORDINATE ROUTING OF CONDUIT ABOVE CEILINGWITH EXISTING OBSTRUCTIONS. PROVIDE PULLSTRING IN CONDUIT.E302 NEW PANELBOARD. SEE RISER, DWG E6.1 AND SEE NEW PANELBOARD SCHEDULE FORREQUIREMENTS.E303 TYP, PROVIDE NEW DEVICES AND CIRCUITS AS SHOWN.E304 PROVIDE ALL POWER AND SIGNAL DEVICE OUTLET BOXES, DEVICES, CONDUIT PATHWAYSAND ACCESSORIES AS REQUIRED FOR A COMPLETE AND FUNCTIONAL VIDEO WALLSYSTEM. COORDINATE FIELD WIRING REQUIREMENTS WITH VIDEO WALL SHOP DRAWINGSAND INSTALLER.E305 PROTECT AND MAINTAIN SECURITY MOTION DETECTOR.E306 RE-INSTALL EXISTING SECURITY MOTION DETECTOR.E307 TYP, SAWCUT/PATCH/PAINT WALL AS REQUIRED TO INSTALL DEVICE FLUSH OUTLET BOXESAND CONCEAL CONDUITS IN EXISTING WALL.E308 TYP, REMOVE, RELOCATE AND RECONNECT EXISTING ELECTRICAL POWER AND SIGNALCIRCUITS ABOVE CEILINGS AS REQUIRED TO ALLOW FOR NEW WALL INSTALLATION. FIELDVERIFY WORK SCOPE.E309 PROVIDE MOTOR RATED SWITCH AND IN-LINE FUSE FOR CIRCUIT SERVING NEW AC FANCONDENSATE PUMP, COORDINATE FUSE SIZE FIELD WIRING REQUIREMENTS FOR PUMPWITH PUMP SHOP DRAWINGS AND INSTALLER. LABEL SWITCH ACCORDINGLY.E310 PROVIDE NEMA-3R, HEAVY DUTY, 30 AMP NON-FUSED DISCONNECT SWITCH TO SERVE NEWAC UNIT. PROVIDE ENGRAVED PLASTIC LABEL ON SWITCH. PROVIDE ENGRAVED PLASTICLABEL ON SWITCH. PROVIDE FINAL CONNECTION TO UNIT WITH LIQUID TIGHT FLEXIBLEMETAL CONDUIT PAINT EXPOSED CONDUIT TO MATCH WALL COLOR. ALL EXTERIOREXPOSED CONDUIT ON WALL SHALL BE ALUMINUM. COORDINATE INSTALLATION WITH UNITFIELD WIRING DRAWINGS AND INSTALLER. PROVIDE ALL WIRING AND CONDUIT ASREQUIRED. PROVIDE UNISTRUT SUPPORTS AS REQUIRED.E311 TYPICAL, FIELD LOCATE DISCONNECT, POWER AND CONTROL ROUGH-IN LOCATIONS WITHEQUIPMENT SHOP DRAWINGS FOR CONDENSING UNIT PANEL. SEAL ALL CONDUITE312 SEE PLANAR VIDEO WALL ELEVATION FOR ADDITIONAL REQUIREMENTS. ALL PLANAR WALLSIGNAL CABLES ROUTED BETWEEN WALL AND IDF CABINET SHALL BE SUPPORTED FROMJ-HOOKS EVERY 4' AND CABLE BUNDLES WRAPPED WITH VELCRO STRAPS EVERY 2'.E313 EXISTING ELECTRICAL CIRCUIT. RELOCATE CONDUIT AND CIRCUIT ABOVE RAISED CEILINGAS REQUIRED. EXTEND CIRCUIT AS REQUIRED. FIELD VERIFY CIRCUIT SIZE AND WORKSCOPE. COORDINATE POWER OUTAGES REQUIRED FOR CIRCUIT WORK WITH OWNERE314 THE CEILING IN THIS ROOM IS BEING RAISED FROM 9' TO 14' ABOVE FINISHED FLOOR.RELOCATE AND SUPPORT ALL ELECTRICAL CIRCUITS AND CABLES ABOVE NEW CEILING ASREQUIRED. EXTEND POWER, LIGHTING AND SIGNAL CIRCUITS AS REQUIRED. PROVIDE NEWCABLING AS REQUIRED TO MAINTAIN EXISTING DEVICES AND SYSTEMS IN OPERATION.FIELD VERIFY WORK SCOPE.E315 PROVIDE NEW 25/2 CB IN EXISTING PANEL TO SERVE NEW CU-1. UPDATE PANELBOARDDIRECTORY CARD ACCORDINGLY. VERIFY CB AND BRANCH CIRCUIT SIZE WITH EQUIPMENTSHOP DRAWINGS.POWER GENERAL NOTESSCALE:1/8" = 1'-0"1POWER AND SIGNALPLANA. COORDINATE ALL ROUGH-IN LOCATIONS WITH ARCHITECTURAL ELEVATIONS AND DRAWINGS, SHOP DRAWINGS AND OTHER TRADES.B. VERIFY ALL COUNTER HEIGHTS PRIOR TO ROUGH-IN.C. GENERAL ELECTRICAL NOTES ON DRAWING E0.1 APPLY TO THIS DRAWING.D. ALL RECEPTACLES LOCATED WITHIN SIX FEET OF SINKS SHALL BE GFCI TYPE WHETHER NOTED OR OTHERWISE.E. 120V BRANCH CIRCUITS EXCEEDING 100 FEET SHALL BE #10 AWG THROUGHOUT LENGTH OF CIRCUIT.F. SEE MECHANICAL DRAWINGS FOR EXACT LOCATIONS OF EQUIPMENT.G. COORDINATE ALL WORK WITH OTHER TRADES AND THE PROJECT SCHEDULE.H. UL-LISTED ASSEMBLIES SHALL BE INSTALLED AT ALL PENETRATIONS OF RATED WALLS. JUNCTION BOXES LOCATED WITHIN RATED WALLS SHALL BE WRAPPED WITH FIRE STOP PUTTY PADS. ALL WORK SHALL BE CONCEALED UNLESS OTHERWISE NOTED.I. ALL RECEPTACLES SHALL HAVE STAINLESS STEEL COVERPLATE AND ENGRAVED WITH PANELBOARD NAME AND CIRCUIT NUMBER. SEE SPECIFICATIONS FOR REQUIREMENTS.J. COORDINATE POWER CONNECTION TO EQUIPMENT WITH EQUIPMENT SUBMITTALS. COORDINATE CONDUIT ROUTING AND OUTLET BOX INSTALLATION IN CASEWORK WITH SHOP DRAWINGS.K. COORDINATE POWER CONNECTION TO ELECTRICAL EQUIPMENT WITH EQUIPMENT SUBMITTALS.L. SEE ARCHITECTURAL DRAWINGS FOR SIGNAGE REQUIREMENTS.M. VERIFY EQUIPMENT BRANCH CIRCUIT REQUIREMENTS WITH OWNER. UPGRADE BRANCH CIRCUITS AND BREAKERS AS REQUIRED TO SUPPORT EQUIPMENT LOAD.N0'4'8'16'SCALE:1/2" = 1'-0"2PLANAR VIDEO WALLELEVATIONNO. DATE ISSUES & REVISIONS1 09-24-24 100% CONSTRUCTIONDOCUMENTSRobert A. Race II, State of Florida, Professional Engineer, License No. PE 51483This Item has been digitally signed and sealed by Robert A. Race II, PE,on ______________ using a Digital Signature.Printed copies of this document are not considered signed and sealed and the signature must be verified on any electronic copies. 09/24/ 2024 NGEXISTING TECO AERIAL TRANSFORMERSEXISTING TECO POLE13,900 SCCEXISTING DUKEENERGY METER#0224714EXTERIORBLDG INTERIORATS400 AEXISTING PANELA= CALCULATED AVAILABLE SYMMETRICAL FAULT CURRENT(IF LESS THAN 10,000 SCC NOT SHOWN)STANDBY EMERGENCY GENERATOR400 A400A FEEDER TAPBOXXX SCCEXISTING PANELBEXISTING DISCEXISTING PANELC150 A150 AMCBONE YEAR RECORDED PEAK 99.2 KW ON 3/27/24SPDNGEXISTING TECO AERIAL TRANSFORMERS(75KVA)EXISTING TECO POLE13,900 SCCEXISTING DUKEENERGY METER#0224714EXTERIORBLDG INTERIORATS400AEXISTING PANELASTANDBY EMERGENCY GENERATOR400AONE YEAR RECORDED PEAK 99.2 KW ON 3/27/24400A FEEDER TAPBOXEXISTING PANELBEXISTING DISCEXISTING PANELCNEW PANEL TRP150 A150 AMCBRISER NOTESSEE SPECIFICATIONS FOR SPD REQUIREMENTS SEE PANEL SCHEDULE FOR FEEDER REQUIREMENTS.PROVIDE TAP BLOCK AND TAP NEW CONDUCTORS TO EXISTING 400A FEEDER CONDUCTORS IN TAP WIREWAY. FIELD VERIFY WORK SCOPE.123321DUKE ENERGY 1 YEAR RECORDED PEAK99.2 KW0.9 PF110.2 KVA=DUKE ENERGY BLDG SERVICE LOAD SUMMARYTOTAL : LOAD ADDED 123.6 KVA*110.2 KVA*13.4 KVA4COORDINATE WITH DUKE ENERGY IF EXISTING TRANSFORMERS WILL NEED TO BE UPGRADED TO SUPPORT ADDITIONAL BLDG LOAD.4LOAD DEMAND KVA123.6 KVA= 343.1 AMPS 208 V X 1.73EXISTING 400A FEEDER TAPBOX LOAD SUMMARYTOTAL LOAD ADDED TO PANEL LOAD ADDED TO PANEL 13.4123.6EXISTING LOAD110.2NEW PANEL "TRP"1613467SURFACE MTD120/208 VOLTS 3PH, 4WBRANCH LOADAMPSCB/P2BCA1CB/PBRANCH LOADAMPSAMPSAMPS---100MCB:MLO:192526323120/123171530221020/120/120/120/120/120/120/11220/120/120/120/1363414 KAIC20/120/120/120/120/120/120/120/120/120/120/120/120/120/120/1141824282127293335EQUIPMENT GROUND BAR* NEC 220.12 ** NEC 220.44 *** NONCOINCIDENT NEC 220.60A PH =CONN KVAWATER HEATTOTALSFUTURE (25%)LOADSTOTAL AMPS:RECEPTCOOLINGHEATINGMISC EQUIPEXH FANSLIGHTINGKVA KVAB PH =FACTORC PH =DMD KVADIVERSITYKVAREMARKS:DES KVAxx==1.001.00xx==1.001.00=xxxxxx=====**1.251.001.001.00*=1.00xxxxxx=====1.001.001.001.001.00SQUARE D TYPE NQOBVIDEO WALL RECEPT8.0SPARESPAREDATA CABINET DATA CABINET RECEPTRECEPTACLESRECEPTACLES30/1820/120/120/13.07.53.08.08.0-/130/337394138---/1-/13520/1820/120/120/120/1911SURGE SUPPRESSOR--3940.53613.9 16.2-----------3.0-13.9 11.9- - -- -FEEDER: 4-#1, #6 EGC, IN 1 1/2" CND. VIDEO WALL RECEPTVIDEO WALL RECEPTVIDEO WALL RECEPTVIDEO WALL RECEPTVIDEO WALL RECEPTRECEPTACLES7.54.54.56.04.5RECEPTACLESRECEPTACLESRECEPTACLESRECEPTACLES14.911.920SPARESPARESPARESPARESPARESPARESPARESPARESPARESPARESPARESPARESPARESPARESPARESPACESPACESPACEVIDEO WALL RECEPTVIDEO WALL RECEPT8.08.0RECEPTACLES3.0SPARE8.08.08.0SealROBERT A. RACE II, P.E.PE 51483Date:Phase:Drawn By:Checked By:Job No:TO THE BEST OF THE ARCHITECT'S AND/OR ENGINEER'S KNOWLEDGE THESE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE-SAFETY STANDARDS4525wSouthManhattanAvenue,Tampa,FL33611-2305T:813.839.0506 F:813.839.4616 AR0015104 1828 CGC1511025wwlonganda ao oscites sc.m.THIS DOCUMENT IS COPYRIGHT MATERIAL, ANY DISCLOSURE, UNAUTH0RIZED USE, DISSEMINATION OR DUPLICATIONWITHOUT THE EXPRESS WRITTEN CONSENT OF LONG & ASSOCIATES IS PROHIBITED ALL RIGHTS RESERVEDLONG & ASSOCIATESARCHITECTS | ENGINEERS, INCDIGITAL SEALS9/24/2024 3:44:03 PME6.1CLEARWATER TRAFFIC OPERATIONSBUILDING REMODELFORCITY OF CLEARWATER1650 N. ARCTURAS AVE, CLEARWATER, FL 33765DTRAR100% CONSTRUCTION DOCUMENTS24034SEPTEMBER 24, 2024ELECTRICAL RISERSAND PANELSCHEDULESSCALE:NTS1EXISTING BLDGELECTRICAL RISERSCALE:NTS2MODIFIED BLDGELECTRICAL RISERNO. DATE ISSUES & REVISIONS1 09-24-24 100% CONSTRUCTIONDOCUMENTSRobert A. Race II, State of Florida, Professional Engineer, License No. PE 51483This Item has been digitally signed and sealed by Robert A. Race II, PE,on ______________ using a Digital Signature.Printed copies of this document are not considered signed and sealed and the signature must be verified on any electronic copies. 09/24/ 2024 FIXTURES AND SIGNAL DEVICESSURFACE MOUNTED LIGHTDEVICES, AND OTHEREXIT SIGNS, FIRE ALARMTYPICAL MOUNTING FORWITH ACOUSTICAL CEILINGSOLID OR SPLIT SLEEVE WALL PENETRATION KIT AS MANUFACTURERED BY SPECIFIED TECHNOLOGIES, INC OR EQUIVALENT SHALL BE INSTALLED FOR ALL WALL OR PARTITION PENETRATIONSMETAL CONDUIT SIZE PER EIA/TIA REQUIREMENTS FIRESTOP IF RATED WALLFREE RUN DATA UTP CABLES(BY OTHERS)ESCUTCHEON PLATE (BOTH SIDES)LIGHT GUAGE FRAMING WITH GYP BOARD, CMU, OR OTHER PARTITION TYPE RATED OR NON-RATEDNOTE:WHERE PENETRATION IS THROUGH FIRE RATED WALL PROVIDE U.L. LISTED SYSTEM.CABLE CAT HANGER(BY OTHERS)CONNECTOR WITH PLASTIC BUSHINGSPROVIDE AS REQUIRED, COORDINATE WITH OWNER'S DATA, SOUND SYSTEM, AND ACS VENDORS.22422323222242422222220 21192212211817162232202191514218 218121121913217216 217108 921621576220TYPICAL PATCH PANELLABELING IDENTIFICATION(SEE SPECIFICATIONS)214214543213PP12131 2PATCH PANELNUMBERPATCH PANELPORT NUMBER2154746211 21248212454443210 2104240 41209 209 2113938207 2083635206 206372073432 33204 205 2053130203 20420828 2927202 2022625201 201(FACTORY LABEL)203NOTE: PATCH PANEL LABELING SHOWN FOR REFERENCEONLY. PATCH PANEL BY OTHERS.NOTE: OUTLET LABELING SHOWN FOR REFERENCE ONLY.CO FACE PLATE, JACK AND CABLING.(BY OTHERS)22CONDUIT TO CEILING SPACE.21127-C-21,22,23,24(BY OTHERS)RJ-45, CAT 6, 568B24234 PAIR CAT 6DATA CABLEPATCH PANELPORT NUMBERTR ROOMNUMBERCONDUIT TO CEILING SPACE.19DATADATADATAVOICEDATADATA147-C-21,22,23,24PATCH PANELPORT NUMBER127-C-19,20TR ROOMNUMBER147-C-19,20PATCH PANELPORT NUMBER(BY OTHERS)RJ-45, CAT 6, 568BPATCH PANELPORT NUMBERNOTE: OUTLET LABELING SHOWN FOR REFERENCE ONLY.CO FACE PLATE, JACK AND CABLING.(BY OTHERS)20(BY OTHERS)4 PAIR CAT 6DATA CABLE(BY OTHERS)4 PAIR CAT 6DATA CABLE(BY OTHERS)4 PAIR CAT 6DATA CABLE(BY OTHERS)4 PAIR CAT 6DATA CABLE(BY OTHERS)4 PAIR CAT 6DATA CABLE(BY OTHERS)(BY OTHERS)SUSPENDED CEILINGROOFUPSNOTE: DATA CABINET ELEVATION IS SHOWN FOR REFERENCE. DATA CABINET, LIU, WIRE MANAGMENT PATCH PANELS, UPS, PLUG STRIP, SHELVES, CABLING, ETC. ARE PROVIDED BY OTHERS, UON. CONDUITS RECEPTACLES, OUTLETS, GROUNDBAR, PLYWOOD BACKBOARD AND GROUDING CIRCUIT SHALL BE PROVIDED BY ELECTRCIAL SUBCONTRACTOR.72" FLOOR MOUNTED EQUIPMENT CABINET WITH LOCKING DOOR AND DUAL FAN AND FILTER KIT. (BY OTHERS)PLUG STRIPQUADRUPLEX RECEPTACLE3/4" GRADE A/C PLYWOOD BACKBOARD 1" LARGER THAN CABINET DIMENSIONS PAINTED 6 SIDES WITH LIGHT GRAY FIRE RETARDANT PAINTJ120V POWER3/4" GRADE A/C PLYWOOD BACKBOARD PAINTED 6 SIDES WITH LIGHT GRAY FIRE RETARDANT PAINT. MOUNT TO BACK PANEL.WMTYPICAL, HORIZONTAL WIREMANAGEMENT 1 RACK UNIT. (BY OTHERS)48 PORT, CAT 6 PATCH PANEL 568B, RJ-45. (BY OTHERS)48 PORT, CAT 6 PATCH PANELS 568B,RJ-45.(BY OTHERS)FIBER LIU - LC TYPE CONNECTORS. (BY OTHERS)WMFLOORFRONT CABINET WHEELED BASE. (BY OTHERS)RACK MOUNTED SHELFCHANGE TO A TGB WITH TWO-HOLE COMPRESSION LUGS FOR GROUNDING#2 AWG GROUNDING CONDUCTOR TOGROUND BAR IN MAIN PANEL "TRP"C2PROVIDE 2-3" CONDUITS AND 1-2" CONDUIT STUBBED THRU LAY-IN CEILING AND MOUNTED TO WALL. PROVIDE PIPE STRAPS AND END BUSHINGS.ELECTRONICSELECTRONICSFIBER LIU30A RECEPTACLEVIDEO EQUIPMENTVIDEO EQUIPMENTVIDEO EQUIPMENTVIDEO EQUIPMENTWMEQUIPMENT BY OTHERSSealROBERT A. RACE II, P.E.PE 51483Date:Phase:Drawn By:Checked By:Job No:TO THE BEST OF THE ARCHITECT'S AND/OR ENGINEER'S KNOWLEDGE THESE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE-SAFETY STANDARDS4525wSouthManhattanAvenue,Tampa,FL33611-2305T:813.839.0506 F:813.839.4616 AR0015104 1828 CGC1511025wwlonganda ao oscites sc.m.THIS DOCUMENT IS COPYRIGHT MATERIAL, ANY DISCLOSURE, UNAUTH0RIZED USE, DISSEMINATION OR DUPLICATIONWITHOUT THE EXPRESS WRITTEN CONSENT OF LONG & ASSOCIATES IS PROHIBITED ALL RIGHTS RESERVEDLONG & ASSOCIATESARCHITECTS | ENGINEERS, INCDIGITAL SEALS9/24/2024 3:44:03 PME7.1CLEARWATER TRAFFIC OPERATIONSBUILDING REMODELFORCITY OF CLEARWATER1650 N. ARCTURAS AVE, CLEARWATER, FL 33765FGPRAR100% CONSTRUCTION DOCUMENTS24034SEPTEMBER 24, 2024DETAILSSCALE:NTS1GRID CEILING MOUNTING DETAILSCALE:NTS2ELECTRICAL WALL PENETRATIONTYPICAL SECTIONSCALE:NTS5LABELING PATCH PANELS DETAILSCALE:NTS3TYPICAL DUPLEX & QUADCOMMUNICATIONS OUTLET DETAILSCALE:NTS4TRAFFIC VIDEO ROOM IDF CABINETELEVATIONNO. DATE ISSUES & REVISIONS1 09-24-24 100% CONSTRUCTIONDOCUMENTSRobert A. Race II, State of Florida, Professional Engineer, License No. PE 51483This Item has been digitally signed and sealed by Robert A. Race II, PE,on ______________ using a Digital Signature.Printed copies of this document are not considered signed and sealed and the signature must be verified on any electronic copies. 09/24/ 2024 TYP, 4 PAIR CAT6 UTP PLENUM RATED CABLE PER JACK BY OTHERSLIU - FIBER OPTIC TERMINAL CABINETPATCH PANELLIUSWITCHNOTES:1. DATA RISER IS FOR REFERENCE ONLY.CONFIRM OUTLET QUANTITIES AND LOCATIONSWITH BUILDING PLANS AND SPECIFICATIONS.2. THIS RISER IS FOR REFERENCE ONLY. SIGNAL SYSTEM DEVICES, CABLING AND EQUIPMENT IS BY OWNER. CONTRACTOR SHALL PROVIDE ALL DEVICE OUTLET BOXES AND CONDUIT PATHWAYS TO SUPPORT SYSTEM. COORDINATE REQUIREMENTS WITH SIGNAL SYSTEM SHOP DWGS AND INSTALLER.CWAPC C CAVLIUEXISTINGMDF RACK2" CNDNEW IDFCABINET21(OCS-XX)(WST-C)ORANGE (N.O.)GRAY (COMMON)PURLPLE (N.C.)(RSP-C-010-Z1)BLACK (HOT)WHITE (NEUTRAL)BLUE (LOAD OUT)VIOLET (0 - 10V +)PINK (0 - 10V -)WHITE (NEUTRAL)SWITCHLEGVIOLET (0 - 10V +)PINK (0 - 10V -)ZONE120/277 VAC RJ45(TYPICAL)LOW VOLTAGE CEILING DUAL TECH SENSOR VACANCY/OCCUPANCYDIMMING DIGITAL WALL SWITCH CAT DIMMING SWITCHPACKSealROBERT A. RACE II, P.E.PE 51483Date:Phase:Drawn By:Checked By:Job No:TO THE BEST OF THE ARCHITECT'S AND/OR ENGINEER'S KNOWLEDGE THESE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE-SAFETY STANDARDS4525wSouthManhattanAvenue,Tampa,FL33611-2305T:813.839.0506 F:813.839.4616 AR0015104 1828 CGC1511025wwlonganda ao oscites sc.m.THIS DOCUMENT IS COPYRIGHT MATERIAL, ANY DISCLOSURE, UNAUTH0RIZED USE, DISSEMINATION OR DUPLICATIONWITHOUT THE EXPRESS WRITTEN CONSENT OF LONG & ASSOCIATES IS PROHIBITED ALL RIGHTS RESERVEDLONG & ASSOCIATESARCHITECTS | ENGINEERS, INCDIGITAL SEALS9/24/2024 3:44:04 PME7.2CLEARWATER TRAFFIC OPERATIONSBUILDING REMODELFORCITY OF CLEARWATER1650 N. ARCTURAS AVE, CLEARWATER, FL 33765DTRAR100% CONSTRUCTION DOCUMENTS24034SEPTEMBER 24, 2024DETAILSSCALE:NTS2PARTIAL DATA RISERSCALE:NTS1ONE SWITCH LEG LIGHTING CONTROL DIAGRAMNO. DATE ISSUES & REVISIONS1 09-24-24 100% CONSTRUCTIONDOCUMENTSRobert A. Race II, State of Florida, Professional Engineer, License No. PE 51483This Item has been digitally signed and sealed by Robert A. Race II, PE,on ______________ using a Digital Signature.Printed copies of this document are not considered signed and sealed and the signature must be verified on any electronic copies. 09/24/ 2024 Cover Memo City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 File Number: ID#24-1627 Agenda Date: 1/16/2025 Status: Consent AgendaVersion: 1 File Type: Action ItemIn Control: Public Works Agenda Number: 6.5 SUBJECT/RECOMMENDATION: Declare furniture and related items in the Municipal Services Building (MSB) surplus as part of the MSB Renovations project (23-0035-EN), authorize disposal pursuant to Clearwater Code of Ordinances Sections 2.623(3) and (4), and authorize the appropriate officials to execute same. (consent) SUMMARY: MSB staff are relocating to existing city-owned space (the old Countryside Library, the Main Library, Clearwater Gas complex, and Main PD building), and lease space (1255 Cleveland St.) in phases during the months of December 2024 and January 2025. The relocation is due to the MSB Renovations project which starts in February 2025. Any newer furniture and related items in the MSB will be redistributed for use at other city facilities. The City contacted an auction service for the public auctioning of the remaining content. The City was informed that the content does not hold sufficient value to conduct a successful auction due to minimal demand and surplus of similar inventory in our area. The contracted mover provided referrals to two liquidation services for quotes on the remaining items. However, similar to the auctioneer’s assessment, market demand for the property is very low. Additionally, the age and condition of the materials and equipment make them less valuable than the cost to move and store them. The cubical furniture has been out of production for over a decade, with no available parts for repair or replacement. Recycling options were explored with both the moving and furniture vendors. However, it was emphasized to the city representative that in the aftermath of the hurricane, metal scrap prices are significantly depressed. The labor cost to scrap outweighs its recycling value, making simple disposal (haul and dump fees) the most cost-effective option. The Purchasing Division contacted local non-profit organizations and the Pinellas County School Board to gauge their interest in receiving donated property. In accordance with FS 274.06, some furniture will be donated to these organizations. Any remaining property has been assessed as having a value less than the cost of disassembly, decommissioning, or relocation. This property will be removed and either salvaged or disposed of by the contractor as part of the MSB Renovations project. In the event that market conditions change and it is determined that there is commercial value in the tangible personal property, the City will seek services of an auctioneer under 2.623(8). STRATEGIC PRIORITY: The surplus of furniture in support of the MSB Renovation project supports the two strategic priorities below. The renovations will improve indoor air quality and energy efficiencies while providing safe and streamlined public interface. Page 1 City of Clearwater Printed on 1/14/2025 MSB furniture inventory for surplus, 1/6/2025 ~67,000 SF City office building Cubical Systems 176 Office/desk set ups 46 File Cabinets 113 Storage Cabinets 38 Shelves 26 Chairs 165 Tables 41 Cover Memo City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 File Number: ID#24-1492 Agenda Date: 1/16/2025 Status: Consent AgendaVersion: 1 File Type: Action ItemIn Control: Public Works Agenda Number: 6.6 SUBJECT/RECOMMENDATION: Authorize the final rental and settlement payments to United Rentals North America, Inc. in the not-to-exceed amount of $254,188.40 for the rental and loss of eight diesel-powered portable pumps utilized by the City of Clearwater, from June 1, 2024 through November 30, 2024, pursuant to Clearwater Code of Ordinances Section 2.563(1)(c), Piggyback; declare the eight flood damaged motors and pumps as surplus pursuant to Section 2.623 (8) and authorize the appropriate officials to execute same. (consent) SUMMARY: United Rentals provided two separate quotes containing four diesel powered portable pumps each, for a total of eight pumps. The pumps were procured through a piggyback off Sourcewell contract #062320-URI valid through August 27, 2024, with one-year renewal option which was exercised. Public Works anticipated the rental would extend through November 30, 2024, coinciding with the “official” end of the hurricane season. The six-month rental cost was approved by Council on May 16, 2024. However, on September 26, 2024, the eight operating pumps and motors were destroyed when the hurricane flooded the island. To resolve this matter fully and finally, the following actions are recommended: ·Payment of Remaining Rental Costs: Approve payment for Months 5 and 6 of the rentals, as billed on Invoices 234592328-007 and 234592328-008 ($10,998 each), and 234594345-006 and 234594345-007 ($10,998 each), totaling $43,992.00, per the contract terms. ·Payment of Final Rental Costs: Approve payment for the newly billed "FINAL" rental costs, detailed on Invoices 2634592328-008 ($8,981.20) and 234592328-009 ($8,981.20), both dated November 26, 2024, totaling $17,962.40. ·Purchase of Damaged Equipment: Approve the purchase of the damaged motors, pumps, hoses, and accessories for an amount not exceeding $192,234.00. This amount represents the "Fair Market Value" as determined by United Rentals and outlined in the “Sale Agreement/Invoice” document #239711986-001, dated November 26, 2024. ·Declaration and Sale of Surplus Equipment: Declare the damaged motors and pumps, as detailed in the aforementioned Sale Document, as surplus. Authorize their sale to the highest bidder(s) in a manner deemed most advantageous to the City by the General Services Director of Fleet Operations or designee, pursuant to Section 2.623(8) via Tampa Machinery Auction pursuant to Pinellas County Contract 190-0534 -R(JJ) valid through November 17, 2027. Public Works staff and legal counsel confirm that all contractual obligations have been met. They recommend proceeding with the financial settlement with United Rentals, the salvage sale of the motors and pumps, and the final closure of this matter. APPROPRIATION CODE AND AMOUNT: 4192090-544100 $ 61,954.40 4192090-548000 $192,234.00 Funds for this settlement is available in the Stormwater Maintenance operating budget. This is funded by the Stormwater Utility Enterprise fund. STRATEGIC PRIORITY: 1.2 Maintain public infrastructure, mobility systems, natural lands, environmental resources, and historic features through systematic management efforts. Page 1 City of Clearwater Printed on 1/14/2025 1 APPRAISAL REPORT OF MACHINERY AND EQUIPMENT Located at: City of Clearwater 100 S Myrtle Ave Clearwater, FL 33756 Desktop Appraisal Effective Date of Appraisal: December 6, 2024 PREPARED BY: 240 Park Place Chagrin Falls, OH. 44022 888-494-3433 Joseph Marino, CMEA, EECA Certified Machinery/Equipment Appraiser Expert Equipment Certified Appraiser 2 December 6, 2024 Mr. Marcus Williamson City of Clearwater 100 S Myrtle Ave Clearwater, FL 33756 Dear Mr. Williamson: Per your request, we respectfully provide an appraisal report for certain machinery and equipment items located at City of Clearwater, 100 S Myrtle Ave, Clearwater, FL 33756. You have requested what is commonly referred to as a "desktop" appraisal, which is a hypothetical determination of value based solely upon information provided by the client and conducted without benefit of a physical inspection. Desktop appraisals are common due to time, travel, and cost considerations. This report has been prepared in compliance with the Uniform Standards of Professional Appraisal Practice. Fee Simple Interest has been reported on the machinery and equipment. We are reporting Salvage Value and Scrap Value as of the effective date of December 6, 2024. Use of this report signifies your acceptance of Limiting Conditions contained in the report and the limitations outlined in the Engagement Agreement. A summary of all information collected indicates that as of this date the estimated Salvage Value of all assets contained in this report would be $12,150, and the estimated Scrap Value of all assets contained in this report would be $2,480. In addition, the estimated Fair Market Value of all items contained in this report if found in good condition would be $260,900. Respectfully submitted, Truman Mox Inc Joseph Marino, CMEA, EECA 3 General Information An appraisal is a type of investigation into the law of probabilities with respect to valuation. Through the appraiser's experience, training, and integrity, we are able to project the activities of buyers and sellers in the marketplace into an estimation of value. In reaching a conclusion, comparison of assets usually involves adjustments due to the individuality and uniqueness of each asset. Transactions are often influenced by sentiment, bias, specific needs, politics, familiarity, lack of understanding, and other conditions not considered by the impartial appraiser. The appraiser cannot lend credence to these possible factors lest he misrepresent the very reason for his profession. An appraisal cannot be guaranteed, nor can it always be proven. The opinion of value can, however, be substantiated and final opinion is the result of a thorough professional analysis of a vast quantity of data. An appraisal must not be considered absolute but should be used as a basis of negotiations between concerned parties, whatever their interests. The valuation process, as followed in the preparation of this report, is an orderly procedure for arriving at an estimate of value. By following this procedure the appraiser begins with a preliminary study of the problem involved and defines the basis from which the appraisal is to be made. A program is then initiated for the accumulation, analysis, and observation of data. The data called for in the preliminary study is then gathered, classified, and analyzed. In assignments to estimate Salvage Value and Scrap Value, the ultimate goal of the valuation process is a supported conclusion that reflects the appraiser's study of all influences on the value of the assets being appraised. Therefore, the appraiser studies the assets from various applicable viewpoints. Various approaches are interrelated, and each involves the gathering and analysis of sales, activity, and value data in relation to the assets being appraised. From the analysis, the appraiser derives separate indications of value for the assets being appraised. One or more approaches may be used, depending on their applicability to the particular appraisal assignment. To complete the valuation process, the appraiser integrates the information drawn from the market research and analysis of data and from the application of appraisal techniques to form a conclusion. This conclusion may be an estimate of value or a range in which the value may fall. An effective integration depends on an appraiser's skill, experience, and judgment. With the preceding in mind, the reader's attention is invited to the appraisal report and various exhibits which point out the facts and reasoning leading to the final estimate of value. 4 Summary of Salient Facts Identity of Client City of Clearwater Intended User(s) City of Clearwater Intended Use Internal Matters Property Interest Appraised Fee Simple Sales History of Appraised Item(s) Not Available Class of Property Construction / Preventative Maintenance Current Use of Property Construction / Preventative Maintenance Use of Property When Appraised Construction / Preventative Maintenance Effective Date of Appraisal December 6, 2024 Date Report Written December 6, 2024 Type of Value Salvage Value Final Estimate of Value $12,150 Type of Value Scrap Value Final Estimate of Value Type of Value Final Estimate of Value *Assumes items were in good condition $2,480 Fair Market Value* $260,900 5 Scope of Work The appraiser has been asked to provide a "desktop" appraisal effective December 6, 2024 of certain machinery/equipment items located at City of Clearwater, 100 S Myrtle Ave, Clearwater, FL 33756. A desktop appraisal is a hypothetical determination of value based solely upon information provided by the client and conducted without benefit of physical inspection. Desktop appraisals are common due to time, travel, and cost considerations. It has been requested that fee simple interest be reported as an estimation of the Salvage Value and Scrap Value. The types of value reported have been determined by the appraiser, upon engagement by the client, to be appropriate to the client's needs. This report is identified as a Report that is intended to comply with the reporting requirements as defined under Standards Rule 8-2 (b) of the Uniform Standards of Professional Appraisal Practice (USPAP) for a Appraisal Report. As such, it presents only summary discussions of the data, reasoning, and analyses that are used in the processes to develop the Appraiser's Opinion of Value. Supporting documentation that is not provided with the report concerning data, reasoning and analyses is retained in the appraiser's file. The depth of discussion contained in this report is specific to the needs of the client and for the intended use stated within this report. Not all specific requirements are applicable to every assignment. In this assignment, not all data involving subject sales, offerings, options and listing was obtainable and verifiable, although the appraiser has made every effort to gather the data by direct contact with the various sources through telephone or e-mail. If this detailed data is not included or addressed, the data is considered to be irrelevant. Due to the large number of subject properties oftentimes appraised in a machinery/equipment appraisal, the report is the most commonly used report form. Reports are accepted on a daily basis by the courts, taxing authorities, lenders, business owners, accountants, and other users of appraisal services. The equipment provided for appraisal lacked specific details on the exact make and model of the diesel pumps. As a result, the appraiser made general assumptions regarding the brand and specifications of the pumps based on the information provided, such as vendor details and unit numbers. It is noted that many pumps share similar parts and mechanisms, and the appraisal assumes that the pumps align with industry-standard features typically associated with units from the vendor listed. This assumption may affect the valuation accuracy, and any significant deviations from these assumptions could require a reassessment. The Income Approach would be purely hypothetical in this assignment. The Cost Approach and the Market Data Approach have been utilized for the final value estimate of each item or category with heavy emphasis on the Market Data Approach when possible. The appraiser, when implementing the market data approach, has endeavored to find "sold comparables." That is to say, they are similar items that have actually transferred in ownership. These comparable sales provide the best and most reliable information. However, if actual historical sales information is not available, the appraiser will oftentimes look to the current market of similar items currently for sale. This information can be useful in estimating value. In this report, a search has been made for "sold" items and items currently "for sale". 6 The appraiser has gathered data on the subject items from as many sources as practical, including but not limited to the original equipment manufacturer (if possible), dealers and brokers of like equipment, published catalogs, and guides of similar equipment as well as the Internet. Upon gathering data regarding new and similar models with characteristics of the subject equipment, the writer has then analyzed the data in an effort to estimate value. After research with various industry professionals, including the above-mentioned sources, the appraiser endeavored to arrive at a value estimate for the subject equipment. After a value was established, this written report was then formulated to set forth the findings and conclusions of the appraiser. An extreme effort was made to comply with the Uniform Standards of Professional Appraisal Practice in providing the final written report. This is a report estimating value based on reported conditions. If it is the client's desire to verify the physical condition and/or needed repairs of the machinery/equipment, which is the subject of this report, the client should consult a qualified mechanic/technician. To determine actual mechanical condition is outside of the appraiser's expertise and the scope of this assignment. This assignment has called for only the larger, more expensive items owned by the client to be appraised. It is understood that oftentimes there also exist smaller, less expensive ancillary/support items that "support" the larger items. These items, too, obviously have value but do not in and of themselves merit the time and expense of an individual valuation. Therefore, it is agreed by the client's use of this report, that if these types of items are mentioned in this report, they will be added under a separate section(s) as opposed to the larger capital items and the appraiser will only apply the Cost Approach (less depreciation) to value. The Market Data Approach will not be applied to the smaller, less significant items, due to time and cost factors required in researching smaller items. These items typically include smaller hand tools, furniture, fixtures, shelving, electronic items, i.e., computers, calculators, copiers, telephone systems, etc., and other less expensive items which are considered to "support" the items, which are the focus of this report. Industry depreciation standards have been applied with little, if any, individual description. Lot pricing is employed with these types of items. Further, the request to the writer as to the type of report needed was implemented. That is to say, the equipment may be valued in place, in use, and as part of a going concern entity; in place, not in use; in place to be removed; not in place, etc. Many types of equipment items are labor intensive in their millwright, installation, or removal. This evaluation sets forth the findings and conclusions of the writer, and is based upon an investigation of conditions affecting value, and is subject to the Statement of Limiting Conditions and Definitions. Without reading the Statement of Limiting Conditions and Definitions, the report cannot be fully understood. The scope of this assignment as explained above has been requested and/or agreed to by the client along with the conditions as stated in the Engagement Agreement. 7 Degree to Which the Property is Inspected or Identified For this assignment, the appraiser was requested to perform a desktop appraisal, meaning the equipment was not personally inspected or identified by the appraiser. Instead, the appraisal relies on information provided by others regarding the condition and identity of the items. It was reported to the appraiser that the equipment in question was submerged and rendered inoperable following Hurricane Helene. Extent of Research Into Physical or Economic Factors That Could Affect Property The appraiser has conducted research with manufacturers and suppliers of the subject items. The appraiser has not had access to the profit and loss statements or tax returns of City of Clearwater. It is assumed the business is profitable and the machinery/equipment, which is the subject of this report, will remain in place and in use well into the future. The purpose of this report is not to comment on profit or loss of the owner, and if there is concern in those areas, the reader or user of this report should conduct further studies. Extent of Data Research The appraiser, in research with all listed sources, described to the best of his ability the characteristics of the subject equipment. It is understood equipment items may be purchased/sold with a variety of peripheral attachments, support items, and other amenities, which could affect value. It is not always possible to know of such factors that may or may not exist. Therefore, it is assumed the subject equipment does in fact have basic qualities needed for operation and would have an expected amount of peripheral amenities associated with the subject item. All information provided the appraiser is believed to be accurate but not warranted or guaranteed. Type and Extent of Analysis Applied in Arriving at Opinions or Conclusions Research was held with manufacturers and dealers providing similar machinery and equipment items. After research with manufacturers, dealers, and industry professionals, the appraiser formulated an opinion as to values and market conditions. Depth of Onsite Inspection As mentioned above, the appraiser has not personally inspected the subject equipment but has relied on the testimony of others as to its existence and condition. Appropriate Market or Market Level The most suitable market for this equipment would involve either complete scrapping or dismantling for parts. 8 Intended User(s) The intended user(s) of this report is/are the City of Clearwater. Confidentiality and Privacy The appraiser will maintain the conformity and privacy of customer information obtained in the course of this assignment in compliance with USPAP and Regulation Practices, Title V of Gramm, Leach, Bliley Financial Modernization Act. We do not sell information about our client to others. We protect the security and confidential information about the client. We share information outside of our company only when necessary to administer products or services we provide when we have your permission, or when required or permitted by law. Overall Condition of Equipment It is understood the subject equipment is in Scrap Condition operating condition except as noted, and used on a daily basis. Appearance is Scrap Condition unless otherwise noted. Intended Use It is understood this report is to be used for this purpose and no other: Internal Matters. Property Interest Appraised It is understood that the property interest appraised is in Fee Simple Interest. 9 Statement of Limiting Conditions - Tangible Assets 1. All facts and data set forth in this report are true and correct to the best of the appraiser's knowledge. 2. The fee for this report is not contingent upon the values reported. There have been no guarantees associated with this fee and no liability can be intimated or assumed in any manner. 3. Since this report has been purchased by the addressee, it is assumed by the appraiser that it is to be used by the addressee in determination of value at that point in time. Use of this report by others should be done so with the understanding that no risk or guarantees have been purchased by the owner of the report nor through the fee paid to the appraiser. The appraiser reserves the right to recall all copies of this report to correct any omission or error. 4. Physical condition in most instances has been determined by observation or indication by others. Any unknown conditions existing at the time of inspection could alter the value. No responsibility is assumed for latent defects of any nature whatsoever which may affect value, nor for any expertise required to disclose such conditions. 5. No consideration has been given to liens or encumbrances, which may be against the property. 6. No investigation of legal fee or title to the property has been made and the claim to the property has been assumed to be valid. 7. Neither the appraiser nor any officer or employee of the appraiser's company has any financial interest in the property appraised, unless specifically noted. 8. No additional values or appraisals have been made in regard to such intangibles as patents, rights to manufacture, trademarks, goodwill, going concern value, etc. 9. This report has been prepared in conformity with the Principles of Good Practice and Code of Ethics of NEBB Institute and the Institute of Equipment Valuation. 10. Other limitations, if any, are clearly defined and individually set out at that point related to the subject. 11. Neither all nor any part of the contents of this report, or copy thereof, shall be reproduced for any purpose other than stated in the report, nor shall it be made available to the media, another appraiser or anyone else without the written consent of the appraiser. 12. For all appraisals subject to satisfactory completion, repairs, or alterations, this report and value conclusions are contingent upon completion of the improvements in a workmanlike manner. 13. Information, estimates and opinions furnished the appraiser and contained in this report 10 were obtained from sources considered reliable and believed to be true and correct; however, no responsibility for the accuracy of such items furnished to the appraiser can be assumed by the appraiser. No liability or responsibility is expressed for results from actions taken by anyone as a result of this report. Further, there is no accountability, obligation, or liability to any third party. 14. Matters of legal nature or tax consequences have not necessarily been considered in this report. The reader should consult a competent attorney or CPA for information and opinions in those areas. 15. In many instances, the appraiser is given information regarding machinery and equipment concerning repairs, accessories, condition, etc., which may or may not be verifiable by the appraiser for a variety of reasons. In such cases, the appraiser must rely on information provided him in searching for comparative data. The appraiser disclaims any responsibility if given erroneous information by any party. 16. Machinery and equipment appraisers are called on for price evaluation and verification for equipment from many different fields of business. It is impossible for any appraiser to be an authority in every field of machinery/equipment. Therefore, the appraiser has endeavored to use basic sound, accepted methodologies in any assignment (i.e., Cost New Less Depreciation and Market Data Approaches). Research with those dealing daily in a specific field were conducted, and all final evaluations are founded on prudence and best effort on the part of the appraiser. "Conclusion of opinion of value" is arrived at from years of experience in the sale and appraisal of machinery, equipment, businesses, and commercial properties. The final form of this report is made possible by omitting many details used in estimating, yet not considered essential to the report. 17. The appraiser has endeavored to use due diligence in all market comparisons. If possible, three comparisons of similar items sold usually provide substance for final value determination. However, at times it is not possible to find any direct sales comparisons that have actually sold. In these cases, the appraiser has relied heavily on comments and testimony from sources considered reliable (dealers, auctioneers, manufacturers, wholesaler, etc.) in arriving at the final value estimate. 18. The writer has based his opinion on certain assumptions that have been presented to him. If these basic assumptions should change for any reason, the final valuation could quite likely change. The appraiser reserves the right to make any adjustments considered necessary as additional or more reliable data becomes available. 19. If the request has been for the writer to accept values given by the principals, i.e., hard assets, fixtures, equipment, inventory, etc., then the assignment becomes hypothetical in nature unless the writer has specifically certified the values of such assets in the report. 20. Nomenclature and identification of tangible assets are assumed by the writer to be accurate, but no guarantee is made in this regard. 21. An appraisal is an estimate of value. When the amount is considered a reasonable and proper value under the concept of a definition, then it is applied. For this reason, the 11 value is, in many cases, a rounded number. As stated in Engineering Valuation and Depreciation, a textbook published by Iowa State University Press of Ames, Iowa, "All values are of the nature of forecast of events and are subject to the uncertainties of all prophecies." 22. In most cases, equipment is itemized, although certain areas require a group estimate, in which case the listings are shown in the quantity column as "lot." This is usually applied in nominal value areas that require general descriptions for applications elsewhere, or in areas where difficulty of access for total description would have required additional time not justified by the items being valued. 23. It is assumed that all equipment has standard features commensurate with its normal operation. For instance, machine tools would include but not be limited to: belt guards, foot pedals, magnetic or standard starters, switch-gear, safety equipment, wiring, piping and controls, electrical, pneumatic or hydraulic systems, or other peripheral items considered standard for operating the indicated model or type of equipment. This type of detailed listing is not described for each machine due to repetition, time, cost, and description length within the listing. An attempt is made, however, to indicate any non- standard features at an appropriate point within the study. 24. The valuation concept used in this report is one chosen by the client and should not be considered a recommendation by the appraiser as to what might result in any later application of the concept. Concept probability and/or feasibility are beyond the scope of the appraisal. The user of the report is to determine the probability of occurrence. The appraisal is purchased in order to allow an opinion of value under any assumed set of circumstances, as requested and mutually agreed upon by the client and the appraiser. 25. Description of items made a part of this report is believed correct. Any errors or omissions were unintentional and should not affect the value assignment. Description is made with the attempt of allowing reasonable identification although it may not allow specific item identification in all cases unless company number tagging is utilized. Examples of this would be in such areas as cabinets, shelving, file cabinets, various hand tools, and unserialized equipment or equipment without justification for serial number search due to associated value and/or time consideration. In some cases, identification numbers cannot be found. 26. In some cases, an appraiser may indicate that certain equipment was observed in operation. This qualification is applicable only to specific pieces of equipment and should not be construed that other equipment was not operable or under operation at the time of inspection. This note could become extremely important in the future but is considered more of note "in passing" at the time of the on-site evaluation. 27. The subject equipment may or may not conform to OSHA standards (Occupational Safety & Health Administration). The sole responsibility for conforming rests with the owner of the subject equipment and may not necessarily affect the final estimate of value reported herein. 28. Any controversy arising out of or relating to this report shall be settled by arbitration in 12 accordance with the rules, then in effect, of the American Arbitration Association. In the unlikely event that differences concerning our services or fees should arise, that are not resolved by mutual agreement, our liability for this engagement will be limited to a return of the fees we have received for this engagement. 29. Since the conclusions by the appraiser are based upon judgments, isolation of any single element as the sole basis of comparison to the whole appraisal may be inaccurate. 30. As stated, this is a report estimating value based on "reported" condition. If it is the client's desire to verify physical condition and/or needed repair of the items, which are the subject of this report, the client should consult a qualified mechanic/technician. To determine actual mechanical condition is outside of the appraiser's expertise and the scope of this assignment. If the condition of the equipment is other than as reported to the appraiser, the estimated value could be unreliable. The appraiser reserves the right to change the value estimate if additional information comes forward as to condition or other factors, which could affect value. 31. This is an Appraisal Report. Additional information may be necessary and will be provided to qualified requests by the writer. 32. It should be noted that the term "certified," or "certified appraisal" as used in this report refers to certification from various recognized appraisal and consulting societies, organizations, or institutes. 33. This report is not to be used for insurance purposes unless specifically stated to do so. 13 Definitions of Condition Very Good (VG) This term describes an item of equipment in excellent condition capable of being used to its fully specified utilization for its designated purpose without being modified and not requiring any repairs or abnormal maintenance at the time of inspection or within the foreseeable future. Good Condition (GC) This term describes those items of equipment which have been modified or repaired and are being used at or near their fully specified utilization but the effects of age and/or utilization indicate that some minor repairs may have to be made or that the item may have to be used to some slightly lesser degree than its fully specified utilization in the foreseeable future. Fair Condition (FC) This term describes those items of equipment which are being used at some point below their fully specified utilization because of the effects of age and/or application and which require general repairs and some replacement of minor elements in the foreseeable future to raise their level of utilization to or near their original specifications. Poor Condition (PC) This term is used to describe those items of equipment, which can only be used at some point well below their fully specified utilization, and it is not possible to realize full capability in their current condition without extensive repairs and/or replacement of major elements in the very near future. Scrap Condition (X) This term is used to describe those items of equipment which are no longer serviceable and which cannot be utilized to any practical degree regardless of the extent of the repairs or modifications to which they may be subjected. This condition applies to items of equipment which have been used for 100% of their useful life or which are 100% technologically or functionally obsolescent. 14 Salvage Value Definition Salvage Value is the estimated amount, expressed in terms of money, that may be expected for the whole property or a component of the whole property that is retired from service for possible use elsewhere, as of a specific date. As defined by Valuing Machinery and Equipment: The Fundamentals of Appraising Machinery & Technical Assets, Third Edition, by the American Society of Appraisers. Scrap Value Definition Scrap Value is the estimated amount, expressed in terms of money, that could be realized for the property if it were sold for its material content, not for a productive use, as of a specific date. As defined by Valuing Machinery and Equipment: The Fundamentals of Appraising Machinery & Technical Assets, Third Edition, by the American Society of Appraisers. Fair Market Value Definition Fair Market Value is the estimated amount, expressed in terms of money, that may reasonably be expected for a property in an exchange between a willing buyer and a willing seller, with equity to both, neither under any compulsion to buy or sell, and both fully aware of all relevant facts, as of a specific date. As defined by Valuing Machinery and Equipment: The Fundamentals of Appraising Machinery & Technical Assets, Third Edition, by the American Society of Appraisers. 15 Machinery and Equipment Definitions The following values are defined in the publication Valuing Machinery and Equipment: The Fundamentals of Appraising Machinery & Technical Assets, Second Edition, by the American Society of Appraisers. 1. Fair Market Value is the estimated amount, expressed in terms of money (cash or financing terms equivalent to cash), that may reasonably be expected for a property in an exchange between a willing buyer and a willing seller, with equity to both, neither under any compulsion to buy or sell, and both fully aware of all relevant facts, as of a specific date. 2. Fair Market Value - Removal is the estimated amount, expressed in terms of money, that may reasonably be expected for an item of property in an exchange between a willing buyer and a willing seller, with equity to both, neither under any compulsion to buy or sell and both fully aware of all relevant facts, considering removal of the property to another location, as of a specific date. 3. Fair Market value in Continued Use is the estimated amount, expressed in terms of money, that may reasonably be expected for a property in an exchange between a willing buyer and a willing seller, with equity to both, neither under any compulsion to buy or sell, and both fully aware of all relevant facts, including installation, as of a specific date and assuming that the business earnings support the value reported. This amount includes all normal direct and indirect costs, such as installation and other assemblage costs to make the property fully operational. 4. Fair Market Value - Installed is the estimated amount, expressed in terms of money that may reasonably be expected for an installed property in an exchange between a willing buyer and a willing seller, with equity to both, neither under any compulsion to buy or sell, and both fully aware of all relevant facts, including installation, as of a specific date. This amount includes all normal direct and indirect costs, such as installation and other assemblage costs, necessary to make the property fully operational. 5. Fair Value is the price that would be received to sell an asset or paid to transfer a liability in an orderly transaction between market participants at the measurement date. Source: FASB 2006 (Used by accountants to determine a net exit value.) 6. Orderly Liquidation Value is the estimated gross amount, expressed in terms of money, that could be typically realized from a liquidation sale, given a reasonable period of time to find a purchaser (or purchasers), with the seller being compelled to sell on an "as is," "where is" basis, as of a specific date. 7. Forced Liquidation Value is the estimated gross amount, expressed in terms of money, that could typically be realized from a properly advertised and conducted public auction, with the seller being compelled to sell with a sense of immediacy on an as-is , where-is basis, as of a specific date. 16 8. Liquidation Value in Place is the estimated gross amount, expressed in terms of money that could typically be realized from a failed facility assuming that the entire facility would be sold intact with a limited time to complete the sale, as of a specific date. 9. Salvage Value is the estimated amount, expressed in terms of money that may be expected for the whole property or a component of the whole property that is retired from service for possible use elsewhere, as of a specific date. 10. Scrap Value is the estimated amount, expressed in terms of money that could be realized for the property if it were sold for its material content, not for a productive use, as of a specific date. 11. Insurance Cost New is the replacement or reproduction cost new as defined in the insurance policy less the cost new of the items specifically excluded in the policy, as of a specific date. 12. Insurable Value Depreciated is the insurance replacement or reproduction cost new less accrued depreciation considered for insurance purposes, as defined in the insurance policy or other agreements, as of a specific date. 17 Methods of Valuation Appraisal methods employed in arriving at the final conclusion as to value on all of the equipment in this section include the Cost Approach Analysis and the Market Data Approach Analysis. At times, the Income Approach Analysis is used. However, on equipment of this type, it would be deemed unadvisable, as it is the result of a purely hypothetical value. Cost Approach Analysis The Cost Approach Analysis is defined as a "method in which the value of a property is derived by estimating the replacement cost of the improvements and deducting therefrom the estimated depreciation." There are three primary forms of depreciation: physical, functional and economic. Physical depreciation is often curable and may involve cosmetic appearance (but, in fact, could go deeper). Functional depreciation means that the machinery has had a loss in productivity due to wear and tear. Economic depreciation (sometimes referred to as External Depreciation) occurs outside of the subject property which results in a loss of value. In determining depreciation, the appraiser has used his judgment and prudence in determining the depreciation factor which could be a combination of all three forms described in total. Experience with this type of equipment has proven the use of a formula, which is as follows: Fair Market Value = Remaining Life ------------------------ Normal Life X Cost New This formula again has proven to be effective on numerous occasions. The Market Data Approach This approach is an appraisal technique in which the market value estimate is predicated upon prices being paid in actual market transactions and current listings, the former fixing the lower limit of value in a static or advancing market and fixing the higher limit of value in a declining market; and the latter fixing the higher limit in any market. It is a process of correlation and analysis of similar recently sold properties. The reliability of this technique is dependent upon: 1. The degree of comparability of each property with the property under appraisal; 2. The time of the sale; 3. The verification of the sale data; 4. The absence of unusual conditions affecting the sale. The Income Approach The Income Approach to value is used only when solid data involving income and expenses for a particular item can be established. It is considered hypothetical in most situations involving machinery and equipment, and though while considered, has not been applied in the final value estimate. 18 Reasoning that Supports the Analysis, Opinions and Conclusions In an effort to provide Cost Less Depreciation Analysis, the appraiser has used, when possible, the actual manufacturer (or dealers) of the subject equipment. At times, new replacement models are offered when the subject model is no longer being made. When this condition exists, the appraiser endeavors to correlate and adjust for various factors involved. If the actual manufacturer of the equipment is not available or cannot be reached for any reason, then dealers or distributors are contacted when possible for verification of similar items with similar utility. Sometimes the manufacturer, distributors, and dealers can provide information for the Market Data Approach as well, since they are oftentimes aware of equipment on the used market, even selling similar equipment at times. A search is also made of similar items in the general market place that have sold and are presently offered for sale. Unless specifically stated, the Income Approach has not been applied in this assignment for reasons mentioned above. Sources Contacted The following sources were contacted in this assignment: Results of Analysis of Subject Sales, Offers, Options and Listings Details are maintained in the appraiser's files. 19 Additional Considerations Title of Appraised Equipment It is understood the items listed in this report are owned and belong to City of Clearwater, 100 S Myrtle Ave, Clearwater, FL 33756. The writer makes no guarantee, however, concerning ownership or clear title. Measurable Marketplace There are distinct levels of trade and each may have its own market value. The writer is under the opinion that other companies similar to City of Clearwater, who provide similar products and services, would be the most appropriate market. Market Conditions Summary of Economic Activity The economy of the Sixth District grew slightly from October through mid-November. Employment was steady, but many firms cited plans to hold employment levels flat or reduce headcount via attrition. Wage growth continued to slow. Input costs and prices remained stable, on net. Workforce contacts described an excess of entry-level talent in relation to available positions, and an increase in retirees seeking work to supplement income. Consumer spending improved even amid persistent price sensitivity, and tourism declined at a modest pace. Housing demand fell, especially in Florida, and existing home inventories grew. Transportation activity increased slightly. Manufacturing declined. Loan growth was slow. Energy activity grew modestly. Labor Markets Employment remained steady since the previous report. The pace of hiring was slow, and firms often hired only to backfill open positions. Many firms cited plans to hold headcount flat into 2025, and some intended to slightly reduce headcount, largely through attrition. Several contacts reported combining roles or relying on automation to improve efficiencies. Though not representative of the majority of firms, some contacts said they may resort to layoffs if demand does not strengthen. However, there were also a few reports of hiring for growth, particularly in healthcare. Firms reported that wage growth was slow, and many expect 2025 wage increases to be in line with or even below 2019 increases. Prices Input costs and prices were relatively unchanged over the reporting period. Construction input costs continued to stabilize, with lumber reaching a four-year low and steel returning to historical norms. Rent, food, and utilities costs were broadly reported as flat or slightly down, though concerns around weather events impacting crops and thus future supply were noted. Insurance premiums remained the most frequently cited inflationary pressure. The Atlanta Fed’s Business Inflation Expectations survey showed year-over-year unit cost growth averaged 2.6 percent in October, unchanged from September. Firms' year-ahead inflation expectations for unit cost growth were 2.2 percent, on average, up slightly from 2.1 percent in September. 20 Community Perspectives Despite sustained demand for affordable rental housing, developer contacts indicated recent challenges to fully financing their projects, including funding gaps that emerged late in the predevelopment stage. Contacts observed that they may have to pull funds from projects earlier in the pipeline to fill these financing gaps. Workforce intermediaries and businesses reported that moderating job growth contributed to greater confidence among employers that they can obtain the labor they need. Several labor contacts noted an oversaturation of entry-level talent, at least relative to the availability of aligned positions. Other sources reported increased interest among retirees in finding work to supplement incomes. Consumer Spending and Tourism Retail sales improved modestly over the reporting period. Many retailers saw increased traffic and sales. Consumers across all income levels exhibited increased price sensitivity, often shifting to value brands. Merchants said promotions were effective and customers were more willing to spend if the price was right. Many firms revised up year-end expectations from a few months ago and were increasingly optimistic for a solid 2025. Several retailers noted stocking up on inventory and pulling purchases of imports forward to get ahead of any potential price increases amid uncertainty surrounding international trade policy and possible port strikes. Tourism in the District declined modestly, as travel and hospitality contacts reported “coming down from a 2022 sugar high.” Some contacts noted trends pointing to subdued spending by lower- and middle-income travelers who are more often choosing to rent a home for multiple families and stay in rather than eat out. An area of strength in tourism activity was driven by higherincome travelers and cruising. The outlook for 2025 is cautiously optimistic, though concerns around weather-related events, regulatory uncertainty, and ongoing cost pressures were mentioned. Construction and Real Estate Rising mortgage rates and lagging effects of recent weather events led to a moderate decline in housing demand over the reporting period. While either flat or slightly up in most of the District, year-over-year sales in Florida declined sharply in October. Existing home inventory also increased in many Florida markets, with some, most notably in southwest Florida, now considered oversup- plied. Still, home prices remained stable and there was no significant downward price pressure. Mortgage rates, high home prices and insurance premiums continued to challenge affordability, especially for first-time buyers. Homebuilders still offered aggressive incentives to offset declining affordability and to sell speculative inventory. 26 The Beige Book District commercial real estate (CRE) markets experienced mixed conditions since the previous report. Multifamily properties continued to experience rising vacancy rates; however, contacts reported that demand accelerated as offers of concessions rose. The industrial sector was described as slow but stable. Non-bank lenders reported rising CRE loan delinquencies. Contacts noted an uptick in the number of banks returning to CRE lending, but increasing long- term rates and loan maturities continued to create challenges for all lender types. Transportation Demand for transportation services grew slightly over the reporting period. Railroads saw an uptick in total traffic along with significant increases in shipments of petroleum and petroleum products and of primary forest products, which were partially offset by notable declines in grain, food, metallic ores, coal, and coke. Intermodal activity was flat. Third-party logistics firms cited 21 stable demand. Container volumes rose for ocean carriers and District ports. Trucking activity was flat to slightly down since the previous report, and significantly lower than year-earlier levels. Inland barge carriers characterized demand as flat to slightly improved. Manufacturing Manufacturing activity continued to decline at a modest pace, on net, since the previous report. Some contacts in the steel industry cited weakening demand and compressed margins; however, others noted strong sales and considerable backlogs. Makers of chemicals reported softer sales. More broadly, manufacturers experienced further declines in output, new orders, backlogs, finished goods inventories, and increased supplier delivery times. The outlook for the next 12 months was cautiously optimistic, with expectations for gradual growth. Banking and Finance Loan growth was modest, and financial institutions anticipate increased loan demand as shortterm interest rates decline. Multifamily lending increased moderately as demand for housing exceeded supply. Asset quality was stable with low levels of nonperforming loans as a percentage of total loans. Borrowing by banks continued to decline as institutions reduced reliance on more expensive funding sources. Declining cash balances fueled diminishing cash- to-assets ratios at District institutions and across the industry more broadly over the reporting period. Energy On balance, activity in the energy sector grew modestly. Oil and gas production, refining, and chemical manufacturing were described as flat, and contacts noted supply and demand in these sectors were generally in balance. However, demand for electricity and renewable energy sources Federal Reserve Bank of Atlanta 27 was described as very strong and growing, the former largely driven by data center projects. Utility company contacts reported that growing demand for electricity across the U.S. necessitated significant grid modernization, and while generation options such as higher natural gas usage, renewables, nuclear, storage, and more are in development, most contacts expect utilization to take two years or more. ** The Beige Book, Summary of Commentary on Current Economic Conditions by Federal Reserve District, The Sixth District** Estimated Exposure Time Exposure time is the estimated length of time that the property interest being appraised would have been offered on the market prior to the hypothetical consummation of a sale at market value on the effective date of the appraisal. This is a retrospective opinion based on an analysis of past events assuming a competitive and open market. The appraiser believes that if properly exposed to the open market the subject item(s) would have sold in approximately 180 days. Extraordinary Assumptions and/or Hypothetical Conditions An Extraordinary Assumption is an assumption directly related to a specific assignment, as of the effective date of the assignment results, which if found to be false could alter the appraiser's opinions or conclusions. Extraordinary Assumptions presume as fact otherwise uncertain 22 information about physical, legal or economic characteristics of the subject property; or about conditions external to the property, such as market conditions or trends; or about the integrity of data used in an analysis. A hypothetical condition is a condition, directly related to a specific assignment, which is contrary to what is known by the appraiser to exist on the effective date of the assignment results, but used for purposes of analysis. Hypothetical conditions are contrary to known facts about physical, legal or economic characteristics of the subject property; or about conditions external to the property, such as market conditions or trends; or about the integrity of data used in an analysis. 1. It is believed there are no hidden defects which are not discernible from a visual inspection and which could affect value. 2. Issues resulting from the above condition could affect the assignment results. 23 Comments Regarding Capital Equipment The appraiser has attempted to analyze all subject sales comparisons, offers, options, and listings in accordance with USPAP Standards Rule 7-5. Data found was limited and in some cases unobtainable. The appraiser has conducted research with dealers, manufacturers, brokers, and others. The Internet has also been used, all in an effort to determine detail and characteristics of the appraised item(s). Data that was found has been weighted in the final value estimate or otherwise considered irrelevant. 24 Capital Equipment # Equipment Description Markings/Manufacturer Model Year United Rental Number Hours Condition FMV* Salvage Value Scrap Value 1 Diesel Pump United Rentals Unknown 2014 NPBA 404020 5,178 Scrap $36,600 $1,500 $300 2 Diesel Pump United Rentals Baker DP66LS 2018 Repl-PU60213SA 6" Skid mount Orig BP44LS 3,613 Scrap $39,600 $1,700 $300 3 Diesel Pump United Rentals Unknown 2014 10313197 16,359 Scrap $15,400 $1,500 $300 4 Diesel Pump United Rentals Baker DP44LS 2017 PU40151SA DP44LS 6,085 Scrap $36,600 $1,300 $300 5 Diesel Pump United Rentals Baker DP44LS 2018 Repl 2-PU60214SA - 6" Skid mount Repl1-1075 8,603 Scrap $37,600 $1,300 $300 6 Diesel Pump United Rentals Unknown 2014 NPBA 40 4006 2,365 Scrap $39,600 $1,500 $300 7 Diesel Pump United Rentals Unknown 2016 10460124 15,732 Scrap $15,400 $1,500 $300 8 Diesel Pump United Rentals Unknown 2016 4JSVM 255TP 8,201 Scrap $36,600 $1,500 $300 9 Telemetry United Rentals Unknown NA NA NA Scrap $2,000 $50 $20 10 Suction Hose NA Unknown NA NA NA Scrap $500 $100 $20 11 Dishcharge Hose NA Unknown NA NA NA Scrap $500 $100 $20 12 Strainers NA Unknown NA NA NA Scrap $500 $100 $20 Estimated Fair Market Value: $260,900 Estimated Salvage Value: $12,150 Estimated Scrap Value $2,480 25 Salvageable Components of a Large Diesel Pump 1. Diesel Engine The diesel engine is often the most valuable component. Key parts such as the engine block, fuel injection system, turbocharger, and alternator can be removed and sold separately. 2. Pump Assembly o Pump Housing: The main casing, often constructed of durable metals, can be repurposed or sold for scrap. o Impellers: High-value items made of brass, stainless steel, or other alloys, often salvaged and resold. o Seals and Bearings: Commonly replaced components in high demand for refurbishment and repairs. 3. Control Panel Electronic control systems, including displays, wiring harnesses, and circuit boards, can be removed and sold for parts or repurposed for other pumps. 4. Skid or Trailer Mounts Heavy-duty mounting frames, including trailers, can be salvaged for use with other pumps or resold as standalone units. 5. Couplings and Drive Systems Components connecting the diesel engine to the pump, such as flexible couplings, drive shafts, and gearboxes, are often sought after for repair or replacement. 6. Fuel and Hydraulic Systems o Fuel Tanks: Typically salvageable and reused or sold independently. o Hydraulic Components: Lines, pumps, and actuators associated with the operation of the pump. 7. Valves and Fittings Any attached valves, such as suction and discharge valves, along with associated fittings and piping, are common salvage items. 8. Cooling System Components Radiators, heat exchangers, and cooling fans can be removed and sold separately. 9. Electrical Components Starter motors, alternators, and wiring assemblies are reusable and frequently sold in secondary markets. 10. Miscellaneous Hardware Bolts, brackets, clamps, and other smaller components can be repurposed or sold to maintenance facilities. 26 Scrap Value Assessment The scrap value of each pump was calculated based on the assumed weight of approximately 3,500 pounds per unit and the current market rate for steel, which is $170 per ton. At this rate, each pump yields an estimated scrap value of $297.50 (3,500 lbs ÷ 2,000 lbs/ton × $170/ton). This valuation assumes that the majority of the pump's components, including the frame, housing, and other metallic parts, are composed primarily of recyclable steel. Variations in material composition or market fluctuations could impact the final scrap value. 27 Final Value Summary and Reconciliation Based on the information supplied to the appraiser, using due diligence and discussions with individuals who sell new and used similar equipment, the appraiser has used a combination of the Cost Less Depreciation Approach and the Market Data Approach for each capital equipment item with a primary emphasis on the Market Data Approach when possible. If good, reliable, market data did not exist or was unclear, the Cost Approach was implemented. All data used has been retained in the appraiser's work file as required in a report. The total estimated Salvage Value (Salvage), Scrap Value (Scrap) for the subject items is as follows: Salvage Scrap Capital Equipment Items $12,150 $2,480 Total: $12,150 $2,480 If the items were found to be in good condition, it is estimated that the Fair Market Value would be $260,900. 28 Appraiser's Certificate I certify to the best of my knowledge and belief: 1. The statements of fact contained in this report are true and correct. 2. The reported analyses, opinions, and conclusions are limited only by the reported assumptions and limiting conditions, and are my personal, impartial and unbiased professional analyses, opinions, and conclusions. 3. I have no present or prospective interest in the property that is the subject of this report, and I have no personal interest with respect to the parties involved. 4. I have no bias with respect to the property that is the subject of this report or to the parties involved with this assignment. 5. My engagement in this assignment was not contingent upon developing or reporting pre- determined results. 6. My compensation for completing this assignment is not contingent upon the development or reporting of a predetermined value or direction in value that favors the cause of the client, the amount of the value opinion, the attainment of a stipulated result, or the occurrence of a subsequent event directly related to the intended use of this appraisal. 7. My analyses, opinions, and conclusions were developed, and this report has been prepared, in conformity with the Uniform Standards of Professional Appraisal Practice. 8. I have not made a personal inspection of the property that is the subject of this report. 9. No one provided significant personal property appraisal assistance to the person signing this certification. 10. Because of my training as an appraiser and my experience in numerous business transactions, I am qualified to perform this assignment. 11. I have performed no services, as an appraiser or in any other capacity, regarding the property that is the subject of the work under review, within the three-year period immediately preceding acceptance of this assignment. Non-Discrimination In arriving at the estimated reasonable value, the writer has not been improperly influenced in any manner by the race, religion, or national origin of any person. Certification and Re-Certification Joseph Marino, CMEA, EECA, is in compliance with the NEBB Institute and the Institute of Equipment Valuation certification or re-certification programs. Joseph Marino, CMEA, EECA Date 12-6-2024 29 Appraiser's Qualifications Joseph Marino, CMEA, EECAௗ Professional designations and work experience for Joseph Marino, CMEA, EECA include: Work Experience:ௗ Truman Mox, Inc. President 2011 to Presentௗ Cortland Savings & Banking Company, Vice President Commercial Lending, 2010 to 2012ௗௗ Leader Capital Group, Vice President 2008 to 2010ௗ Park View Federal Savings Bank, Commercial Lending, 2000 to 2008 Education:ௗ Ohio State University, Bachelor of Science, Finance, August 2000.ௗ ௗ Certifications:ௗ EECA – Expert Equipment Certified Appraiser, Institute of Equipment Valuationௗ CMEA – Certified Machinery & Equipment Appraiser, Member Memberships:ௗ National Association of Certified Valuators and Analysts (NACVA) - Memberௗ American Society of Appraisers (ASA) – Memberௗ ௗ ௗ Profile:ௗ Joseph Marino serves as the President of Truman Mox. Mr. Marino holds a Bachelor of Science Degree in Finance from The Ohio State University and served as a Vice President of Commercial Lending and worked for two regional publicly traded banks. His experience includes a broad range of advising on loan transactions from Commercial Construction, Asset Based, Commercial Real Estate, C&I and Equipment/Machinery.ௗ ௗ Mr. Marino has been responsible for overseeing transactions for various small cap and middle market companies in essentially all industries. His transaction experience touches all aspects of debt placement from mergers & acquisitions, senior debt restructuring and leveraged capital transactions.ௗ ௗ Joseph Marino, CMEA, EECA has been awarded the CMEA designation (Certified Machinery/Equipment Appraiser) by the NEBB Institute. And the Expert Equipment Certified Appraiser from the Institute of Equipment Valuation. Qualified CMEA’s and EECA’s are approved to provide appraisal services for the Small Business Administration, Federally Insured Financial Institutions and the Internal Revenue Service. CMEAs and EECA’s are located throughout the United States and several foreign countries, and are used by banks, other lending institutions, CPAs, attorneys, business buyers and others to provide needed financial information for a variety of reasons.ௗ ௗ ௗ 30 ௗ ௗ ௗ ௗ 31 32 ௗ 33 34 ADDENDA 35 Additional Definitions and Terms from USPAP Various terms are used throughout the appraisal report. The following are definitions of the terms: 1. ADVOCACY - Representing the cause or interest of another, even if that cause or interest does not necessarily coincide with one's own beliefs, opinions, conclusions, or recommendations. 2. APPRAISAL - (noun) The act or process of developing an opinion of value; an opinion of value. (Adjective) of or pertaining to appraising and related functions such as appraisal practice or appraisal services. 3. APPRAISAL CONSULTING -The act or process of developing an analysis, recommendation, or opinion to solve a problem, where an opinion of value is a component of the analysis leading to the assignment results. 4. APPRAISAL FOUNDATION - The Appraisal Foundation incorporated as an Illinois not for Profit Corporation on November 30, 1987. 5. APPRAISAL PRACTICE - Valuation services performed by an individual acting as an appraiser, including but not limited to appraisal, appraisal review, or appraisal consulting. 6. APPRAISER - One who is expected to perform valuation services competently and in a manner that is independent, impartial, and objective. 7. APPRAISER PEERS - Other appraisers who have expertise and competency in the same or a similar type of assignment. 8. APPRECIATION - Increase in value due to increase in cost to reproduce, value over the cost, or value at some specified earlier point in time brought about by greater demand, improved economic conditions, increasing price levels, reversal of depreciating environmental trends, improved transportation facilities, direction of community or area growth, or other factors. 9. ASSIGNMENT - A valuation service provided as a consequence of an agreement between an appraiser and a client. 10. ASSIGNMENT RESULTS - An appraiser's opinions and conclusions developed specific to an assignment. 11. ASSUMPTION - that which is taken to be true. 12. BIAS - A preference or inclination that precluded an appraiser's impartiality, independence, or objectivity in an assignment. 13. BUSINESS ENTERPRISE - An entity pursuing an economic activity. 36 14. CLIENT - The party or parties who engage an appraiser (by employment or contract) in a specific assignment. 15. CONFIDENTIAL INFORMATION - Information that is either: Identified by the client as confidential when providing it to an appraiser and that is not available from any other source; or 16. COST - The amount required to create, produce, or obtain a property 17. DEPRECIATION - A loss of utility and hence value from any cause. An effect caused by physical deterioration and/or obsolescence. 18. ECONOMIC OBSOLESCENCE - Impairment of desirability of useful life arising from factors external to the property, such as economic forces or environmental changes which affect supply-demand relationships in the market. Loss in the use and value of a property arising from the factors of economic obsolescence is to be distinguished from loss in value from physical deterioration and functional obsolescence, both of which are inherent in the property. Also referred to as Location or Environmental Obsolescence. 19. EXTRAORDINARY ASSUMPTION - an assumption, directly related to a specific assignment, which, if found to be false, could alter the appraiser's opinion or conclusions. 20. FEASIBILITY ANALYSIS - A study of the cost-benefit relationship of an economic endeavor. 21. FUNCTIONAL OBSOLESCENCE - Impairment of functional capacity or efficiency. Functional obsolescence reflects the loss in value brought about by such factors as overcapacity, inadequacy, and changes in the art that affect the property item itself or its relation with other elements comprising a larger property. The inability of a structure to perform adequately the function for which it is currently employed. 22. HIGHEST AND BEST USE - That reasonable and probable use that will support the highest present value, as defined, as of the effective date of the appraisal. 23. HYPOTHETICAL CONDITION - That which is contrary to what exists but is supposed for the purpose of analysis. 24. INTANGIBLE PROPERTY (INTANGIBLE ASSETS) - Nonphysical assets, including but not limited to franchises, trademarks, patents, copyrights, goodwill, equities, securities, and contracts as distinguished from physical assets such as facilities and equipment. 25. INTENDED USE - The use or uses of an appraiser's reported appraisal, appraisal review, or appraisal consulting assignment opinions and conclusions, as identified by the appraiser based on communication with the client at the time of the assignment. 26. INTENDED USER - The client and any other party as identified, by name or type, as users of the appraisal, appraisal review, or appraisal consulting report by the appraiser on the basis of communication with the client at the time of the assignment. 37 27. JURISDICTIONAL EXCEPTION - An assignment condition that voids the force of a part or parts of USPAP, when compliance with part or parts of USPAP is contrary to law or public policy applicable to the assignment. 28. MARKET PRICE - The amount actually paid, or to be paid, for a property in a particular transaction differs from market value in that it is an accomplished or historic fact, whereas market value is and remains an estimate until proven. Market price involves no assumption of prudent conduct by the parties, absence of undue stimulus, or any other condition basic to the market value concept. 29. MARKET VALUE - A type of value, stated as an opinion, that presumes the transfer of property (i.e., a right of ownership or a bundle of such rights), as of a certain date, under specific conditions set forth in the definition of the term identified by the appraiser as applicable in an appraisal. 30. PERSONAL PROPERTY - Identifiable tangible objects that are considered by the general public as being "personal" - for example, furnishings, artwork, antiques, gems and jewelry, collectibles, machinery and equipment; all tangible property that is not classified as real estate. 31. PRESENT VALUE - The current monetary value. It is the today's cash lump sum, which represents the current value of the right to collect future payments. It is the discounted value of aggregate future payments. 32. PRICE - The amount asked, offered, or paid for property. 33. REPORT - Any communication, written or oral, of an appraisal, appraisal review, or appraisal consulting service that is transmitted to the client upon completion of an assignment. 34. SCOPE OF WORK - The amount and type of information researched and the analysis applied in an assignment. Scope of work includes, but is not limited to, the following:the degree to which the property is inspected or identified;the extent of research into physical or economic factors that could affect the property;the extent of data research;and the type and extent of analysis applied to arrive at opinions or conclusions. 35. SIGNATURE - Personalized evidence indicating authentication of the work performed by the appraiser and the acceptance of the responsibility for content, analyses, and conclusions in the report. 36. SUPPLEMENTAL STANDARDS - Requirements issued by government agencies, government sponsored enterprises, or other entities that establish public policy which add to the purpose, intent and content of the requirements in USPAP, that have a material effect on the development and reporting of assignment results. 37. VALUE - The monetary relationship between properties and those who buy, sell, or use those properties. 38 38. VALUATION PROCESS - Services pertaining to aspects of property value. 39. WORKFILE - Documentation necessary to support an appraiser's analysis, opinions, and conclusions. 39 PHOTOGRAPHS 40 41 42 43 44 Page 1 of 2 GENERAL RELEASE OF CONTRACT CLAIMS KNOW ALL BY THESE PRESENTS that the undersigned, United Rentals North America Inc., (“United Rentals”) for and in consideration of the sum of _____________________ ($X.00), the receipt and sufficiency of which is acknowledged, does hereby, on behalf of the company, its heirs, executors, administrators, representatives, successors, and assigns, fully acquit, release and forever discharge CITY OF CLEARWATER, its employees, council members, representatives, successors and assigns of and from any and all claims, demands, invoices, damages, costs, attorneys' fees, and causes of action whether arising at law or in equity which it may now have, or may hereafter have against the City of Clearwater, concerning any and all occurrences arising out of the rental equipment contract that was entered into between the Parties on or about May 16, 2024 in which United Rental agreed to provide the City with pumps and associated equipment during the rental term according to the same terms and conditions as Sourcewell Contract #062320-URI (the “Contract”). IT IS UNDERSTOOD that the acceptance by the undersigned of the aforesaid consideration and execution and delivery of this Release is not to be considered an admission of liability on the part of City of Clearwater, but is in full settlement and compromise of disputed claims which the undersigned has against the City of Clearwater. IT IS FURTHER UNDERSTOOD that all amounts owed to others arising from the incident have been paid or will be paid from the proceeds of this settlement and the undersigned agrees to fully indemnify and hold harmless all parties hereby released from any claims, past or future, for services of any third-party supplier of equipment or any third-party services related to the Contract. THE UNDERSIGNED FURTHER REPRESENTS that he or she has read and Page 2 of 2 understands this General Release, and specifically understands that this is a General Release of All Claims related to the Contract. SIGNED AND SEALED this _______ day of _____________________, 2024. (CAUTION: READ BEFORE SIGNING) On behalf of United Rentals, Inc. __________________________________________ [Signature] __________________________________________ [Print Name] __________________________________________ [Title] On behalf of City of Clearwater __________________________________________ [Signature] __________________________________________ [Print Name] ________________________________________________ [Title] STATE OF FLORIDA COUNTY OF PINELLAS The foregoing instrument was acknowledged before me by means of physical presence or online notarization, this ______ day of __________________, 2024, by _________________________________ _____________________________________ Signature of Notary Public--State of Florida _____________________________________ Print, Type, or Stamp Commissioned Name of Notary Public Personally Known _____ OR Produced Identification_____ Type of Identification Produced__________ Page 3 of 2 Outfall United Rentals Pump Number Model Year Hours Fair Market Value 10/1/24 Retail Value 10/1/24 Pump Status 10/1 Post Hurrican Helene Condition Based Upon City Photos & Stated Salt Water Flood History Provided Fair Market Value Salvage Value Scrap Value Acacia St NPBA 404020 2014 5178.6 $14,050 $16,524 Inoperable Scrap $36,600 $1,500 $300 Mango St Repl-PU60213SA 6" Skid mount Orig BP44LS PU04780 2018 3613.744 $30,566 $35,960 Inoperable Scrap $39,600 $1,700 $300 Verbena St 10313197 2014 16359.6 $14,050 $16,524 Inoperable Scrap $15,400 $1,500 $300 Gardenia St PU40151SA DP44LS 2017 6085.1 $18,420 $21,670 Inoperable Scrap $36,600 $1,300 $300 Laurel St Repl 2-PU60214SA - 6" Skid mount Repl1-1075 2483 Orig was PU40233JA DP44LS 2018 8603.492 $30,566 $35,960 Inoperable Scrap $37,600 $1,300 $300 Carlouel Dr NPBA 40 4006 2014 2365 $14,050 $16,524 Inoperable Scrap $39,600 $1,500 $300 Bruce Ave 10460124 2016 15732.2 $15,065 $17,720 Inoperable Scrap $15,400 $1,500 $300 1055 Eldorado 4JSVM 255TP 2016 8201 $25,315 $29,783 Inoperable Scrap $36,600 $1,500 $300 Telemetry 8 @ $2,871.00 8@ $3,827.75 $22,968 $30,622 8@$2,000 8@$50 8@$20 $16,000 $400 $160 Suction Hose 8 @ $252 8 @ $252 $2,016 $2,016 8@$500 8@$100 8@$20 $4,000 $800 $160 Discharge Hose 8 @ $267 8 @ $267 $4,272 $4,272 8@$500 8@$100 8@$20 $4,000 $800 $160 Strainers 8 @ $112 8 @ $112 $896 $896 8@$500 8@$100 8@$20 $4,000 $800 $160 $192,234 $228,470 $285,400 $14,600 $3,040 UNITED RENTALS STATED FAIR MARKET VALUE $192,234 ($14,600) UNPAID RENTAL CONTRACTS MONTH 5 and 6 $43,992 BILLED,UNPAID FINAL COSTS AT RENTAL RETURN $17,962 RECOMMENDED SETTLEMENT TOTAL $254,188 TrumanMox Appraiser Values December 6, 2024 United Rentals Northbeach Hurricane Helene Destruction / Settlement Recaps In-service date 6/3/2024 Out of service date 9/26/2024 POTENTIAL SALVAGE VALUE Values - Fair Market and Salvage United Rental Values Outfall and Pump Locations In Service Date Out-of Service Hurricane Surge Vendor United Rentals Pump Number Model Year Hours UR Fair Market Value 10/1/24 UR Retail Value 10/1/24 Pump Status 10/1 Post Hurrican Helene Telemetry Info Suction Length Discharge Length Acacia St 6/3/2024 9/26/2024 United Rental NPBA 404020 2014 5178.6 $ 14,050 $ 16,523.76 Inoperable 11880673 20 130 Mango St 6/3/2024 9/26/2024 United Rental Repl- PU60213SA 6" Skid mount Orig 2018 3613.744 $ 30,566 $ 35,959.53 Inoperable 11880680 20 70 Verbena St 6/3/2024 9/26/2024 United Rental 10313197 2014 16359.6 $ 14,050 $ 16,523.76 Inoperable 11880667 20 128 Gardenia St 6/3/2024 9/26/2024 United Rental PU40151SA DP44LS 2017 6085.1 $ 18,420 $ 21,669.93 Inoperable 11880665 20 128 Laurel St 6/3/2024 9/26/2024 United Rental Repl 2- PU60214SA - 6" Skid mount 2018 8603.492 $ 30,566 $ 35,959.53 Inoperable 11880675 20 197 Carlouel Dr 6/3/2024 9/26/2024 United Rental NPBA 40 4006 2014 2365 $ 14,050 $ 16,523.76 Inoperable 11880671 20 156 Bruce Ave 6/3/2024 9/26/2024 United Rental 10460124 2016 15732.2 $ 15,065 $ 17,720.38 Inoperable 11880674 20 135 1055 Eldorado 6/3/2024 9/26/2024 United Rental 4JSVM 255TP 2016 8201 $ 25,315 $ 29,783.15 Inoperable 11880677 20 150 Telemetry 8 @ $2,871.00 8@ $3,827.75 $ 22,968 $ 30,622.00 Suction Hose 8 @ $252 8 @ $252 $ 2,016 $ 2,016.00 4" x 20' Discharge Hose 8 @ $267 8 @ $267 $ 4,272 $ 4,272.00 4" x 50' Strainers 8 @ $112 8 @ $112 $ 896 $ 896.00 4" x 50' $ 192,234 $ 228,469.80 United Rentals Northbeach Hurricane Helene Destruction / Settlement Recaps The pumps locations listed below are all east and off of Bay Esplanade unless noted by an ** Total Fair Market Value Cover Memo City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 File Number: ID#24-1605 Agenda Date: 1/16/2025 Status: Consent AgendaVersion: 1 File Type: Action ItemIn Control: Finance Agenda Number: 6.7 SUBJECT/RECOMMENDATION: Approve an amendment to the Master Services Agreement Re: Participants (Participation Amendment) between the City of Clearwater, Bank of America, N.A. for itself and as assignee of Banc of America Merchant Services, LLC (Bank), and Central Florida Expressway Authority (Lead Merchant) for the provision of merchant services beginning December 12, 2024 and renewing annually in June until CFX terminates the agreement, and authorize the appropriate officials to execute same. (consent) SUMMARY: The City has utilized Banc of America Merchant Services for the processing of certain VISA and MasterCard payments under a state contract since 2015. The state contract expired on December 11, 2024. Banc of America Merchant Services has an active stand-alone agreement with the Central Florida Expressway Authority (formerly known as the Orlando Orange County Expressway Authority) with the same pricing as the expiring state contract that is available to other governmental entities in Florida as a piggyback option. This merchant services agreement is utilized for revenues collected by Parking, Parks and Recreation, Clearwater Gas, and Business Tax Receipts. APPROPRIATION CODE AND AMOUNT: Fees are charged to 548000 (Other Charges) in the respective departments. USE OF RESERVE FUNDS: N/A STRATEGIC PRIORITY: 1.1 - Provide evidence-based measurement tools to continually guide municipal performance and promote accountable governance. 1.3 - Adopt responsive levels of service for public facilities and amenities, and identify resources required to sustain that level of service. Page 1 City of Clearwater Printed on 1/14/2025 CFX (BOA) Participant Rider 05-01-23 1 AMENDMENT TO MASTER SERVICES AGREEMENT RE: PARTICIPANTS This Amendment to Agreement Re: Participants (“Participant Amendment”) dated _____________________ (“Effective Date”) is made by and among Bank of America, N.A., for itself and as assignee of Banc of America Merchant Services, LLC (“Bank”), CENTRAL FLORIDA EXPRESSWAY AUTHORITY (“Lead Merchant”) and the below identified Participant (each, a “Participant” and collectively, the “Participants”) and supplements and amends the defined Integrated Agreement structure within the Umbrella Agreement for Merchant Processing Services with its referenced documents ("Umbrella Agreement") between the parties dated ______________(collectively, as amended and supplemented from time to time, the “Agreement”). Lead Merchant and Bank (as amended and supplemented from time to time, all collectively the “Agreement”). For the purposes of this Participation Amendment (and the Agreement), a “Participant” shall be defined as any government entity or political subdivision located within the jurisdictional limits of the State of Florida, such as an office, department, division, bureau, board, commission, educational system or other agency, with separate statutory authority, or delegated authority from the Lead Merchant to procure services or otherwise operate under a separate tax identification number as the Lead Merchant (where applicable) that has executed a Participation Amendment. The Lead Merchant and Participants may be referred to herein individually as “Merchant” and collectively as the “Merchants”. Capitalized terms not defined in this Participant Amendment have the meanings set forth in the Agreement, whether or not the corresponding terms in the Agreement are in all capital letters. The parties agree to the following: A. Participants Join the Agreement; Lead Merchant Authority. The Agreement, as stated within the Umbrella Agreement, consists of the following: (a) the Umbrella Agreement,; (b) the Master Services Agreement dated as of June 14, 2013 (“MSA”), (c) Amendment No. 1 to the Master Services Agreement dated as of July 24, 2014 (“MSA Addendum”), (d) Payeezy Services Addendum (“Payeezy Addendum”), dated as of March 30, 2020 (e) any amendments or supplements made to the Agreement after the Effective Date as more fully described herein and (f) this “Amendment to Master Services Agreement Re: Participants” signed by a Participant (the “Participant Amendment”). Each Participant hereby agrees to the terms of the Agreement with the same effect as if it had physically signed the Agreement and entered into a separate version of the Agreement with Bank; provided, however, (i) each Participant (including any Additional Participants, as defined below) acknowledges receipt of a copy of the Agreement, (ii) authorizes the Lead Merchant to act as agent for such Participant in connection with matters relating to the Agreement, including (a) administering the services provided under the Agreement (for purposes of this Participant Amendment, the “Services”), including but not limited to (a) terminating the Agreement entirely and (b) agreeing to assignments, modifications and amendments to the Agreement); any and all such actions by the Lead Merchant will be binding on the Participants; provided; however, Participants agree to reimburse Lead Merchant for any and all causes of actions, injuries, or damages arising from Lead Merchant acting as the agent of the Participants as set forth herein and (iii) with respect to each Participant, Section 5.2 of the MSA is hereby amended to read as follows: 5.2 Limitation of Liability. NOTWITHSTANDING ANYTHING IN THIS MSA TO THE CONTRARY, PROVIDER’S CUMULATIVE LIABILITY, IN THE AGGREGATE (INCLUSIVE OF ANY INDEMNIFICATION OBLIGATION UNDER THIS MSA OR ANY ADDENDUM OR ANY COMPONENT OF THE AGREEMENT STATED IN THE Umbrella Agreement (OR ANY LATER AMENDMENTS THERETO), WHETHER SUCH CLAIMS ARE RELATED OR UNRELATED TO ONE ANOTHER) FOR ALL LOSSES, CLAIMS, SUITS, CONTROVERSIES, BREACHES, OR DAMAGES FOR ANY CAUSE WHATSOEVER (INCLUDING, BUT NOT LIMITED TO, THOSE ARISING OUT OF OR RELATED TO THIS MSA OR ANY ADDENDUM OR ANY COMPONENT OF THE AGREEMENT STATED IN THE UMBRELLA AGREEMENT (OR ANY LATER AMENDMENTS THERETO)) AND REGARDLESS OF THE FORM OF ACTION OR LEGAL THEORY SHALL NOT EXCEED THE LESSER OF, (I) $100,000; OR (II) THE AMOUNT OF FEES RECEIVED BY PROVIDER PURSUANT TO THIS MSA FOR THE SERVICES IN THE IMMEDIATELY PRECEDING 12 MONTHS. Section 5.2 of the MSA remains unchanged with respect to Lead Merchant. Bank may conclusively rely on Lead Merchant's authority to act for itself and to bind the Participants with respect to the foregoing. Notwithstanding any provisions to the contrary, each Participant shall be solely responsible for its own performance under the Agreement, including, but not limited to (a) presenting, managing, transmitting and responding to inquiries regarding Sales Drafts, Credit Drafts, and retrieval requests, (b) providing settlement account instructions and debit authorizations (including for Chargebacks and other amounts owed under the Agreement), (c) transmitting and receiving data and information regarding Participants (including any regarding the Participant’s Sales Drafts (including Cardholder data) and other transactions), (d) coordinating and effecting Terminal changes, (e) executing set-up forms as necessary to provide the Services. The parties hereto agree that Lead Merchant is not guaranteeing the performance of any Participant under the Agreement, nor shall any Participant shall be responsible for the obligations of other Participants, and neither shall any Participant act on behalf of, or instruct Bank with respect to, any other Participant. Bank will enforce the terms of the Agreement directly against each Participant. Each Participant does not waive any defense of sovereign immunity it may have in any Claims brought by a third party against each Participant relating to the indemnity obligations under the Agreement. B. Settlement Accounts. Each Participant will provide Bank with financial institution information necessary for Bank to transfer settlement funds resulting from such Participant’s Sales Drafts (“Settlement Funds”) to an account owned by each such Participant. Settlement Funds for Participants will not be transferred to settlement accounts owned by Lead Merchant nor any other Participant. Each Participant represents and warrants to Bank that no Settlement Funds of a type that, by virtue of a statutory, regulatory, contractual or other restriction, cannot be commingled with other funds or payments will be submitted to or received in any Participant settlement account. CFX (BOA) Participant Rider 05-01-23 2 C. Lead Merchant Reaffirmed Obligations; Representations; Warranties and Covenants. The Lead Merchant reaffirms all of its representations, warranties, covenants, agreements, obligations and responsibilities set forth under the Agreement. Each Participant hereby represents and warrants to Bank that (a) it is a Participant as such is defined hereunder and (b) all necessary action was taken by the Participant’s governing body to provide Lead Merchant all necessary power and authority to act on behalf of Participant in connection with the Agreement and the Services of such Participant as described in this Participation Amendment. Additionally, each Merchant represents and warrants to Bank that (a) the execution and delivery of this Participant Amendment has been authorized by all necessary corporate and governmental action and does not violate any provision of law applicable to such Merchant, or any provision of such Merchant’s organizational documentation or any other agreement binding upon such Merchant, (b) the person(s) executing and delivering this Participant Amendment for and on behalf of such Merchant are duly authorized to do so and (c) the information for such Merchant, as set forth below and/or in Attachment I to this Participant Amendment, including, without limitation, the tax identification number for such Merchant, is true, complete and accurate. Each Merchant agrees that Bank’s reliance and actions taken based on the representations and warranties contained in this Participant Amendment do not constitute negligence or willful misconduct. Further, each Merchant hereby agrees that Bank will not be liable, and such Merchant shall not sue or otherwise make claims against Bank for or on account of any claim for damages arising out of or relating to the Bank allowing the arrangements contemplated by this Participant Amendment. D. Merchants; Additional Participants and New Services. All references in the Agreement to “Customer” or “CUSTOMER” shall have the same meaning as set forth in this Participant Amendment for “Merchant”. Each Participant hereby acknowledges and agrees that, from time to time, the Lead Merchant may, without notice to or consent of the Participants (i) join additional entities (“Additional Participants”) as parties to the Agreement by duly completing and executing (on behalf of itself and the Participants) an Accession Agreement, substantively consistent with the terms of this Participant Amendment and acceptable to Bank, at which time, such Additional Participants shall have the same rights and obligations as the Participants, and the Lead Merchant shall have the same obligations with respect to such Additional Participants as it has for the Participants and/or (ii) subscribe to additional services (“New Services”) via an amendment, addendum or supplement in a form acceptable to the Bank signed by the Lead Merchant (on behalf of itself and the Participants, including any Additional Participants), at which time such New Services shall also constitute Services under the Agreement. E. Financial Information. Section 3.1 of the Agreement (Financial and Other Information), is hereby amended as follows: Notwithstanding any provision to the contrary contained in the Agreement, Participant agrees to provide Bank annual audited financial statements within one hundred eighty (180) days after the end of each fiscal year. In addition, Participant authorizes Bank to obtain from third parties financial and credit information relating to Participant, as authorized under the Participant Amendment (and the Agreement). F. Confidentiality. Notwithstanding any provision to the contrary, the parties hereto acknowledge and agree that any information marked or otherwise identified as confidential or proprietary which is supplied or otherwise made accessible by Bank that Bank requires be treated as Bank’s confidential information will be marked by Bank as confidential. G. Termination. For the avoidance of doubt, Bank may suspend or terminate the provision of Services and/or the Agreement (as applicable) with respect to any Participant, as such suspension or termination rights are described in the Agreement. Bank may terminate the Agreement with respect to any Participant(s), with (90) ninety days’ notice for any reason and with as much notice as is reasonably practicable under the circumstances if: (i) upon notice to Participant if, in Bank’s sole discretion such termination is necessary for Bank to comply with its obligations under any Applicable Law or the Card Organization Rules; (ii) upon notice to Participant where Bank is required to do so by Applicable Law, the Card Organizations; and/or (iii) immediately if Merchant causes, or may cause, harm or loss of goodwill to the Card Organizations’ systems. Any Participant may also terminate its Participant Amendment with (90) ninety days’ notice for any reason. This Participant Amendment will also automatically terminate upon termination of the Agreement or the Umbrella Agreement. H. Counterparts. This Participant Amendment may be executed in any number of counterparts and by the different parties hereto on separate counterparts, and each such counterpart shall be deemed to be an original, but all such counterparts shall together constitute but one and the same Participant Amendment. Receipt of an executed signature page to the Participant Amendment by telecopy, or other electronic transmission shall constitute effective delivery thereof. Participants Each Participant shall be as identified as set forth in the signature block to this Participant Amendment and in Attachment 1 to this Participant Amendment, attached hereto. Fees Shall be as identified in the Agreement. CFX (BOA) Participant Rider 05-01-23 3 Except as modified above, the Agreement remains in full force and effect and any reference to it after the Effective Date will mean the Agreement as modified by this Participant Amendment. This Participant Amendment is not binding on Bank unless and until signed by Bank. CENTRAL FLORIDA EXPRESSWAY AUTHORITY (“LEAD MERCHANT”) Bound by Umbrella Agreement BANK OF AMERICA, N.A. (“BANK”) By: Name: Title: Date: (“PARTICIPANT”) By: Name: Title: Date: (“PARTICIPANT”) By: Name: Title: Date: CFX (BOA) Participant Rider 05-01-23 4 ATTACHMENT 1 TO AMENDMENT TO MASTER SERVICES AGREEMENT RE: PARTICIPANTS Legal Name D/B/A Address Notices (if any) Name/Title/Fax Tax ID # Method of Settlement (See Agreement) Mark one box: Debit/Credit Direct Settlement Account Wire Transfers/Debits to Designated Account Automated Clearing House Credit/Debit to Designated Account Bank Account Number: Bank Account Name: Name & Address of Bank: Bank Officer Contact: Phone Number: Mark one box: Debit/Credit Direct Settlement Account Wire Transfers/Debits to Designated Account Automated Clearing House Credit/Debit to Designated Account Bank Account Number: Bank Account Name: Name & Address of Bank: Bank Officer Contact: Phone Number: Cover Memo City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 File Number: ID#24-1616 Agenda Date: 1/16/2025 Status: Consent AgendaVersion: 1 File Type: Action ItemIn Control: Marine & Aviation Agenda Number: 6.8 SUBJECT/RECOMMENDATION: Approve a Lease Agreement between Clearwater Ferry and the City for ferry vessels purchased under FDOT JPA Agreement G2S84 and authorize the appropriate officials to execute same. (consent) SUMMARY: The City has always had an interest in connecting downtown and Clearwater Beach with alternative forms of transportation. Some of the reasons for the interest are reducing traffic on Memorial Causeway, addressing parking shortages on the beach and providing tourists with other avenues for entertainment. RFP #35-16 was released on May 10, 2016, to evaluate the potential for a scheduled water taxi service in Clearwater providing waterborne transportation between Downtown Clearwater, Clearwater Beach Marina, and the Clearwater Beach Recreation Center. Since November of 2016, Clearwater Ferry Services Inc. has been the sole provider of this service for the city with the routes changing periodically during this time. In July of 2023 the City entered into the Second Amendment and Second Extension to Water Taxi Operation Agreement between the City of Clearwater and the Clearwater Ferry Service. The agreements included the Ferry requested subsidy, in the amount of $500,000 in multiple payments through October of 2027, designed to help cover the operating costs required to service the Clearwater routes and regular schedules (Friday-Sunday from 10 AM - 9:30PM). The City requires Clearwater Ferry Services Inc. to provide a minimum of two vessels for the routes and incorporates a penalty in the event a vessel is out of service for an extended period. Marine and Aviation is responsible for maintaining the ferry landings. The amended routes and schedules were specifically designed to facilitate the activation of downtown and Coachman Park by connecting the City’s Downtown Harbor Marina and Clearwater Beach Marina by an alternative means of transportation. The operating agreement extends until September 30, 2033. On March 7, 2024, Council approved FDOT JPA Agreement G2S84 provided for an 83% grant from FDOT for the purchase of vessels, refurbishment/construction of docks, and water transportation service, with a 17% cash match from the City. The project cost was $1,200,000 with FDOT contributing $1,000,000 in grant funding and the City of Clearwater contributing up to $200,000 in matching funds. The grant allowed for up to $800,000 of grant funds to be used for the purchase of vessels and the refurbishment and construction of docks and up to $200,000 of grant funds to be used for water transportation service operations including maintenance and supplies. On March 8, 2024, the City published RFP 32-24 for the purchase of two pontoon or tritoon vessels for conducting ferry services on the beautiful intercoastal waters on the west-central coast of Florida. On April 18, 2024, the evaluation committee representing City Manager’s Office, Marine and Aviation and a representative from Clearwater Ferry selected Trident Pontoons, Inc. for the purchase of the two ferry vessels. The vessels were built in accordance with specifications outlined in the RFP and the Agreement. The vessels have been delivered. The City would like to enter into a lease agreement with the Clearwater Ferry to license and operate the vessels in compliance with the Second Amendment and Second Page 1 City of Clearwater Printed on 1/14/2025 File Number: ID#24-1616 Extension to Water Taxi Operation Agreement. The Ferry is responsible for all maintenance, registration, licensing and insuring of the vessel. The Ferry agrees to indemnify the City against all liabilities, demands, claims and suits related to the vessels. The City is agreeing to the lease for the nominal amount of $1 in exchange for the Ferry’s performance of the contract terms. APPROPRIATION CODE AND AMOUNT: Annual $1 payment from Clearwater Ferry to be coded to the General Fund. STRATEGIC PRIORITY: High Performing Government: 1.2 Maintain public infrastructure, mobility systems, natural lands, environmental resources, and historic features through systematic management efforts. Economic & Housing Opportunity: 2.2 Cultivate a business climate that welcomes entrepreneurship, inspires local investment, supports Eco-friendly enterprises, and encourages high-quality job growth. Community Well-Being: 3.2 Preserve community livability through responsible development standards, proactive code compliance, and targeted revitalization. Environmental Stewardship: 4.4 Develop accessible and active transportation networks that enhance pedestrian safety and reduce citywide greenhouse gas emissions. Page 2 City of Clearwater Printed on 1/14/2025 STATE OF FLORIDA DEPARTMENT OF TRANSPORTATION CONTRACT STATUS CHANGE/CHECKLIST COMPTROLLER 01/08 STATE COMPTROLLER USE: Info Provider: Dave Newell Received date: Return to: Maurice Forbes Approved date: Mail Station: 7-230 Approved by: Phone # of Info Provider: 813-975-6195 CONTRACT NUMBER: G2S84 SITE/DISTRICT: Seven Total Executed Contract Amount: $ 1,000,000.00 / $ 1,000,000.00 To date This action Status Code (choose one) 10 = Executed Contract 4X or 6X = Audit Status (Indicate Year) 20 = In Claims 99 = Post Design Service 50 = Complete/Terminated Contract Original Contract Amendment (Indicate #) Renewal Addition (Indicate #) Award Supplemental (Indicate #) Letter of Authorization (Indicate #) Time Extension Close Contract Other Changes (must include comments) LETTING DATE: AWARD DATE: DATE OF CONTRACT EXECUTION (Last Signed Date): 1/5/2024 If last date signed > contract start date you must submit emergency certification (287.059 F.S. (2) 1) or Certificate of noncompliance (287.059 F.S. (2)) or settlement document (CM4(87-88) or CM11 (91-92)). CONTRACT BEGINNING DATE: 1/5/2024 ENDING DATE: 6/30/2026 SERVICES BEGINNING DATE: 1/5/2024 SERVICES ENDING DATE: 6/30/2026 VENDOR NAME: City of Clearwater VENDOR NUMBER (FEID/SS): F596000289046 PROJECT NUMBER: 453243-1-94-01 PROJECT NUMBER: PROJECT NUMBER: PROJECT NUMBER: CAN THIS CONTRACT BE RENEWED? YES NO SERVICE TYPE: Earmark - Service Development PAGE NUMBER RENEWAL CLAUSE IN CONTRACT: Comments: Contract executed, please change status code. Certification Statement: I certify that the above information is correct and a true reflection of information contained in the above referenced contract. Approved by: (Printed or typed) Dave Newell Title: Grant Manager Approval Signature: Approval Date: 1/19/2024 DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F01/05/2024 | 3:44 PM EST DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F DocuSign Envelope ID: 2A9637E7-A26E-4877-87D7-D01A6A3A5C1F Cover Memo City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 File Number: ID#24-1604 Agenda Date: 1/16/2025 Status: Consent AgendaVersion: 1 File Type: Action ItemIn Control: General Services Agenda Number: 6.9 SUBJECT/RECOMMENDATION: Declare list of vehicles and equipment surplus and authorize disposal through auction pursuant to Clearwater Code Section 2.623(6) and (8) and authorize the appropriate officials to execute the same. (consent) SUMMARY: On August 17, 2023, Council approved the Vehicle Replacement List for fiscal year 2024. Subsequently, on June 20, 2024, Council approved the Vehicle Replacement List for fiscal year 2025, authorizing the purchase of replacement vehicles and equipment. This agenda item seeks council approval to declare surplus the vehicles and equipment identified for replacement on these lists and authorize their disposal via auction through Tampa Machinery Auction in Tampa, FL, and Royal Auction Group in Zephyrhills, FL, in accordance with Section 2.623(6) and (8). Tampa Machinery Auction and Royal Auction Group were competitively procured by Pinellas County under Contract No. 190-0537-R, valid through November 16, 2027. The vehicles and equipment listed have reached the end of their useful and economic life, as determined by factors such as age, mileage/hours of operation, total life-to-date use, historical maintenance costs compared to similar vehicles, operating costs per mile/hour, anticipated repairs, ongoing maintenance needs, and overall physical condition. Additionally, Fleet will continue to present agenda items for the disposal of vehicles and equipment from the 2023/24 and 2024/25 Vehicle Replacement Lists as their replacements become road ready. APPROPRIATION CODE AND AMOUNT: N/A USE OF RESERVE FUNDS: N/A STRATEGIC PRIORITY: Maintain public infrastructure, mobility systems, natural lands, environmental resources, and historic features through systematic management efforts. Page 1 City of Clearwater Printed on 1/14/2025 ITEM #ASSET #YEAR DESCRIPTION SERIAL NUMBER MILEAGE SURPLUS / DISPOSAL REPLACED BY 1 G1080 1986 BUTLER TRAILER 861296 XXXXX AGE/MILEAGE/CONDITION G5638 2 G1453 1995 WELLS CARGO TRAILER 1W2000F12S3031404 XXXXX AGE/MILEAGE/CONDITION G5639 3 G2448 2001 ODELL TRAILER 2000171596101665P XXXXX AGE/MILEAGE/CONDITION G5640 4 G2490 2003 LESCO SPREADER 7045923J191Z6002 XXXXX AGE/MILEAGE/CONDITION G5669 5 G2554 2004 STERLING ACTERRA 2FZACGDC94AN38508 5878MI AGE/MILEAGE/CONDITION G5468 6 G2693 2003 STERLING ACTERRA 2FZACGAK04AM70109 27650MI AGE/MILEAGE/CONDITION G5440 7 G3041 2004 CROSLEY TRAILER 5MWBU12294S002179 XXXXX AGE/MILEAGE/CONDITION G5642 8 G3231 2002 EZGO 1200G 1502047 1117HR AGE/MILEAGE/CONDITION G5657 9 G3253 2006 PERFORMANCE TRAILER 40ZBP16195P132781 XXXXX AGE/MILEAGE/CONDITION XXXX 10 G3317 2008 CHEVY EXPRESS VAN 1GNFG154981116981 36321MI AGE/MILEAGE/CONDITION G5606 11 G3538 2009 HONDA CIVIC CNG 1HGFA46589L000410 60548MI AGE/MILEAGE/CONDITION TBD 12 G3561 2008 TORO MOWER 290000206 2860 HR AGE/MILEAGE/CONDITION XXXX 13 G3653 2010 TORO ZMASTER 280000275 3400HR AGE/MILEAGE/CONDITION G5531 14 G3698 1999 BRUTUS ROLLER 9751 30HR AGE/MILEAGE/CONDITION G5512 15 G3829 2013 KENWORTH T800 JAWS TRUCK 1NKBH28XXDJ341628 117110MI AGE/MILEAGE/CONDITION G5494 16 G3860 2012 FORD E150 1FTNE1EW8CDB14285 86179MI AGE/MILEAGE/CONDITION G5453 17 G3877 2012 JACOBSON GREENSAIRE 5823401659 39HR AGE/MILEAGE/CONDITION G5667 18 G3926 2012 CASE 580N NACC564829 1830HR AGE/MILEAGE/CONDITION G4076 19 G3914 2013 FORD F150 1FTMF1CMXDKE18807 59650MI AGE/MILEAGE/CONDITION G5596 20 G3917 2013 FORD F150 1FTMF1CMXDKE18810 74044MI AGE/MILEAGE/CONDITION G5597 21 G3957 2013 F350 UT.1FTRF3C61DEA99394 98108MI AGE/MILEAGE/CONDITION G5599 22 G4007 2014 BOBCAT 3200 AJNS30264 2633HR AGE/MILEAGE/CONDITION G5623 23 G4042 2014 FORD E150 1FTNE1EW0EDB10721 84777MI AGE/MILEAGE/CONDITION G5603 24 G4060 2015 FORD TAURUS 1FAHP2D81FG119613 13295MI AGE/MILEAGE/CONDITION G5664 25 G4070 2014 FORD F150 4X4 1FTMF1EM3EKF56073 78736MI AGE/MILEAGE/CONDITION G5604 26 G4071 2014 F150 4X4 1FTEX1EM4EFC09703 106694MI AGE/MILEAGE/CONDITION G5605 27 G4081 2015 FORD F350 1FDRF3G6XFEA88855 61167MI AGE/MILEAGE/CONDITION TBD 28 G4149 2015 CHEVY EQUINOX 2GNALAEKXF1151217 89377MI AGE/MILEAGE/CONDITION G5585 29 G4181 2015 FORD F250 1FTBF2A6XFED18659 105132MI AGE/MILEAGE/CONDITION G5598 30 G4194 2015 FORD F350 1FD8W3G60FED18737 54556MI AGE/MILEAGE/CONDITION G5613 31 G4199 2015 FORD F150 1FTEX1C88FKD50255 87900MI AGE/MILEAGE/CONDITION G5610 32 G4200 2015 FOR F150 1FTEX1C86FKD50254 84583MI AGE/MILEAGE/CONDITION G5611 33 G4353 2017 NISSAN ALTIMA 1N4AL3AP1HN330016 95096MI AGE/MILEAGE/CONDITION G5446 34 G4387 2017 EXPLORER 1FM5K8ARXHGB93204 110551MI AGE/MILEAGE/CONDITION G5415 35 G4406 2017 EXPLORER 1FM5K8AR2HGB82892 97424MI AGE/MILEAGE/CONDITION G5414 36 G4452 2017 FORD F250 1FT7X2B61HEC33990 140137MI AGE/MILEAGE/CONDITION G5621 37 G4589 2018 F250 EXT 1FT7X2A60JEB41714 78386MI AGE/MILEAGE/CONDITION TBD JANUARY AUCTION Cover Memo City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 File Number: ID#25-0004 Agenda Date: 1/16/2025 Status: Consent AgendaVersion: 1 File Type: Action ItemIn Control: Human Resources Agenda Number: 6.10 SUBJECT/RECOMMENDATION: Approve the collective bargaining agreement as negotiated between the City of Clearwater and International Association of Fire Fighters Bargaining Unit for Fiscal years 2024/2025, 2025/2026, 2026/2027 and authorize the appropriate officials to execute same. (consent) SUMMARY: The current collective bargaining agreement between the City of Clearwater and IAFF Bargaining Unit expired on September 30, 2024. The parties reached a tentative agreement for a new contract which was ratified by the membership on January 3, 2025.    This three-year agreement will bring the IAFF to the 75th percentile in year one, which is a 13% increase for Firefighters, a 13% increase for Driver/Operators, a 9% increase for Fire Medics, a 13% increase for Fire Inspector I, a 14% increase for Fire Inspector II, a 15% increase for Fire Lieutenants, and 12% increase for Fire Medic Lieutenants. Year two provides a 4% general wage increase (GWI) for all classifications in the first pay period in October. It also provides a step pay increase of 3% and provides for all pay ranges to be adjusted by 4% in the second year.  In the third year of the agreement, it provides for a 3% general wage increase plus a step pay increase of 3% and a 3% pay range adjustment for all classifications.   APPROPRIATION CODE AND AMOUNT: A cumulative estimated value of this agreement over the three years is $5,312,411.  The cost associated with the implementation of this agreement by fiscal year is anticipated to be approximately as follows:    FY 2024/25                     $2,528,978 FY 2025/26                     $1,299,885  FY 2026/27                     $1,483,548    A contingency fund was budgeted in FY25 to provide for increases related public safety union contract negotiations. The final agreements will require a budget amendment to account for the difference. A first quarter budget amendment will recognize the allocation of $2,250,000 of General Fund revenues to cover increases to Police and Fire departments in excess of budgeted contingency. Future budgets will include the contract costs in the proposed budget. The Fire Department is funded by General Fund revenues. USE OF RESERVE FUNDS: Funding for this contract will be provided by a first quarter budget amendment allocating General Fund reserves in the amount of $2,250,000 to fund increases from public safety union agreements. Inclusive of this item if approved, a net total of $13,180,000 of General Fund reserves has been used to date to fund expenditures in the 2024/25 operating budget. The remaining balance in General Fund reserves after the 8.5% reserve is approximately $27.5 million, or 12.1% of the current General Fund operating budget. Page 1 City of Clearwater Printed on 1/14/2025 File Number: ID#25-0004 STRATEGIC PRIORITY: Superior Public Service 5.1 Attract and retain top-quality personnel through the maintenance of a competitive compensation program. Page 2 City of Clearwater Printed on 1/14/2025 IAFF Collective Bargaining Agreement 2024-2027 Overview of Changes General housekeeping of the document including dates/years have been updated throughout the document, some of the gender specific language was changed to gender neutral, and mentions of 53-hour employees was updated to 53/50-hour employees to reflect the new schedule being implemented in the third year of the contract. Article 3, Rights of Parties Added language that the City shall request and obtain an independent medical evaluation for any disability pension claims and the City Attorney’s office will make a recommendation for a stipulated approval or evidentiary hearing. If stipulated approval is recommended, an agenda item will be brought forward to the Pension Trustees. If an evidentiary hearing is recommended, the hearing shall be conducted by State of Florida Division of Administrative Hearings. Article 5, Labor-Management Cooperation Added language that the City will maintain a brief summary of Labor-Management meetings and the Union can add comments to the summary if necessary. Article 6, Grievance Procedure Added language that the Union waives rights to utilize the Civil Service Board on any matter in the Collective Bargaining Agreement. Updated the steps of the grievance procedure to say calendar days instead of work days and updated the time Fire Administration will meet with the grievant in Step 1 and Step 2 from 10 working days to 14 calendar days. Added language for grievance arbitrations that each party shall have the right to unilaterally reject one list of arbitrators from Federal Medication and Conciliation Service and extended the time frame of the arbitration hearing to sixty days. Article 7, Personnel Practices Added language that as of the third year of the contract, employees will be awarded a Kelly Day after every eight days worked resulting in an average work week of 50.3077. Added language that employees will have the first right of refusal to work the Extra Pay Shift on their assigned Kelly Day provided the employee has signed up for Extra Pay. Updated Pay Plan Administration section to match the new step plan in place. Updated language to remove the Employee Fitness & Wellness Incentive Day starting the third year of the contract to coincide with the implementation of the new schedule. Article 8, Leaves of Absence Added language that 50-hour employees will only receive up to two floating holidays each payroll calendar year starting the third year of the contract to coincide with the implementation of the new schedule. Updated the vacation accruals to be on a table instead of a list and updated the vacation buyback language to match other vacation buyback language. Increased the vacation bank for 53/50-hour employees from 240 to 264 hours and for 40- hour employees from 172 to 180 hours and updated the vacation bank language that all unused vacation hours for the year will be added to the employee’s vacation bank as long as it does not exceed the cap. Increased the sick leave accrual rate for 53/50-hour employees from 134.42 hours a year to 144 hours a year. Updated the funeral leave language to include aunt, uncle, nephew, and niece as part of the extended family. Added that the City will provide one week of paid parental leave to eligible bargaining unit members in conjunction with FMLA use for the birth of a child, adoption, or foster care. Article 9, Wages and Compensation Updated the pay scale for all bargaining positions to be 3% per step instead of $1,800 per year of completed service. Added that bargaining unit members will be paid in accordance with the new annual rate for the first year of the contract. Bargaining unit members will receive a 4% GWI in year two and 3% GWI in year three and eligible bargaining members will receive a step each year of the contract in conjunction with the GWI. Increased the annual resource allowance for bargaining members from $440 a year to $540 a year. Increased the pay for special team members from $50 a pay period to $60 a pay period, increased the pay for special team leaders from $60 a pay period to $70 a pay period, and updated the language so those who serve on more than one special teams can be compensated for up to two special teams. Updated the EMS wages from eligible employees receiving $100 a payroll period to be in the Paramedic pool and 5% assignment pay for all hours served on the ALS unit to eligible employees who are in non-Paramedic job classifications that have a State of Florida and Pinellas County Paramedic certification receiving $225 a payroll period for all employees Increased tuition reimbursement amount from $1,700 to $2,000 and from $2,000 to $2,200 for Master’s Degree level programs. Added language that any employee who has successfully passed a proficiency exam and has been designated as a certified bilingual interpreter shall be eligible to receive $25 per payroll period and any employee who obtains a State of Florida Fire Officer I or 2, State of Florida Fire Inspector I or 2, or State of Florida Arson Investigator certification who do not require it for their job classification are eligible to receive $25 a payroll peri od. These incentive pays are capped at $50 a payroll period. Increased standby pay from $40 to $50 for Monday through Friday and from $50 to $75 for weekends and extended time during designated holidays. Updated paycheck issuance language that states employees who do not use direct deposit will receive a pay card instead of a paper check. Appendix A, Wages Added appendix to show the biweekly pay range for union members for the contract years which mirrors previous Agreements. Addendum, Military and Prior Firefighter Buyback Added language that union members can buyback eligible prior military or firefighter service which will be updated in the pension ordinance. AGREEMENT Between CITY OF CLEARWATER and INTERNATIONAL ASSOCIATION OF FIRE FIGHTERS, AFL-CIO Local 1158 Fiscal Years 2021-2022 2022-2023 2023-2024 2024-2025 2025-2026 2026-2027 Our Mission is to work cooperatively with labor and management to provide cost effective, top quality Emergency services while ensuring and improving the safety and benefits for our Members i Page No. Table of Contents ........................................................................................................................ i-iv Preamble ............................................................................................................................1 ARTICLE 1 Recognition and General Provisions ..............................................................1 Section 1 Exclusive Bargaining Agent ..............................................................................1 Section 2 New Classifications ...........................................................................................1 Section 3 Contract Constitutes Entire Agreement .............................................................1 ARTICLE 2 Representatives of Parties ...............................................................................2 ARTICLE 3 Rights of Parties ........................................................................................... 2-4 Section 1 Management Rights ...........................................................................................2 Section 2 Emergency Conditions .......................................................................................2 Section 3 Union Rights ......................................................................................................3 Stewards .............................................................................................................3 Checkoff .............................................................................................................3 Posting of Agreement ........................................................................................3 Bulletin Boards ..................................................................................................3 Employee Orientation ........................................................................................4 Section 4 No Discrimination ..............................................................................................4 ARTICLE 4 No Strike ...........................................................................................................4 ARTICLE 5 Labor-Management Cooperation ............................................................... 4-5 ARTICLE 6 Grievance Procedure ................................................................................... 5-7 Section 1 Definition ...........................................................................................................5 Section 2 Filing Procedures ...............................................................................................5 Section 3 Arbitration ...................................................................................................... 6-7 Section 4 Grievance Initiated by the City ..........................................................................7 Section 5 Time Limit Exceptions ......................................................................................7 Section 6 Grievance Initiated by Employee .......................................................................7 ARTICLE 7 Personnel Practices .................................................................................... 8-28 Section 1 Work Schedule ...................................................................................................8 Section 2 Assignments .......................................................................................................9 Section 3 Extra Pay Assignment .................................................................................. 9-13 Section 4 Exchange of Duty Time (Swaps) ............................................................... 13-14 ii ARTICLE 7 Personnel Practices (cont.) Page No. Section 5 Call-In, Holdover, and Court Time ..................................................................14 Section 6 Daylight Savings Time ....................................................................................15 Section 7 State EOC/FEMA Deployment........................................................................15 Section 8 Pay Plan Administration ............................................................................ 15-17 Promotions .......................................................................................................15 Demotions ........................................................................................................16 Acting Pay ........................................................................................................16 Fair Labor Standards Exemption .....................................................................17 Section 9 Promotional Process.........................................................................................17 Announcements................................................................................................17 Eligibility .........................................................................................................17 Disqualification of Applicants ................................................................... 17-18 Scope and Character of Evaluation Process.....................................................18 Notification of Results .....................................................................................18 Appeals from Ratings ......................................................................................19 Section 10 Open and Promotional Eligibility Lists ...........................................................19 Section 11 Appointments ...................................................................................................19 Section 12 Probation ..........................................................................................................20 Section 13 Light Duty ........................................................................................................20 Section 14 Line-of-Duty Injury Pay ..................................................................................21 Section 15 EMS Classifications ................................................................................... 22-24 Section 16 Firefighter/Driver-Operator ....................................................................... 24-25 Section 17 Work Rules and Prevailing Rights ...................................................................25 Section 18 Subcontracting .................................................................................................25 Section 19 Indemnification ................................................................................................25 Section 20 Sports Activities On Duty ................................................................................26 Section 21 Lawn Maintenance ...........................................................................................26 Section 22 Physical Examination................................................................................. 26-27 Frequency of Physicals ....................................................................................26 Types of Exams................................................................................................26 Immunizations and Inoculations ......................................................................26 iii ARTICLE 7 Personnel Practices (cont.) Page No. Sect 22 (cont.) Physical Fitness ..............................................................................................26 Department Physician ......................................................................................27 Wellness Re-Opener ........................................................................................27 Section 23 Employee Fitness & Wellness Incentive .........................................................27 Section 24 Residency Requirement ...................................................................................28 Section 25 Tobacco Product Usage ...................................................................................28 ARTICLE 8 Leaves of Absence .................................................................................... 28-43 Section 1 Holidays ...........................................................................................................28 Observed Holidays ...........................................................................................28 Floating Holidays ....................................................................................... 28-29 Selection of Floating Holidays.........................................................................29 Payment for Floating Holidays ........................................................................29 Conversion of Floating Holidays to Personal Leave .......................................29 Section 2 Vacations.................................................................................................... 30-35 Accrual of Vacation Leave ........................................................................ 30-32 Use of Vacation Leave ............................................................................... 32-34 Accrual During Military Leave ........................................................................34 Conversion to Other Leave ..............................................................................34 Payment for Unused Vacation ................................................................... 34-35 Banking of Vacation ........................................................................................35 Section 3 Sick Leave .................................................................................................. 35-39 Accrual of Sick Leave ................................................................................ 35-36 Payment for Unused Sick Leave ................................................................ 37-38 Sick Leave Incentive Program .........................................................................38 Sick Leave Pool ......................................................................................... 38-39 Section 4 Funeral Leave...................................................................................................39 Section 5 Absence Without Leave ...................................................................................40 Section 6 Time Off From Duty .................................................................................. 40-41 Section 7 Right to Contribute Work ................................................................................41 Section 8 Military Leave ............................................................................................ 41-43 iv ARTICLE 9 Wages and Compensation ....................................................................... 43-50 Section 1 Pay Schedule ....................................................................................................43 Section 2 Pay Schedule Format .......................................................................................44 Section 3 Merit Pay Review ............................................................................................44 Section 4 Rates of Pay ............................................................................................... 44-45 Section 5 Annual Personal Resource Allowance .............................................................45 Section 6 Mileage Reimbursement ..................................................................................45 Section 7 Special Teams ............................................................................................ 45-46 Section 8 EMS Wages ............................................................................................... 46-47 Section 9 Training and Tuition Refund ...........................................................................47 Section 10 Clothing and Equipment ............................................................................ 48-49 Section 11 Standby ............................................................................................................50 Section 12 Paycheck Issuance ...........................................................................................50 ARTICLE 10 Insurance ........................................................................................................51 ARTICLE 11 Performance and Discipline ..........................................................................52 ARTICLE 12 Drug and Alcohol Policy ................................................................................52 ARTICLE 13 Retirement ......................................................................................................53 ARTICLE 14 Seniority, Layoff, and Recall................................................................... 53-56 Section 1 Seniority ..................................................................................................... 53-54 Section 2 Layoffs .............................................................................................................55 Section 3 Reemployment Rights ......................................................................................56 Section 4 30-Day Notification .........................................................................................56 ARTICLE 15 Duration, Modification, and Termination ............................................. 56-57 Section 1 Amendments ....................................................................................................56 Section 2 Severability and Waiver ...................................................................................56 Section 3 Duration ...........................................................................................................57 Signature Page .......................................................................................................................57 1 PREAMBLE This Agreement is entered into by the City of Clearwater, Florida, hereinafter referred to as the "City," and Local 1158 of the International Association of Fire Fighters, AFL-CIO, hereinafter referred to as the "Union". The Agreement has been negotiated in good faith for the purpose of promoting harmonious relations, establishing an orderly and peaceful procedure to settle differences which might arise, and setting forth the basic and full agreement between the parties concerning wages, rates of pay, hours of work, and all other terms and conditions of employment. ARTICLE 1 RECOGNITION AND GENERAL PROVISIONS Section 1. Exclusive Bargaining Agent The City recognizes the Union as the exclusive bargaining representative in accordance with Chapter 447, Florida Statutes, as amended, for all employees in the bargaining unit defined by the Public Employees Relations Commission and issued Certification number 122 in Case No. SH-RA-756-1129 dated September 3, 1975. All persons in the classifications designated Firefighter, Firefighter/Driver-Operator, Fire Medic, Fire Lieutenant, Fire Medic Lieutenant, Fire Inspector I, Fire Inspector II, and Fire Prevention Inspector shall be included in the bargaining unit. All others shall be excluded. Any incumbent of the Fire Prevention Inspector job classification as of the effective date of this Agreement shall be permitted to maintain such job classification designation. There shall be no further bargaining unit members allocated to the Fire Prevention Inspector job classification after the effective date of this Agreement. Section 2. New Classifications Should the City and the Union agree to establish new job classifications within the Fire Department which may be in the bargaining unit, the City shall provide notice to the Union not less than 30 days prior to staffing such classification. The parties shall submit a Unit Clarification Petition to the Public Employees Relations Commission and shall negotiate appropriate wage rates, hours, and terms and conditions of employment for such classification. Section 3. Contract Constitutes Entire Agreement of the Parties This Agreement contains the entire contract, understanding, undertaking, and agreement of the parties hereto, and finally determines and settles all matters of collective bargaining for and during its term, except regarding the City's Pension Plan and as may be otherwise specifically provided herein. The Parties agree to bargain proposed changes to the City's Pension Plan at the same time that bargaining occurs for this agreement and successor agreements. 2 ARTICLE 2 REPRESENTATIVES OF PARTIES Section 1. The City agrees that during the term of this Agreement it will deal only with the authorized representatives of the Union in matters requiring mutual consent or other official action called for by this Agreement. Authorized representatives shall be defined as the elected Officers of the Union and duly elected or appointed stewards. The Union agrees to notify the City of the name of such authorized representatives as of the execution of this agreement, and any change in elected Officers or appointed stewards shall be provided by the Union to the Office of the Fire Chief within 72 hours of the change. Section 2. The Union likewise agrees that during the term of this Agreement the Union and the employees covered hereunder shall deal only with the City Manager or his/her representative in matters requiring mutual consent or other official action. The Union specifically agrees that neither the Union nor the employees covered hereunder shall seek to involve the City's elected officials in the administration of this Agreement or otherwise in the operation of the City's Fire Department; provided that nothing contained herein shall restrict an employee's opportunity to present non-employment related matters to such elected officials. ARTICLE 3 RIGHTS OF PARTIES Section 1. Management Rights Except as expressly limited by any provision of this Agreement, the City reserves and retains exclusively all of its normal and inherent rights with respect to the management of its operations, whether exercised or not, including, but not limited to, its rights to determine, and from time to time redetermine, the number, location and type of its various operations, functions and services; the methods, procedures and policies to be employed; to discontinue the conduct of any operations, functions or services, in whole or in part; to transfer its operations, functions or services from or to, either in whole or in part, any of its departments or other divisions; to select and direct the working force in accordance with requirements determined by the City; to create, modify or discontinue job classifications; to establish and change working rules and regulations; to establish and change work schedules and assignments; to transfer, promote or demote employees; to lay off, furlough, terminate or otherwise relieve employees from work for lack of work, lack of funds, or other legitimate reason; to suspend, discharge or otherwise discipline employees for proper cause; to alter or vary past practices and otherwise to take such measures as the City may determine to be necessary to the orderly and efficient operation of its various operations, functions and/or services. Section 2. Emergency Conditions If in the sole discretion of the City Manager or Mayor it is determined that civil emergency conditions exist, including, but not limited to, riots, civil disorders, strikes, hurricane conditions, or similar catastrophes or disorders, the provisions of this Agreement may be suspended by the City Manager or Mayor during the term of the declared emergency provided that wage rates and other direct monetary payments shall not be suspended. 3 Section 3. Union Rights A. Stewards: There shall be one (1) Union Official or designee for all bargaining unit members on each shift for line personnel and one additional Union Official or designee for Fire Prevention personnel. An employee working on duty shall be represented by the respective (line or inspection) "on-duty" representative or other union official. An employee having a grievance shall have the right to take the matter up with his/her Shift Steward or other Union Officer during working time, provided that neither the employee nor the Shift Steward may leave their assigned Fire Station or work area outside a Fire Station without prior permission of the Fire Chief or his/her specifically designated representative, and, provided further, that the employee and the Union Official shall not interfere with the normal operations of the Department. It shall be the employee's responsibility to obtain a representative when the Fire Chief or his/her designee determines that the on- duty representative cannot be made available due to operational demands. All members of the bargaining unit may wear the I.A.F.F. pin on their uniforms. B. Checkoff: The City shall deduct and provide to the Union on a biweekly basis dues and uniform assessments owed by the employee to the Union in an amount certified to be correct by the Union Secretary-Treasurer. Prior to such deduction. the Union shall provide the City with a signed statement from each employee authorizing such deduction in a form satisfactory to the City. Any authorization for dues deduction may be canceled by the employee upon 30 days written notice to the City and the Union. The Union shall indemnify, defend and hold the City, its officers, officials, agents, and employees harmless against any claim, demand, suit, or liability (monetary or otherwise) and for all legal costs arising from any action taken or not taken by the City, its officials, agents, and employees correctly complying with this Section. The Union shall promptly refund to the City any funds received in accordance with this Agreement which are in excess of the amount of basic and uniform membership dues which the City has agreed to deduct. Nothing contained herein shall require the City to deduct from a salary or be otherwise involved in the collection of Union fines, penalties or special assessments. In the event an employee's salary earnings within any pay period, after deductions for withholding, pension or social security, health and/or other standard deductions, are not sufficient to cover dues it will be the responsibility of the Union to collect its dues for that pay period from the employee. C. Posting of Agreement: In accordance with the City’s Greenprint Sustainability Plan, the City and the Union agree that this Agreement shall be posted by the City on the City’s Launchpad and Website. D. Bulletin Boards: The City agrees to provide a 2 feet x 4 feet space on bulletin boards at each Fire Station for posting by the Union of notices of meetings or other official Union information; provided, the Fire District Commander or his/her designee shall first review such posting, and if found to be outside of the scope of this Section, such posting shall be modified to the mutual agreement of the parties. The Fire District Commander will continue to include the Union notices in the intra-departmental mail which he/she delivers to the stations. 4 E. Employee Orientation: The City shall permit the Union to make a presentation to all new bargaining unit members at the City new employee orientation. Subject matter of the Union presentation and any Union materials to be distributed must be approved by the City Manager or his/her designee. Section 4. No Discrimination The City and the Union specifically agree that the provisions of this Agreement shall be equally applicable to all employees covered herein without regard to race, color, religion, sex, national origin, membership or non-membership in labor organization, sexual orientation, or age, as provided by law. Any claim of discrimination under Federal or State civil rights laws by an employee against the City, its officers or representatives shall not be grievable or arbitrable under the provisions of Article 6 but shall be subject only to the method of review prescribed by law. Nothing herein contained shall preclude the right of an employee to grieve and arbitrate disciplinary action taken by the City, except as otherwise herein provided. Section 5. Disability Retirement Process Upon receipt of a complete application for a disability pension, which includes the most recent medical conclusions known to the applicant at the time of submittal, the City shall request and obtain an independent medical evaluation (“IME”). If disabilities are claimed that involve multiple specialties, one IME per specialty shall be selected. Any costs directly or indirectly relating to IME’s shall be paid by the pension plan. After receiving the completed IME report(s), the application and any other records the City deems relevant to the application, the City Attorney’s Office shall either review or arrange for outside legal counsel to review, on behalf of the City, the merits of the application. The City Attorney’s Office, or legal counsel hired by the City Attorney’s Office for this purpose, shall recommend to the City Manager either a stipulated approval or an evidentiary hearing. The City Manager shall take the recommendation under advisement and consider any other factors he/she deems relevant to the application and determine on behalf of the City whether to enter a stipulated approval, or whether to schedule an evidentiary hearing. If the City Manager enters into a stipulated approval, an agenda item shall be brought before the Pension Trustees confirming the stipulation. The role of the Pension Trustees in said approval shall be ministerial in nature. Upon approval by the Pension Trustees, the City shall finalize and distribute the disability pension benefits to which the applicant is entitled. If the City Manager opts for an evidentiary hearing, the hearing shall be conducted by the State of Florida Division of Administrative Hearings (“DOAH”). The Pension Trustees will enter into a contract with DOAH for this purpose. It shall be the duty of the hearing officer to review the application for a disability retirement, determine whether the claim meets the criteria for awarding a disability pension benefit, and issue a recommended order. During the formal hearing, the applicant and City shall have the right to be heard, to be represented by a person of their choice, and to present evidentiary facts. Each party shall pay its own expense for its representative, counsel, and witnesses. At the formal hearing, the technical rules of evidence shall not apply. The hearing officer shall have the power to administer oaths, issue subpoenas, compel the production of books, papers and other documents and receive evidence. The hearing officer shall utilize a procedure similar to that set forth in F.S. §§ 120.569 and 120.57. The hearing officer shall have no authority to award attorney’s fees to the prevailing party. 5 All recommended orders prepared by the hearing officer shall conform with the requirements for such orders as set forth in F.S. §§ 120.569 and 120.57. The hearing officer shall then transmit the recommended order composed of findings of fact, conclusions of law, and disposition to the Pension Trustees. The Pension Trustees may adopt the recommended order as the final order. The Pension Trustees in its final order may reject or modify the conclusions of law over which it has substantive jurisdiction and interpretation of administrative rules over which it has substantive jurisdiction. When rejecting or modifying such conclusion of law or interpretation of administrative rule, the Pension Trustees must state with particularity its reasons for rejecting or modifying such conclusion of law or interpretation of administrative rule and must make a finding that its substituted conclusion of law or interpretation of administrative rule is as or more reasonable than that which was rejected or modified. Rejection or modification of conclusions of law may not form the basis for rejection or modification of findings of fact. The Pension Trustees may not reject or modify the findings of fact unless the Pension Trustees first determines from a review of the entire record, and states with particularity in the order, that the findings of fact were not based upon competent substantial evidence or that the proceedings on which the findings were based did not comply with essential requirements of law. The Pension Trustees may accept the recommendation in the recommended order but may not reduce or increase it without a review of the complete record and without stating with particularity its reasons therefore in the order, by citing to the record in justifying the action. Any party adversely affected shall have the right to have the administrative proceeding reviewed by filing a petition for certiorari with the circuit court of Pinellas County as provided by Rule 9.100 of the Florida Rules of Appellate Procedure. ARTICLE 4 NO STRIKE Section 1. The Union agrees that during the term of this Agreement, it shall not authorize, instigate, condone, excuse, ratify or support any strike, slowdown, sit-down, work stoppage or any other act of like or similar nature likely to interfere with the efficient operation of the City's affairs engaged in or supported by members of the Union and/or employees represented by the Union or other agents or representatives of the Union. The parties specifically incorporate herein the provisions of FS. 447.505, 447.507 and 447.509. Section 2. Should the Union or employees covered by this Agreement within the City's Fire Department breach this Article, the City may then proceed against the Union as covered in FS 447 and such sections of state and federal law that may apply. The City would also be entitled to obtain an injunction with notice at ex-parte hearing for breach of this Article. Section 3. Should any member of the bargaining unit be found guilty of striking as defined in Chapter 447, Florida Statutes, he/she shall be subject to dismissal, and it is expressly agreed that such violation constitutes just cause for dismissal. ARTICLE 5 LABOR-MANAGEMENT COOPERATION A. The City and Union agree to maintain a cooperative Labor/Management committee for the IAFF Local 1158 bargaining units. The committee shall consist of an equal number of members of each party not to exceed a total of eight (8) members. It is understood that this committee in no way is a substitute for the grievance procedure or the right of collective bargaining but has been established for the purpose of 6 discussion and input from both sides on matters that may be mutually resolved by the parties or may eventually become items of collective bargaining, grievances, or litigation. The Labor/Management Committee will meet quarterly or as deemed necessary by the Committee. Either side may cancel a meeting with 24-hours notice. A cancelled meeting may be rescheduled with mutual consent. The Committee will draft bylaws addressing administrative protocols. Adoption and any changes to bylaws shall require a simple majority vote among all members of the Committee. The City will maintain a written brief summary of the events of the meetings. The Union will be permitted to add comments to the summary if necessary. B. Department Safety Committee 1. Authority. The Clearwater Fire and Rescue Occupational Health and Safety Committee shall be established in accordance with the direction as outlined in Florida Stature 633.810, "Workplace safety committees and safety coordinators." 2. Membership. The committee shall be made up of an equal number of bargaining unit members to be appointed by the Union and Fire Department management staff officers to be appointed by the Fire Chief or his/her designee, not to exceed a total of eight members. 3. Workplace Safety Coordinator. A Clearwater Fire and Rescue Chief Officer shall be designated as the department Workplace Safety Coordinator for the purpose of chairing the committee and providing administrative support. 4. Meetings. Upon approval of this agreement by the City Council, the committee shall meet within thirty calendar days thereafter to establish those duties and procedures as outlined in, but not limited to, Florida Statute 633.810, and as approved by the Fire Chief or his/her designee. ARTICLE 6 GRIEVANCE PROCEDURE Section 1. A grievance shall be defined as any difference, dispute or complaint regarding the interpretation or application of the terms of this Agreement, including Civil Service Rules and Regulations, except as exclusions are noted in other articles of this Agreement. The grieving party must state in writing the remedy sought to resolve the grievance. Section 2. All grievances filed shall be submitted on the appropriate form (City form #9900-0061, IAFF Grievance Form), and shall refer to the specific Article and section of this Agreement or Civil Service Rules and Regulations upon which the grievance is based, and shall contain a concise written statement of the facts alleged to support the grievance, and shall be signed by the grievant or representative. A Grievant may be accompanied by a representative of the Union at any time during the Grievance Procedure. Newly hired probationary employees shall not have access to the Grievance Procedure for any matter of discipline (including discharge), assignments, scheduling, or access to training opportunities during the probationary period. Any grievance by a permanent employee relating to suspension or dismissal shall be initiated at Step 2. 7 A grievant is prohibited by law from filing an appeal with the Civil Service Board once a grievance is filed. This shall specifically include grievances relating to suspensions, demotions, and dismissals. On behalf of employees covered by this Agreement, the Union hereby waives all rights of these employees to utilize and appeal to the Civil Service Board concerning any matter defined in this Agreement. This shall specifically include appeals and grievances relating to suspensions, demotions and dismissals. Grievances may be filed and processed by the Union except grievances of discipline that must be initiated by the disciplined employee. As used in this Article, the term "employee" may also mean a group of employees having the same grievance. In such event, one employee shall be designated by the group of employees to act as a spokesperson and shall be responsible for processing the grievance. All employees in the group shall be identified, however only the spokesperson needs to sign the grievance. For purposes of this Grievance Procedure, normal working hours shall be considered 8:00 a.m. to 5:00 p.m. and normal workdays shall be considered Monday through Friday, holidays excepted. STEP l The grievant shall present his/her grievance in writing to their his/her Fire District Commander or Fire Marshal within 30 calendar work days after the grievant has knowledge or constructive knowledge of the occurrence of the action giving rise to the grievance. The Fire District Commander or Fire Marshal shall arrange for a meeting with the grievant within 14 calendar 10 work days of receipt of the grievance. Discussions will be informal for the purpose of settling differences in the simplest and most direct manner. The Fire District Commander or Fire Marshal shall review the grievance and submit a decision in writing to the grievant within 30 calendar work days from the date of the meeting. If the grievance is not resolved at Step 1, the grievance may be appealed to Step 2. STEP 2 If the grievance is not settled at the first step, the grievant shall, within 30 calendar work days of the date of written notification from the Fire District Commander or Fire Marshal, present the written grievance to the Fire Chief or his/her designee. The Fire Chief or his/her designee shall obtain the facts concerning the alleged grievance and shall, within 14 calendar 10 work days following receipt of the written grievance, meet with the grievant. The Fire Chief or his/her designee shall review the grievance and notify the grievant of his/her decision in writing not later than 30 calendar work days following the meeting day. If the grievance is not resolved at Step 2, the grievance may be appealed to Step 3. STEP 3 If still unresolved, the grievance may be submitted to the City Manager or his/her designee within 30 calendar work days of the date of written notification from the Fire Chief or his/her designee. At the request of the grievant, the City Manager or his/her designee shall meet with the grievant. The grievant must make this request to meet with the City Manager at the time of submission of the grievance to the City Manager or designee. If so requested, the City Manager or designee shall arrange a meeting with the grievant within 30 calendar work days of the request. The City may determine who shall meet with the employee. Within 30 calendar work days of the meeting, the City Manager or his/her designee shall notify the employee, in writing, of their his/her decision. 8 If no meeting is requested by the grievant at the time of submission of the grievance to the City Manager or designee, the City Manager or designee shall notify the employee of their his/her decision in writing within 30 calendar work days of receipt of the grievance. If a grievance is not submitted to the City Manager or his/her designee, it shall be deemed to have been resolved at Step 2 to the grievant’s satisfaction. The City shall notify the Union in writing of any change in the City Manager's designee for the receipt or hearing of grievances. Section 3. In the event that the grievance is still unresolved, the matter may be submitted to final and binding arbitration as provided in this section. · A. Within 30 calendar work days of the decision of the City Manager, the aggrieved party shall notify the City Manager of their his/her intent to arbitrate. Within 30 calendar days of the notice of intent to arbitrate, Concurrently, said party shall request from the Federal Mediation and Conciliation Service a list of seven names of qualified arbitrators. Each party shall have the right to unilaterally reject one list of arbitrators received from FMCS. Thereafter, a list may only be rejected by mutual consent of the parties. Within 21 calendar days after After the receipt of such a list, representatives of the parties shall meet and each party shall strike three names. A flip of the coin shall determine who shall strike the first name, and then the other party shall strike a name. The process shall then be repeated until one name remains and the remaining name shall be the arbitrator selected and notified of his/her selection as arbitrator. As promptly as can be arranged but not more than 60 calendar days unless mutually agreed by the City and Union, the arbitration hearing shall be held. Each party shall pay its own expense for its representative, counsel and witnesses. The charges of the arbitrator shall be shared equally by the City and the aggrieved party. The decision of the arbitrator shall be final and binding on both parties, except that either party may seek review as provided by law. The arbitrator shall have no power to add to, subtract from, modify or alter the terms of this Agreement. B. Copies of the decision of the arbitrator made in accordance with the jurisdiction and authority of this Agreement shall be furnished to both parties within 30 calendar days from the close of the hearing or as otherwise agreed to by both parties. Section 4. Formal Processing of Grievance Initiated By The City Where any provision of this Agreement involves responsibility on the part of the Union which, in the view of the City, is not properly being carried out, the City may present the issue to the Union as a grievance. If such grievance cannot be resolved by discussion between the City and the unit representative on an informal basis, the grievance may be formally filed in writing by the City Manager or his/her designee by giving written notice to the business agent of the Union. Such notice shall indicate the provision(s) of the Agreement which the City contends is/are not properly being carried out by the Union. If not resolved within 30 work days following receipt by the Union of the written grievance, the City may submit the grievance to arbitration under the provisions of Section 3 of this Article. Section 5. All of the time limits contained in this Article may be extended by mutual written consent of the parties. If the grievant fails to submit or advance a grievance at any step in the process within the prescribed time limit as defined above, the written determination received by the grievant from the respondent at the prior step shall be considered accepted by the grievant, and the grievance shall be considered resolved. If the City fails to respond to a grievant at any step in the process within the prescribed time limit as defined above, the Union may advance the grievance to the next step in the process. Section 6. If an employee chooses to process their his/her own grievance, the Union must be invited to attend any meeting where the resolution of the grievance may occur. FS 447.301(4). 9 ARTICLE 7 PERSONNEL PRACTICES Section 1. Work Schedule A. Hours and Days of Work: Shifts shall start at 8:00 A.M. each work day and end at 8:00 AM. the following morning. Total: 24 hours. Coverage shall consist of three shifts: "A", "B", and "C", which will work in the following rotation (see sample monthly work schedule below): Sunday Monday Tuesday Wednesday Thursday Friday Saturday 1 work 2 off 3 work 4 off 5 work 6 off 7 off 8 off 9 off 10 work 11 off 12 work 13 off 14 work off 15 off 16 off 17 off 18 off 19 work 20 off 21 work 22 off 23 work 24 off 25 off 26 off 27 off 28 work 29 off 30 work, etc. B. Inspection Division: Fire Inspectors will work 7:30 AM. to 4:00 P.M., Monday through Friday, with a 30-minute lunch break for each inspector. The Chief reserves the right to assign the necessary personnel to each shift which, in his/her judgment, provides for most effective departmental operations. C. Kelly Days: 1. Employees will be awarded a Kelly Day after every 18 days worked. This means they will be scheduled to work 18 consecutive shift days and will be scheduled off the 19th scheduled shift day. This will result in a 53.0526 hour average work week. Effective no later than the first day of the payroll period that includes October 1, 2026, employees will be awarded a Kelly Day after every 8 days worked. This means employees will be scheduled to work 8 consecutive shift days and will be scheduled off the 9th scheduled shift day. This will result in a 50.3077-hour average work week. 2. Kelly Day rotations for each position will be determined by the Department. Individual employees Kelly Day rotations will not be changed except when an employee changes job classification or shift. It is understood that when an employee changes job classification or shift, he/she will be assigned to the Kelly Day rotation for the position being filled. Employees may exchange Kelly Days in accordance with the procedures for exchanges of on-duty time as set forth in Article 7, Section 4 of this Agreement. A Kelly Day may be exchanged only one time between two employees, and once exchanged may not be exchanged again thereafter with another employee 3. When a Kelly Day occurs within a block of days that have been selected by an employee for vacation, the Kelly Day shall not be counted against the employee's vacation leave accrual balance and the vacation leave hours may be used toward a single vacation day request instead. The single vacation day in such case may be submitted during the vacation pick process after the two rounds of vacation "block" selections and before the selection of any "bonus" days, floating holidays, or sick leave incentive days. The single vacation day may also be submitted at any time during the year, subject to availability and the operational demands of the Department, in accordance with Article 8, Section 2, B of this Agreement. 10 Section 2. Assignments A. New and existing employees may be reassigned for Light Duty, training, out-of-area deployments, or voluntary special project opportunities. Employees shall continue to be paid their standard biweekly pay during such assignments. All hours actually worked during such assignments shall be counted toward the calculation of overtime at the end of the established FLSA cycle in accordance with Article 7, Section 8, D. B. Additional work hours assigned through the Mandatory list and Relief list for staffing of response units (seat pay), and for staffing of special events units, shall be paid at the overtime rate as defined in Article 9 Section 4. All other hours worked shall be compensated in accordance with the Federal Fair Labor Standards Act. Section 3. Extra Pay Assignments Department policy may require the scheduling of Extra Pay and/or mandatory Holdover assignments. The department shall attempt to equalize Extra Pay and mandatory Holdover to the extent practicable. The selection of certified and/or individuals who possess specialty qualification(s) may be required and shall be allowed. The Fire Chief shall determine the method(s) for administering Extra Pay and mandatory Holdover provided that methods used shall be in compliance with the requirements herein. Extra Pay and mandatory Holdover administration shall be coordinated at the Fire District Commander level except as otherwise assigned by the Fire Chief or his/her designee. Upon ratification of this agreement, the department shall have up to 90 days to implement the methodology for Extra Pay and mandatory Holdover administration contained herein. During the implementation period, all practices and procedures currently in effect shall be maintained. Extra Pay work shall be defined as that time worked by an employee in addition to the employees regularly scheduled hours where the employee is assigned through the TeleStaff Sign-up list and Mandatory Holdover list for staffing of response units (seat pay; for staffing of special events units, and shall be compensated at the overtime rate as defined in Article 9 Section 4. All other hours worked shall be compensated in accordance with the Federal Fair Labor Standards Act. A. Extra Pay Signup 1. Employees shall be responsible for signing up for Extra Pay eligibility on the specific days they elect to work Extra Pay. Employees may sign up to work only from 0800-2000; or only from 2000-0800; or both time periods. Employees may modify their sign-up to include a specific time- frame. Employees will only be considered for Extra Pay vacancies that span the time frame included in the sign-up. Sign-up access shall be available at each fire station, through the TeleStaff program. 2. Personnel may sign-up, or remove a sign-up, at any time prior to the filling of Extra Pay vacancies. The department may begin filling Extra Pay vacancies as the vacancies become known Extra Pay Vacancies in a three-shift work cycle ("Trick") may be filled anytime after the start of the three- shift work cycle that immediately precedes the work cycle where the vacancies exist. 3. Personnel shall be responsible for maintaining their Extra Pay contact numbers in a manner so that an employee can be contacted. 11 B. Extra Pay Credits 1. Employees shall be assigned credits hour for hour based on the Extra Pay hours worked in a regular shift assignment. 2. Employees who sign-up for Extra Pay and then refuse an Extra Pay offer when contacted between 07:00 and 08:00 hours on the morning where the Extra Pay vacancy occurs, shall be assigned credits equaling the number of hours of the Extra Pay vacancy. No credits shall be added for a refusal after 08:00 hours. No credits shall be added for refusal of shifts less than 12 hours. Inability to contact an employee who has signed up for Extra Pay shall not be cause for adding credits. 3. New employees shall be eligible for Extra Pay assignment after six months of continuous service. These employees shall be assigned a number of credits equal to the average accumulated by all employees in the same classification at that time. 4. Extra Pay credits shall not be carried over from year to year and shall be zeroed out effective January 1 of each year. Initial Extra Pay assignments at the start of each year shall be made on the basis of Department seniority among employees in the same classification. Should two or more employees have the same seniority they shall initially be arranged on the list alphabetically by last name. 5. The department shall maintain overtime credit lists as referenced in the various sections of this article. In addition, the department shall maintain a master Credits list to include all personnel from all shifts, which shall include all types of Extra Pay work. The credit lists shall be used to equalize Extra Pay to the best extent possible. All lists maintained by the Department are maintained in the TeleStaff Program, which is available to all users shall be made available to the Union upon request. C. Shift Extra Pay Selection Procedures 1. The Fire District Commander shall be responsible for the assignment of on-duty personnel to provide adequate staffing according to the Department's minimum staffing requirements. Employees who are on current promotion eligibility lists or who are placed on established "Acting" eligibility lists upon meeting the minimum qualifications and having been deemed qualified by the Department for the necessary classification shall be transferred, assigned laterally, or utilized in an Acting capacity prior to the scheduling of Extra Pay. However, if an employee has taken the most recent promotional exam for that position and not passed, they shall not be deemed as meeting qualifications. Employees shall be chosen who will result in the least amount of disruption to operations. The Department will attempt to equalize acting opportunities among eligible employees to the extent practicable. When the number of on-duty personnel is sufficient to provide coverage to meet the Department's minimum staffing requirements, no assignment of an individual to an Acting capacity shall occur if it will result in the necessity of Extra Pay. 2. When the Department determines that a operational vacancy requires Extra Pay, the Fire District Commander shall initiate procedures to offer the Extra Pay assignment to personnel who are signed up for the that vacancy period. When the Extra Pay vacancy is filled greater than 12 hours prior to the start of the shift where the vacancy exists, Extra Pay offers shall be made in the following order: a. Qualified personnel who hold the same classification as the position necessitating the Extra Pay; sorted by least number of credits; then department seniority; then alphabetical order of surname. 12 b. Qualified personnel who are deemed qualified to act either up or down in the position necessitating the Extra Pay; sorted by least number of credits; then department seniority; then alphabetically by last name. c. Employees will have the first right of refusal to work the Extra Pay shift (24 hours) on their assigned Kelly Day, provided the employee has signed up for Extra Pay. 3. If none of the employees who hold the same classification as the Extra Pay vacancy (paragraphs 2a, above) accept the Extra Pay offer, the Fire District Commander shall have the option to fill that vacancy with on-duty personnel who are deemed qualified to act in that position, and then backfill the resulting vacancy. The Department shall not be obligated to fill the vacancy with an employee who signs-up after this option is implemented. Employees who have failed the most recent promotional exam for the position on shall not be deemed qualified to act in that position. 4. When an Extra Pay vacancy occurs following 1700 hours on the previous shift (same shift-label as the vacancy); the Fire District Commander shall be permitted to fill the Extra Pay at the level of classification of that vacancy. 5. When a vacancy occurs on short-notice and affects operations by placing apparatus below minimum staffing levels, the Fire District Commander may fill the vacancy in the most expeditious manner available at that time, in the manner as close to the regular established procedures (in paragraph C.2. above) as possible. 6. If an employee cancels leave that had created a vacancy, the Extra Pay employees who were selected to fill that vacancy may be cancelled regardless of credits or seniority. There will be no credits assigned to employees who are cancelled. 7. Short-term Extra Pay vacancies created by travel between stations and other short duration events that occur at shift change will be filled by the employee from the previous shift that is in the position creating the vacancy. That employee may arrange for another employee to holdover, subject to approval by the applicable Fire District Commander. D. Mandatory Holdover Extra Pay 1. The Mandatory Holdover Extra Pay procedures will be utilized by the Department when vacancies cannot be staffed with Shift Extra Pay Selection procedures (Para C. above); however, Mandatory Holdover Extra pay shall not be applied until the shift before the Extra Pay vacancy will occur. Mandatory Holdover Extra Pay assignments will be rotated among all employees in accordance with the employee's respective job classification and shift. Employee names will be initially arranged at the first of each year on the Mandatory Extra Pay list by job classification in the order of least senior to most senior. 2. Mandatory Holdover Extra Pay assignments will not exceed 12 hours in duration. Start and end times will be determined by the Fire District Commander. 3. When the need to utilize Mandatory Holdover Extra Pay arises, the Fire District Commander will first use the Mandatory Holdover Extra Pay list from the shift working the day previous to the Holdover Extra Pay vacancy. Employees shall be chosen from the same classification as the vacancy creating the Holdover. Exceptions to the same-classification clause may be made when a vacancy requires a 13 specialty that cannot be fulfilled using same-classification. 3. The list will be utilized in descending order using the first employee in that classification that is qualified to fill the position creating the vacancy. Employees not present at shift change due to approved leave will be bypassed and their position on the list will remain the same. 4. An employee selected for Mandatory Holdover Extra Pay assignment will have the opportunity to arrange for a substitute to fill the assignment. The substitute must be approved by the applicable Fire District Commander. The employee who was initially assigned Mandatory Holdover Extra Pay shall not be relieved of duty until approval for the substitution is issued by the Fire District Commander. When an approved substitute fulfils the Mandatory Holdover Extra Pay assignment, the employee initially subject to the assignment will be moved to the bottom of the list and the position of the substitute employee will remain unchanged on the list. 5. An employee who will not be present at their next-shift start time due to scheduled approved leave will not be subject to assignment from the Mandatory Holdover Extra Pay list from the end of his/her last shift immediately preceding the leave, until the start of his/her first shift immediately following the leave, and the next applicable employee on the list will be selected instead. When an employee is bypassed for a Mandatory Holdover Extra Pay based on this exemption, they shall maintain their current position on the Mandatory Extra Pay list. 6. Failing all of the above, the Fire District Commander will contact the Fire Division Chief to determine the appropriate course of action. Until the appropriate course of action is determined, apparatus will remain in service utilizing the employee who is currently in the position creating the vacancy. E. Special Event Extra Pay 1. The Department will provide notification of Special Event Extra Pay opportunities to all members of the bargaining unit. Notification will include the type and location of the event, the anticipated start and end times of the event, the number of personnel, respective job classifications and specialties needed, and deadline to respond. Employees may signup, or remove a signup, for special event Extra Pay up to the point that the Extra Pay is assigned which may occur anytime after the published deadline. 2. The selection of certified and/or individuals who possess specialty qualification(s) may be required and shall be allowed. Special Event Extra Pay offers shall be made in the following order: a. Qualified personnel who hold the same classification as the position necessitating the Extra Pay sorted by least number of credits; then department seniority; then alphabetically by last name. b. Qualified personnel who are deemed qualified to act either up or down in the position necessitating the Extra Pay sorted by least number of credits; then department seniority; then alphabetically by last name. However, if an employee has taken the most recent promotional exam for that position and not passed, they shall not be deemed as meeting qualifications. 3. If none of the employees who hold the same classification as the Extra Pay vacancy (paragraphs 2a, above) accept the Extra Pay offer, the Fire District Commander shall have the option to fill the special event vacancy with on-duty personnel who are deemed qualified for that position, and then backfill the resulting shift vacancy. 4. Employees shall be assigned credits hour for hour based on the Extra Pay hours worked in a special event assignment. Credits shall be applied to the same credit "bucket" as shift Extra Pay credits. 5. When there are an insufficient number of employees available from the special event Extra Pay sign-up list, mandatory assignment may be utilized in accordance with the procedures described in paragraph D above. If the vacancies cannot be filled with personnel from the shift prior to the Special Event, the mandatory list for the shift on four-days off may be utilized subject to the provisions of paragraph D. 14 6. Employees who are signed up for a special event assignment and subsequently refuse that assignment will be assigned credits equaling the number of hours of the event refused. 7. New employees shall be eligible for special event Extra Pay after six months of continuous service. These employees shall be assigned a number of credits equal to the average accumulated by all employees in the same classification at that time. 8. Extra Pay credits shall not be carried over from year to year and shall be zeroed out effective January 1 of each year. Initial special event Extra Pay assignment each year shall be made on the basis of Department seniority among employees in the same classification. F. Emergency Conditions Extra Pay When the Fire Chief determines that a state of emergency does or may exist, including, but not limited to natural or manmade disaster, civil disturbance, or other situation necessitating increased staffing for operational effectiveness, the procedures listed above may be bypassed during the state of emergency and staffing will be established according to operational needs. However, compensation for Extra Pay assignments shall still be in effect. Section 4. Exchange of Duty Time Employees within the Department may exchange on-duty time upon the following conditions: A. That the employee filling in be acceptable to the applicable Fire District Commander prior to the change. With the approval of the applicable Fire District Commander, Fire Medic Lieutenants and Acting Fire Medic Lieutenant - qualified Fire Lieutenants shall be permitted to exchange on-duty time. B. That the employees desiring the exchange notify the company officer of the anticipated change not less than 24 hours prior to the start of the anticipated changed unless such exchange arises under emergency situations. C. That no employee may be allowed to exchange more than 192 hours (8 days) per fiscal year. Additional Exchange of Duty Time hours may be granted by the Fire Chief or his/her designee. Each time an employee is permitted to allow another employee to work in his/her place in accordance with this exchange provision, the number of hours to be exchanged will be counted toward the established limit only for the employee who has been permitted to allow another employee to work in his/her place. D. That the employee working the time will be covered by all applicable benefits in case of injury while filling in, but will not receive pay for this period. E. If the employee agreeing to loan or fill in time is sick or fails to appear for the exchange, his/her appropriate leave account or pay will be charged. F. The employee agreeing to fill in for another member is obligated to remain on duty in the absence of the person with whom the exchange is made. G. Notwithstanding any provision to the contrary above, the City shall not be required to allow an exchange if doing so would impose upon the City liability for any additional overtime compensation over what persons may otherwise be entitled to. Prior to discontinuing the exchange allowance for this reason the City shall notify the Union concerning the legal basis for the decision to do so. 15 H. Time exchange is subject to a one hour minimum and at one-hour increments. Any premium of acting pay shall be in accordance with this Agreement and Departmental policy. I. Kelly Days may be exchanged between bargaining unit members in the same job classification only. An exception to this restriction may be made if the employees involved and department management all agree to the exchange. Kelly Day exchanges shall not count towards the 192 hours allotted for swaps in a year. J. Bargaining unit members on a Kelly Day shall not be counted towards the total allotted number of employees allowed off for any given day. Section 5. Call-in/Holdover/Court Time A. When an employee is called in to work less than 48 hours prior to the start of his/her regularly scheduled shift to perform the duties and responsibilities of an established Fire Department job classification, he/she will be paid a minimum of four hours at the overtime rate of pay. The City may require the employee to remain on duty for the duration of the four-hour period or for as long as he/she is needed, at the option of the City. The procedures outlined in Article 7, Section 3 of this agreement shall be used to fill positions when a call-in is necessary. All hours actually worked during such call- in shall be counted toward the calculation of overtime at the end of the established FLSA cycle in accordance with Article 7, Section 8, D of this Agreement. B. When an employee is held over past the end of his/her regularly scheduled shift to perform the duties and responsibilities of an established Fire Department job classification, the time held over shall be paid at the overtime rate of pay and shall be counted as time worked toward the calculation of overtime at the end of the established FLSA cycle in accordance with Article 7, Section 8, D of this Agreement. The City may require the employee to remain on duty until a relief employee arrives, in order to maintain staffing levels when the absence of such employee or employees would result in the removal of a unit or units from service. The holdover provision above will be utilized only until the position can be filled by use of the overtime procedures outlined in Article 7, Section 3 of this Agreement. C. Any employee whose appearance is required in Circuit Court or County Court as the result of a matter arising out of the course of his/her employment, shall receive a minimum of two hours pay if such attendance is during the employee's off-duty hours. This time will be paid at the regular rate of pay and will be counted as hours worked toward the calculation of overtime. This same provision shall also apply when the employee is subpoenaed to appear at the State Attorney's Office, Public Defender's Office, or a private attorney's office, in a criminal case arising from the employee's course of employment. However, this provision shall not apply when an employee or the Union has brought an action against the City or any City official. D. Leave with pay will be granted for those hours spent by an employee on jury duty that fall during the employee's scheduled work hours only. The employee will notify his/her Fire District Commander immediately upon learning of selection for jury duty. Scheduled work hours that the employee is released from work with pay for jury duty shall not count as hours worked for the purpose of determining overtime. The employee may be required to provide evidence of jury duty service in order to receive compensation for such hours. 16 E. Employees who participate in meetings or on committees at the request of the City shall have all such time counted as hours worked and shall be paid at their regular rate of pay. The holdover and call-in provisions as outlined in this Section shall not apply to time spent participating in meetings or on City committees. Section 6. Daylight Savings Time All bargaining unit members on the regularly scheduled shift in the Fall that as a result of Daylight Saving Time actually work (sweat) twenty-five hours shall receive their standard biweekly rate of pay plus one additional hour in the affected pay period. The additional hour actually worked shall be counted towards the calculation of Overtime at the end of the respective FLSA cycle. All bargaining unit members on the regularly scheduled shift in the Spring that as a result of Daylight Saving Time actually work (sweat) twenty three hours shall receive their standard biweekly rate of pay in the affected pay period. The additional hour not actually worked shall count as hours actually worked and shall be counted towards the calculation of Overtime at the end of the respective FLSA cycle. Vacation, Floating Holiday, and Sick Leave days used on the affected days shall count as 24 hours (if the entire shift is used) in either of the above instances. Exchanges of on-duty time (swaps) on the affected days shall be treated in accordance with Section 4 of this Article. As such, the regularly scheduled employee shall be entitled to credit for the additional hour in the Fall. Section 7. State EOC/FEMA Initiated Emergency Deployment It is understood that the Department may deploy personnel to render aid and assistance to other jurisdictions in accordance with State EOC and or FEMA initiatives. No bargaining unit employee will be involuntarily assigned to deploy under this paragraph. Such deployments shall not be subject to the call-in provisions as outlined in Section 5 of this Article. Employees subject to such deployments shall not suffer a loss of any regular pay the employee would otherwise have received if not dispatched as a result of the assignment. However, any pay above and beyond the employee's regular pay shall be based upon and subject to Section 2 of this Article and the reimbursing agency guidelines. Where such guidelines are available, they shall be provided to the employees at the time of assignment. Employees who are deployed in accordance with the provisions above shall be eligible for any applicable insurance, including Workers Compensation, to the extent provided by the plan terms or applicable law for the duration of such deployment. Section 8. Pay Plan Administration A. Promotions: 1. Upon promotion from one classification to a higher level classification, an employee shall be placed into the step number in the higher level classification which is the same as the step number to which the employee is assigned in their current classification. (For example, a Step 6 Firefighter would be promoted into Step 6 of the Fire Medic range. A Step 5 Fire Medic would be promoted into Step 5 of 17 the Fire Lieutenant range.) will receive an increase equal to the difference between the base pay in the employee’s current job classification and the base pay in the promotional job classification (for example, an employee who is promoted from Fire Medic to Fire Lieutenant would receive an increase of $8,000.00). Under no circumstances will the employee's promotional base rate of pay exceed the established pay range maximum. 2. A higher level classification shall be deemed to be one having a higher maximum rate of pay. A promoted employee shall maintain their his/her existing annual performance review date for the purpose of determining eligibility for subsequent annual performance reviews. B. Demotions: 1. An employee who is demoted for any reason shall be placed into the step number in the lower level classification which is the same as the step number to which the employee is assigned in their current classification. (For example, a Step 6 Fire Medic would be demoted into Step 6 of the Firefighter range. A Step 5 Fire Lieutenant would be demoted into Step 5 of the Firefighter/Driver-Operator range.) voluntarily, for lack of work occasioned by consolidation of a municipal function by another governmental agency, for lack of work generally, for lack of funds, or for other causes beyond his/her control, will receive a decrease equal to the difference between the base pay in the employee’s current job classification and the base pay in the demoted job classification. An employee may be allowed, with the prior approval of the Fire Chief, to demote only to a lower level classification for which a position vacancy exists and for which the employee meets the minimum eligibility requirements at the time of demotion. A demoted employee shall maintain their his/her existing annual performance review date for the purpose of determining eligibility for subsequent annual performance reviews. A demotion shall be defined as any change of an employee from a position in one class to a position in a class of a lower level. A lower level classification shall be deemed to be one having a lower maximum rate of pay. For non-voluntary, non-disciplinary demotions, such employee shall be placed at the head of the reemployment list for the class from which he/she was demoted. 2. An employee who is appointed from layoff from the reemployment list to a position in the department in which he/she previously served shall be paid the equivalent to what he/she was receiving upon separation, adjusted only by the any difference in the amount of base pay upon termination and the base pay in effect for the job classification held at the time of re-employment, and shall be eligible for step advancement Merit Pay when he/she shall have been re-employed a sufficient number of days to make up the number of days he/she lacked for eligibility at the time of separation. C. Acting Pay 1. Acting pay shall be provided to any employee who is assigned in an acting capacity to a position in a class of a higher level for a minimum of four hours. An employee shall be deemed qualified and shall be required to act in a higher level classification if he/she is on the existing eligibility list, or if he/she is placed on an established "Acting" eligibility list upon being determined, after agreeing to participate in a process to be conducted by the Department, to meet guidelines established by the Department for the higher level classification. The Fire District Commander shall fill Acting assignments when the Department is at or above minimum staffing levels by choosing employees who will result in the least amount of disruption to operations and in accordance with Article 7, Section 3, C. 2. Acting Pay shall be 5% above the employee's current base rate of pay. 18 3. Acting Pay Removal Acting pay shall cease to be paid to a bargaining unit member when: The employee is reassigned, transferred, demoted or promoted to any position not involving the performance of the acting function, or the acting position is removed by the Department or other appropriate authority pursuant to provisions of the collective bargaining Agreement. Acting pay terminates at the time of the job function change or at the time of the formal assignment removal. Any employee who has elected to be included on the established "Acting" eligibility list may, with 30 days notice, be voluntarily removed from the list. The Department at its discretion may at any time remove an employee from the "Acting" eligibility list. The Department will provide the employee with the reason for removal from the list. Those Paramedic certified employees who are assigned to the non-Paramedic classifications of Firefighter and Firefighter/Driver-Operator, and who elect to voluntarily be removed from the "Acting" eligibility list and no longer be eligible for a Paramedic certification pay differential, shall not be permitted to request reinstatement to the established "Acting" eligibility list for a period of six months from the time they are removed from the list. 4. Acting Eligibility List Shortages In the event the Department determines that an insufficient number of employees are willing or qualified to serve in an Acting capacity for a given job classification, the Union agrees to discuss and, if necessary, negotiate changes or impacts as required by law. This includes but is not limited to changes such as qualification requirements for classifications and promotion, modification of external hiring and employment criteria, modification or elimination of job classifications, or changes to Acting requirements. D. Fair Labor Standards, Section 7(k) Exemption 1. The City of Clearwater Fire Department, pursuant to the Fair Labor Standards Section 7(k) exemption, has established a 28-day work cycle for employees in the bargaining unit who work 106 hours average biweekly schedule. 2. All employees in the bargaining unit with the exception of Fire inspection personnel shall be paid overtime only for all regular hours actually worked in excess of 212 hours during the designated 28- day work cycle. Fire inspection personnel assigned to a 40-hour weekly schedule shall be eligible for overtime for all hours actually worked in excess of 40 hours per work week. Section 9. Promotional Process A. Promotional evaluation announcements will be posted in each station at least 30 days prior to the filing deadline. B. Each announcement of a promotional evaluation shall state: 1. The title of the class for which the eligibility list is to be created. 2. The nature of the work to be performed. 19 3. The minimum qualifications which may be required for admission to the evaluation process. 4. The general scope of the evaluation process to be used. C. Eligibility for promotional evaluation processes may be restricted to persons employed in designated lower classes and/or in designated organizational units. D. Disqualification of Applicants The Human Resources Director, on behalf of the City, may reject the application of any person for admission to any evaluation process or refuse to evaluate any applicant or to certify the name of an eligible for appointment if, in his/her opinion, it is found: 1. That the applicant fails to meet the established qualification requirements for the classification. 2. That the application was not filed on or before the closing date for receipt of applications specified in the public announcement. 3. That the applicant has made an intentional false statement as to any material fact, has practiced or attempted to practice deception or fraud in his/her application or in securing eligibility or appointment. This provision shall be interpreted to include the use of any other than the applicant's legal name in making application. 4. That the applicant has a record of previous unsatisfactory service in City employment or elsewhere for the past two years of such a nature as to demonstrate unsuitability for employment in a position of the class for which he/she is applying. 5. That the applicant fails to meet standards for the position that are required by State and/or Federal law or applicable rules under such laws. 6. Any person who, by order of the Human Resources Director, is denied permission to compete in any promotional evaluation process or whose eligibility is canceled under the provisions of this section may make a written appeal to the City Manager for a final decision. E. Scope and Character of Evaluation Processes 1. Provisions applying to promotional evaluation processes: a) All promotional evaluation processes shall be competitive. b) All evaluation processes shall be of such character as to fairly determine the qualifications, fitness and ability of applicants to perform the duties of the classification to which appointment is to be made. c) Evaluation processes may be written, oral, physical or performance, or a combination of these types. They may take into consideration such factors (including experience, education, aptitude, capacity, knowledge, character, physical fitness, and other qualifications) as, in the judgment of the Human Resources Director, enter into the determination of the relative fitness of the applicants and may include inquiry into the moral character, or any other pertinent quality or attribute of the applicant. d) Evaluation processes shall include established criteria for determining a passing grade, score, or mark. 20 F. Notification of Results Each candidate shall be notified in writing of his/her name being placed on the eligible list or his/her failure to attain a place on the list. Any candidate may, within 15 calendar days following the mailing date of his/her notice of results, request permission from the Human Resources Department to review his/her evaluation results, and will be given reasonable opportunity to do so, provided the test is not proprietary. If the test is proprietary, then a summary of his/her results shall be furnished to the applicant upon request, provided such request is made in writing within 15 days after the last section of the examination is administered and the summary is made available by the vendor. Any costs associated with the summary shall be paid one-half by the employee and one-half by the Fire Department. G. Appeals from Ratings 1. Any candidate who fails to attain status on an eligibility list may, within 15 calendar days from the date of notification of such, notify the Human Resources Director in writing that error, other than error of judgment, exists. The Human Resources Director shall thereupon conduct a review. If upon review, errors other than error of judgment, are found, such errors shall be corrected. In the event such review discloses error affecting other candidates, the other candidates shall also be corrected. 2. An error correction may cause names to be added or subtracted from the eligibility list, however no change made in the ratings of any candidate shall be deemed to invalidate or in any way affect any certification or appointment previously made. Section 10. Open and Promotional Eligibility Lists All employees deemed eligible through the evaluation process shall be placed on the appropriate eligibility list for a period of two years from the date of placement on and establishing of such list by the Human Resources Department. The individual dates of initial eligibility shall appear next to the candidates' names and may differ when concurrent eligibility lists exist. The names of all persons who may be lawfully appointed and who have achieved a passing score on the evaluation process shall be placed on the appropriate eligibility list in the order of their final score without regard to the time of their test. The names of two or more eligibles having the same final score will be arranged in alphabetical order. Section 11. Appointments A. In certifying from an external eligibility list for entry hire positions, the Human Resources Department shall certify an open list of all candidates achieving a passing score on the evaluation process. In certifying from an internal eligibility list for the filling of a promotional vacancy, the Human Resources Department shall certify the names of the candidates in the top five score groups at the time of the certification. Selection from an open or promotional list shall be at the sole discretion of the Fire Chief. Selection criteria shall be developed and may include such factors as seniority, experience, education, aptitude, capacity, knowledge, character, physical fitness, and other qualifications. B. Selection criteria shall be announced at least 30 days prior to the selection process. C. Selection processes shall be competitive; shall be of such character as to fairly determine the 21 qualifications, fitness, and ability of applicants to perform the duties of the classification to which appointment is to be made; may be written, oral, physical, performance, or a combination of these types; shall include criteria to determine the relative fitness of applicants; and shall not include questions or evaluations framed to be discriminatory in nature. When skills and qualifications are substantially equal, seniority shall prevail in selection determinations for positions within the bargaining unit. D. The Department shall counsel with any eligible employee who is not selected for promotion upon the written request of the employee. Such counseling shall include an explanation and written summary of the selection criteria whereby improvement may make the employee not selected better qualified. Section 12. Probation A. A newly hired employee or an employee promoted from a class outside the bargaining unit to a class within the bargaining unit shall serve a probationary period of 12 months of active service during which he/she shall have the opportunity to demonstrate to the satisfaction of the Fire Chief his/her suitability for the job. In the event the employee is, for any reason, absent from duty for any reason other than floating holidays or on light duty for an accumulated period equal to two weeks scheduled work hours or more, then all such time shall be added to the probationary period. B. A newly hired employee who, during the probationary period, does not demonstrate suitability for the class, as determined by the Fire Chief, shall be notified in writing of the reason(s) and shall be terminated. An employee promoted from a class outside the bargaining unit to a class within the bargaining unit who, during the probationary period, does not demonstrate suitability for the class as determined by the Fire Chief, shall be returned to his/her position held prior to the promotion or to another position at the same or lower level for which the employee is determined to be qualified, provided there is no cause for dismissal. An employee shall not have access to the grievance procedure regarding the termination during probation. C. An employee promoted or demoted from a class within the bargaining unit to a class within the bargaining unit shall serve a probationary period of six months of active service during which he/she shall have the opportunity to demonstrate to the satisfaction of the Fire Chief his/her suitability for the job. In the event the employee is absent from duty for any reason other than scheduled leave or on light duty for an accumulated period equal to one week scheduled work hours or more, then all such time shall be added to and thereby extend the probationary period. D. An employee promoted from a class within the bargaining unit to a class within the bargaining unit who, during the probationary period, does not demonstrate suitability for the class, as determined by the Fire Chief, shall be notified in writing and shall be demoted to his/her former classification. A promoted employee serving a probationary period within the bargaining unit shall not be entitled to appeal his/her non-successful probationary period and his/her return to his/her former position. Section 13. Light Duty Light duty shall be defined as those activities which an employee can perform which do not require any type of physical activity which may aggravate an existing injury. An employee must be released by the treating physician for light duty and must have approval from Risk Management and the Fire Chief. Employees on either a job-related or non-job-related injury, illness or other medical condition may be assigned to light duty. 22 53/50-hour weekly schedule employees placed on light duty shall continue to be paid their standard biweekly pay in accordance with Article 7, Section 2. All hours actually worked while in a light duty status shall be counted toward overtime at the end of the FLSA cycle in accordance with Article 7, Section 8., D. Employees who are authorized time off while assigned to light duty shall have the number of hours equivalent to the time off deducted from the applicable leave balance. Medical appointments, approved by the Risk Management Department, related to a line of duty injury shall not be deducted from the applicable leave balance. Employees injured on duty who are approved for light duty shall continue to receive Special Teams pay if applicable. For off duty injuries, Special Teams pay shall cease after 90 calendar days of assignment to light duty. 40-hour weekly schedule employees shall maintain their 40-hour schedule while on light duty. All employees on light duty shall have their medical status reviewed periodically as directed by the City to determine whether maximum medical improvement has been achieved and/or the employee is fit to return to full duty. If needed, the City may require a second medical evaluation; and if so required, this shall be done at the City's expense. Light-duty assignments may be limited in number and scope at the sole discretion of the Fire Chief. Section 14. Line-of-Duty Injury Pay The City hereby agrees to pay the following compensation to any employee injured in the line of duty in accordance with the following definitions, terms and conditions. A. Line-of-duty compensation shall be payable under this section only with respect to disability as the result of injury to an employee where such injury is incurred in the line of duty. B. An injury shall be deemed to have been incurred in the line-of-duty if and only if such injury is compensable under the Florida Workers' Compensation Law. C. The amount of line-of-duty compensation paid shall be the amount required to supplement funds received from the Florida Workers' Compensation Law and any other disability or other income plan provided by the City, either by law or by agreement, to the point where the sum of the line-of-duty supplement herein provided and all other payments herein described equal the employee’s regular rate of pay at the time of the injury. D. No line-of-duty compensation under this section shall be allowed for the first seven calendar days of disability (except as provided below); provided, however, that if the injury results in disability of more than 21 calendar days, compensation shall be paid from the commencement of the disability. (It is understood that this paragraph is so stated to be in compliance with current workers' compensation law. Changes in workers' compensation law will modify this paragraph accordingly.) E. The term disability as used in this section means incapacity because of the line-of-duty injury to earn in the same or any other employment the wages which the employee was receiving at the time of injury. F. It is the intent of this section to provide supplemental compensation for line-of-duty injuries only, and this section shall not be construed to provide compensation in the event of death or injury incurred in any manner other than in the line of duty. In the event of any dispute or disagreement concerning the interpretation of the terms of this section, then the decisions concerning definition of those terms issued 23 under the Florida Workers' Compensation Law shall control. G. The City will provide line-of-duty compensation in the amount necessary to supplement funds received from the Florida Workers Compensation Law in order to equal the employee's regular rate of pay with no charge to the employee's accrued paid leave. When an employee with less than three (3) years of service is injured on the job to the extent that such employee misses scheduled work time. The maximum period for which payment may be made under this section shall be 90 calendar days from the date of injury for each injury during the first year of employment, 60 calendar days during the second year of employment, and 30 calendar days during the third year of employment. H. Line-of-duty injury pay will be provided from the first day of injury for those defined in (G) above; however, the amount paid shall be only that amount required to supplement funds received by the employee from the Florida Workers' Compensation Law and any other disability or other income plans provided by the City, to the point where the sum of all payments is equal to the employee's regular base pay rate at the time of injury. At such time as the employee receives his/her initial workers' compensation payment, the City shall approximate the differential needed to equal the employee's base pay and shall provide such line- of-duty injury pay to equal the employee's regular base pay rate at the time of injury. Any adjustment to the City's line-of-duty injury pay under this policy will be made following the employee's return to work or at the expiration of the period for which line-of-duty injury pay is provided. I. Line-of-duty pay shall not be provided from the first day of injury to any employee after the third year of employment. Following the time limits prescribed for the provision of line of duty compensation in paragraph (G) above, employees shall be required to utilize accrued paid leave time to supplement funds received from the Florida Workers Compensation Law in order to maintain a paid status. Employee shall be permitted to utilize accrued paid leave time only in the amount necessary to supplement funds received from the Florida Workers Compensation Law in order to equal the employee's regular rate of pay at the time of the injury. J. It is the intention of the parties that nothing in this Agreement shall interfere with the normal procedures under the Workers' Compensation Laws or the requirements of the City's workers' compensation insurance carrier. Should any language of this Agreement conflict with provisions of the Workers' Compensation Law, the provisions of the Law shall prevail. An employee may choose his/her approved Workers' Compensation treating physician if prior approval is obtained through the Risk Management Division. K. If an employee is killed in the line of duty, the City shall pay to the spouse, or if there is no surviving spouse, the estate, of such deceased employee his/her accumulated severance pay. Within 48 hours of the death of the employee, the City shall deliver to the spouse or surviving children or the employee's dependent beneficiary a check for the sum of one month's current salary of the employee. L. Upon return from working a fire, the employee may request a physical examination by the City physician to ensure the employee is stable and capable of returning to work. This right may be rescinded on an individual basis if repeatedly abused. The City shall have the right to require the employee undergo a physical examination by a physician of its choice prior to receiving or continuing to receive compensation under this Section. M. Failure to immediately report a line-of-duty injury to the employee's immediate supervisor or to the Risk Management Division within 24 hours of the time of occurrence of the injury, shall result in a loss of all line-of-duty pay under this Article unless such failure to report was: (a) caused solely by and as a direct 24 result of the employee's injuries or (b) resulted from the occurrence of an event over which the employee had no control in the opinion of the City Manager. Section 15. EMS Classifications A. The paramedic classifications of Fire Medic and Fire Medic Lieutenant are employees within the City's Fire Department who are appointed by the Department to perform emergency medical services in an emergency medical services program and who have successfully completed and passed a Paramedic training program recognized by the Department and approved by Florida Statute and the Pinellas County Medical Director's office. A Fire Medic is a classification which is responsible for maintaining EMS equipment and performing emergency medical services on an ALS Unit in the area of medical procedures and patient care in addition to any assigned fire suppression duties. B. The City retains the right to hire qualified external applicants into the Fire Medic job classification, or to offer promotional opportunities to qualified existing bargaining unit or other City personnel. Should the City cease to operate emergency medical services, those employees classified as Fire Medic or Fire Medic Lieutenant shall continue to be employed by the City on the same basis as any other employee in the bargaining unit, provided that employees who are demoted shall have their compensation fixed at the same step in the respective range as that which they are assigned in their classification prior to demotion. C. EMS Status 1. All Fire and Rescue Department employees shall be required as a condition of employment to possess and maintain the appropriate EMS certifications in accordance with their respective job description. It shall be each individual employee's responsibility to ensure that all requirements are met to maintain the active status of his/her respective applicable required EMS certification. The Department shall provide opportunities for employees to meet such requirements during work hours, but employees who are unable to take advantage of such opportunities due to absence or operational demands shall not be required to make arrangements for attending to the requirements on their own. The following bargaining unit members shall be exempt from the above requirement to possess and maintain the applicable EMS certifications: Jones, Michael Employees assigned through initial hire or promotion to the classifications of Fire Medic and Fire Medic Lieutenant are required to maintain the appropriate Paramedic certifications as determined by the Department as a condition of continued employment. Depending on the staffing level of Department Paramedic positions and the availability of vacancies in non-Paramedic positions, Fire Medics and Fire Medic Lieutenants may be permitted to voluntarily demote to non-Paramedic positions for which they are determined by the Department to be qualified, with the corresponding reduction in pay in accordance with Article 7, Section 8. Approval of such demotions shall be at the sole discretion of the Fire Chief. If voluntary demotion is not approved by the Fire Chief and there is no other vacant position in the City for which such an employee is deemed by the City to be qualified, the employee may be subject to applicable provisions of the City's policies and procedures, including involuntary demotion or layoff. The City reserves the right to hire into the classification of Fire Medic new employees who possess the appropriate Paramedic certifications, and to require that such certifications be maintained as a condition of continued employment. 25 2. Employees who have their required EMS certifications revoked by the State of Florida or the Office of the Pinellas County Medical Director, and who appeal the action within the established timeframe through the appropriate administrative procedure, shall be maintained as employees in the Clearwater Fire and Rescue Department until a Final Order is rendered by the Division of Administrative Hearings. Said date shall not include any further appellate proceedings by the employee. Such employees who do not take advantage of this appeal procedure, or who do not have their EMS certifications fully reinstated through this procedure, shall be required to find alternate employment within the City or shall be subject to layoff 30 days from the date of the Final Order of the Division of Administrative Hearings, not including any further appellate proceedings by the employee, and shall be placed on the reemployment list for a period of one year from the date of the layoff. The Fire Chief shall have the discretion to not institute layoff based on individual circumstances, and such decisions shall be considered by the parties to be non-precedent setting. The actions of the City pursuant to this Paragraph shall not be subject to the grievance and arbitration/appeal procedure under this Agreement or under the Civil Service Rules. 3. The Fire Department and all bargaining unit members shall comply with Florida Statutes and the Pinellas County EMS Rules and Regulations regarding Quality Assurance and ACLS and BTLS certification. The decisions of the County Medical Director in such matters shall not be subject to the City grievance procedure but shall be addressed through the appropriate appeals procedure. 4. The demotion of an employee required to possess an EMS certification shall not be subject to the contractual grievance procedure or Civil Service appeal procedure when the demotion or removal of pay is based upon loss of EMS certification due to action taken by the office of the Medical Director of Pinellas County or by the State of Florida. 5. The demotion of an employee required to perform EMS services or the removal of Paramedic certification pay shall be subject to the contractual grievance procedure or the Civil Service appeal procedure only if such demotion or removal of pay is the result of a disciplinary action not related to the above referenced loss of EMS certification. 6. The Arbitrator shall not have the power to substitute his/her judgment for that of the Department, the Medical Director, or the State of Florida with whom EMS personnel work in relation to performance of employees to the standards of excellence desired by the City the Medical Director, or the State of Florida. D. The parties agree that Fire Medics and Fire Medic Lieutenants are healthcare professionals but shall not be considered "professional" employees within the meaning of the Florida Public Employees Relations Act. E. If the application of this Article, or any part thereof, whether or not relating to pay, is superseded by action of a superior governmental agency, then the City will be absolved of complying with this Agreement to the extent of the conflict. Section 16. Firefighter/Driver-Operator A. Classification The classification of Firefighter/Driver-Operator shall be for those employees within the Fire Department who are the drivers and operators of the following type vehicles: Fire Engines, Aerial Apparatus (including operation of the tiller), and Squad. 26 B. Appointments All Firefighter/Driver-Operator positions shall be filled by a competitive eligibility and selection process. All employees who successfully complete the eligibility determination process shall be eligible for consideration in the selection process. The minimum qualifications shall be in accordance with the respective City job description. C. Wages All employees assigned as driver shall have at least 4 years on the department and shall receive pay in accordance with Appendix A. Section 17. Work Rules and Prevailing Rights A. It is understood and agreed by both parties that the duties performed by members of the bargaining unit cannot always be covered by job descriptions and, therefore, members of the bargaining unit may be required to perform duties in addition to all those listed within the current job descriptions which are, in the judgment of the City, related to the purposes of the Fire Department, which judgment shall not be arbitrary, capricious or unreasonable. B. Any Fire Department Rule or Regulation in conflict with this Agreement shall be of no force and effect. C. Prior to the implementation of any changes in the existing Fire Department Rules and Regulations, the Fire Chief must provide twenty calendar days notice for the Union to identify any bargaining as required in accordance with Florida Statutes, Chapter 447. If requested by the Union, the change will be referred to the next Labor/Management Committee meeting, which shall be scheduled within 14 calendar days to meet and discuss such change. If the Union provides no response, the rule will be implemented after the initial twenty day notice unless the time is extended by the Chief. The issue of whether such change conflicts with this Agreement shall be subject to the grievance procedure contained herein. The time for filing said grievance shall commence on the date the rule is implemented. D. All rights and working conditions, enjoyed throughout the Department by the employees at the present time which are not included in this Agreement shall be presumed to be reasonable and proper and shall not be changed by the City in an arbitrary or capricious manner; provided that nothing contained herein shall limit the City's rights under Paragraphs A, B and C of this Section or as expressly provided elsewhere in this contract or by law. Section 18. Subcontracting During the term of this Agreement, the City shall not subcontract out to private concerns any fire suppression, Emergency Medical Service and rescue services of the Department. Any action of the state of Florida or Pinellas County to assume control of any basic fire suppression, Emergency Medical Service or rescue services shall not be deemed subcontracting. Section 19. Indemnification The City agrees to defend any employee when the employee is sued on any claim arising out of his/her employment with the City and acting within the scope of his/her duties. The employee agrees to cooperate in 27 his/her defense. The City also agrees to pay any judgment rendered against an employee for acts committed when the employee is acting within the scope of his/her City employment, provided that the employee did not act intentionally, with malice, or with gross negligence. Section 20. Sports Participation in sporting activities while on duty shall be permitted in accordance with Fire Department SOP/SDP. Section 21. Lawn Maintenance Employees covered by the contract shall not be required to perform lawn maintenance at the fire stations. Section 22. Physical Examination A. Employees covered by this labor agreement shall be required to undergo an annual physical examination. B. The employer shall bear the cost of each examination. Additionally, 53/50 hour schedule employees shall be provided an allowance for attending the physical during off-duty hours. The City agrees 40 hour schedule employees may attend their physical during on-duty hours with no loss of pay. The results of these physicals shall be made available to the City and to each employee upon completion of the physical and shall be maintained as confidential medical records in accordance with law. Physicals shall include but not necessarily be limited to the following: 1. 12 Lead EKG 2. SMA Profile 12 (liver, blood sugar, etc.) 3. Chest X-Ray – (as required) 4. Complete Blood Count 5. Urinalysis 6. Rectal Cancer Exam (optional for employee) 7. Doctor's Physical (eyesight, reflexes, hearing, throat, etc.) 8. Breast/Cervical Cancer Exam (Females- optional for employee) 9. Audiometric Evaluation 10. Spirometry (Pulmonary Function) 11. Titers for Hepatitis A and B C. The City agrees to pay all expenses for inoculation or immunization shots for employees and members of an employee's family residing in his/her household when such becomes necessary as a result of said employee's exposure to contagious disease where said employee had been exposed to said disease in the line of duty; provided that the employee first makes all reasonable efforts to have this service performed at no cost by the County Health Department. The City further agrees to reimburse the co-pay cost for any preventive inoculation or immunization shots an employee may receive from his/her City primary care physician. D. The parties agree that the physical condition of the employee is of great concern to the employee and to the 28 City. All employees whose physical fitness or medical status is deemed deficient in some manner as a result of the physical examination shall be advised by the Department and shall be encouraged to undertake a fitness rehabilitation program in an effort to improve their physical fitness and health. The City shall provide free access for all bargaining unit members, and family members who are currently enrolled on the City’s health insurance plans, to any City recreational facility. Additional fees for programs conducted at such facilities shall be borne by the employee. It is understood by all parties that the decision whether to use such facilities is entirely voluntary on the part of the bargaining unit members, and time spent using such facilities shall neither be paid nor will any accidents or injuries incurred while utilizing such facilities be compensable under workers compensation. E. The City agrees to contract with a licensed physician who shall be selected by the City and agreed to by the Union to act as a Department Physician whose duties shall be to advise the employees and the department in matters concerning the health of the employees. F. The City and Union agree that based upon a mutual agreement of the parties, this Article may be reopened for the purpose of negotiating a Wellness provision only. If the Article is reopened for such purpose and the parties are not able to reach an agreement, the item shall not be subject to the impasse procedure and the Article shall remain status quo in whole and part. Section 23. Employee Fitness & Wellness Incentive 1. During contract year 1 (October 1, 2024 – September 30, 2025) and contract year 2 (October 1, 2025 – September 30, 2026) each fiscal year, employees will have the opportunity to earn wellness incentive leave hours for maintaining physical fitness and wellness standards as set forth in departmental policy. This program is voluntary. 2. Employees performing the Fitness & Wellness Assessment shall be covered under workers compensation. 3. The Fitness & Wellness Assessment will consist of two parts: Work Performance Assessment and Injury Resistance Assessment. Each assessment will be worth a maximum of twelve (12) hours for 53-hour employees or four (4) hours for 40-hour employees. This wellness incentive leave may be used in four (4) hour increments subject to the provisions set forth in Article 8, Section 2(B). 4. Scores within the fiftieth (50th) percentile or above will receive wellness incentive leave hours according to the schedule below: 53-hour Employee Incentive Value Percentile Range Reward Value 90-100 24-hours 80-90 20-hours 70-80 16-hours 60-70 12-hours 50-60 8-hours 29 40-hour Employee Incentive Value Percentile Range Reward Value 90-100 8-hours 80-90 7-hours 70-80 6-hours 60-70 4-hours 50-60 2-hours Effective October 1, 2026 and thereafter, employees will no longer be allowed to participate and earn incentive leave hours in this Employee Fitness & Wellness Incentive. Section 24. Residency Requirement All bargaining unit members shall be required to maintain residence within the geographical boundaries of Pinellas, Hillsborough, Pasco, Manatee, and Hernando Counties. This requirement shall continue during their tenure in any position within the fire service of the City of Clearwater. Section 25. Tobacco Product Usage No smoking or use of tobacco on or off the job shall be permitted for any bargaining unit member as a condition of employment and their continued employment within the fire service. Violation of this provision shall be deemed just cause of disciplinary action by the City, up to and including dismissal. ARTICLE 8 LEAVES OF ABSENCE Section 1. Holidays A. The following holidays shall be observed: New Year’s Day Veteran’s Day Martin Luther King Day Thanksgiving Day Memorial Day Day after Thanksgiving Day Juneteenth Day Christmas Day Independence Day Labor Day Holiday pay for the above listed holidays will be paid at the employee's current base rate of pay for the number of hours equaling 10% of the biweekly schedule, except that the following three special holidays will be compensated at the employee's current base rate of pay for the number of hours equaling 15% of the biweekly schedule: Christmas Day, Thanksgiving Day, and New Year's Day. 40-hour per week schedule fire inspection personnel shall not work on designated holidays unless directed to do so by the Fire Marshal or his/her designee. Fire prevention inspection personnel who are required to work on a designated holiday shall receive time-and-one-half their regular pay for all hours actually worked or 4 hours minimum, whichever is greater, on the holiday in addition to the holiday pay described above. When 30 a City-observed holiday falls on a Saturday, the preceding Friday shall be the designated holiday for fire prevention inspection personnel. When a City-observed holiday falls on a Sunday, the following Monday shall be the designated holiday for fire prevention inspection personnel. Designated holidays which fall on a fire prevention inspection employee's regularly scheduled work day shall count as hours actually worked for the purpose of calculating overtime. B. In addition to the holidays listed in Section 1, each employee may receive up to four additional "floating holidays". Effective January 1, 2027, 50-hour employees will only receive up to two “floating holidays.” Floating holidays shall be awarded at the beginning of each payroll calendar year, subject to the restrictions below. For such floating holidays the employee shall receive his/her regular rate of pay for such day if he/she does not work that day, but shall not receive additional compensation. Any day for which an employee is not scheduled to work may not be designated as a floating holiday. Floating holidays shall be subject to the following requirements and conditions: 1. No employee may utilize floating holidays until 30 calendar days after the date of hire. 2. Any person employed between January 1 and March 31 shall receive 100% of floating holidays to be utilized during the year of hire; any person employed between April 1 and June 30 shall receive 75% of floating holidays to be utilized during the year of hire; any person employed between July 1 and September 30 shall receive 50% of floating holidays to be utilized during the year of hire; and any persons employed between October 1 and October 31 shall receive 25% of floating holiday to be utilized during the year of hire. Persons employed after October 31 shall not be eligible for any floating holidays during the year of hire. Effective January 1, 2027, any 50-hour person employed between January 1 and June 30 shall receive 100% of floating holidays to be utilized during the year of hire, and any 50-hour person employed after July 1 shall receive 50% of floating holidays to be utilized during the year of hire. 3. Floating holidays may not be carried over from one payroll calendar year to another payroll calendar year and if not taken are forfeited except as provided in Paragraph D of this Section. 4. After the year of hire, employees shall receive four "floating holidays" each calendar payroll year. Effective January 1, 2027, 50-hour employees will only receive two “floating holidays” each payroll calendar year. 5. Upon an employee's separation from the City, the employee may receive a lump sum payment for any remaining floating holiday balance per Paragraph D of this Section, or the remaining floating holiday balance may be used to advance the employee's date of retirement. C. Floating holidays will be selected in reverse seniority after all vacation days and longevity days have been scheduled. It is not necessary for an employee to schedule his/her floating holidays during the vacation selection process. Any employee selecting floating holidays after the vacation selection process will give the Department 48 hours' notice in writing of his/her request. This notice will be given to the Fire District Commander for approval based on vacation selection criteria. This permission shall not be arbitrarily withheld. In case more than one employee requests a particular day and the Department determines that both employees may not be off duty on that particular day, the senior employee shall be given preference. D. If the employee chooses not to take one or more floating holidays, he/she may make a written request to the Fire Chief on or before November 15th to receive 24 hours of regular pay for 53/50-hour week, or 8.0 hours of regular pay for 40-hour week in lieu thereof payable in the payroll period which includes December 1st. Any floaters not taken or requested for payment are forfeited. No more than four floating holidays shall be 31 approved for payment each year. E. Each payroll calendar year, members of the bargaining unit may elect to take one floating holiday as "Personal Leave Time." This personal leave day may be broken into blocks of 4 hours and will be taken in 4-hour increments. Personal Leave Time will be selected after all vacation days, extra vacation days and floating holidays have been scheduled. Any employee selecting Personal Leave Time after the vacation selection process will give the Department 48 hours' notice in writing of his/her request. All requests for Personal Leave Time must comply with all the criteria pertaining to the vacation selection process. If an employee chooses not to use all blocks of Personal Leave Time, he/she may make a written request to the Fire Chief on or before November 15th to receive pay for such remaining blocks, payable in the subsequent payroll period which includes December 1st. Section 2. Vacations A. Accrual of Vacation Leave 1. Vacation leave shall be granted for all full-time employees in accordance with the number of completed years of credited service. A full-time employee shall be deemed to have earned and be eligible for vacation on the first anniversary of his/her employment. For newly hired employees, such vacation shall be prorated for the year of hire according to the following schedule: 53/50-Hour Weekly Schedule Employees January/February Hire Date.................................................................. 6 Duty Days March/April Hire Date .......................................................................... 5 Duty Days May/June Hire Date .............................................................................. 4 Duty Days July/August Hire Date........................................................................... 3 Duty Days September/October Hire Date............................................................... 2 Duty Days November/December Hire Date ............................................................. 1 Duty Day 40-Hour Weekly Schedule Employees January/February Hire Date ........................................................................ 80 Hours March/April Hire Date ................................................................................ 64 Hours May/June Hire Date ....................................................................................48 Hours July/August Hire Date................................................................................. 32 Hours September/October Hire Date.....................................................................24 Hours November/December Hire Date ................................................................. 16 Hours Effective in the 2023 payroll calendar year and thereafter, employees shall be deemed to have earned and be eligible for vacation accrual at the beginning of each payroll calendar year. As such, employees on the 50/53-hour weekly schedule shall accrue paid vacation as follows: Year 1 1 year anniversary of Hire Pro-rated Days Year 2 January following 1 year anniversary of Hire 6 Duty Days Year 3 Following January 6 Duty Days Year 4 Following January 7 Duty Days 32 Year 5 Following January 7 Duty Days Year 6 Following January 7 Duty Days Year 7 Following January 8 Duty Days Year 8 Following January 8 Duty Days Year 9 Following January 8 Duty Days Year 10 Following January 8 Duty Days Year 11 Following January 9 Duty Days Year 12 Following January 9 Duty Days Year 13 Following January 9 Duty Days Year 14 Following January 9 Duty Days Year 15 Following January 10 Duty Days Year 16 Following January 10 Duty Days Year 17 Following January 10 Duty Days Year 18 Following January 11 Duty Days Year 25 and higher Following January Thereafter 12 Duty Days Years of Service Days 1 (First Anniversary) Pro-rated / up to 6 Days 2-3 6 Days 4-6 7 Days 7-10 8 Days 11-14 9 Days 15-17 10 Days 18-24 11 Days 25 and higher 12 Days Employees on the 40-hour weekly schedule shall accrue paid vacation as follows: Year 1 1 year anniversary of Hire Pro-rated Days Year 2 January following 1 year anniversary of Hire 80 hours Year 3 Following January 88 hours Year 4 Following January 96 hours Year 5 Following January 104 hours Year 6 Following January 112 hours Year 7 Following January 120 hours Year 8 Following January 128 hours Year 9 Following January 128 hours Year 10 Following January 128 hours Year 11 Following January 136 hours Year 12 Following January 144 hours Year 13 Following January 152 hours Year 14 Following January 152 hours Year 15 Following January 152 hours Year 16 and higher Following January Thereafter 160 hours 32 Years of Service Hours 1 (First anniversary) Pro-rate / up to 80 Hours 2 80 Hours 3 88 Hours 4 96 Hours 5 104 Hours 6 112 Hours 7 120 Hours 8-10 128 Hours 11 136 Hours 12 144 Hours 13-15 152 Hours 16 and higher 160 Hours 2. Effective in 2023 and thereafter, the vacation year shall be the payroll calendar year. 3. Effective in the 2023 and 2024 2025 payroll calendar years and thereafter, 53/50-hour employees who have used at least seventy-two (72) vacation hours may receive up to seventy-two (72) hours of vacation stipend in exchange for the same number of vacation hours. The employee must maintain a minimum of one hundred twenty (120) hours in their vacation bank after the exchange. The employee must not have received any formal discipline during that payroll calendar year and must have received at least Meet Standards on the most recent annual evaluation. The employee may elect to make one written request per payroll calendar year to the Payroll Preparer. Written requests must be turned into Finance Payroll on or before the second pay period end date in November. The vacation stipend will only be paid in the first paycheck in December of that payroll calendar year. on or before November 15 to receive the seventy- two (72) hours of vacation stipend by the payroll period which includes December 1 of that payroll calendar year. Vacation hours sold will be paid out as pensionable earnings, at the employee’s hourly base rate exclusive of any premium or shift assignment pay in effect at the end of the payroll period following the date this form is provided to the department. Contribution requests will be irrevocable. Effective in 2023 and 2024 the 2025 payroll calendar years and thereafter, 40-hr employees who have used at least twenty-four (24) vacation hours may receive up to twenty-four hours of vacation stipend in exchange for the same number of vacation hours. The employee must maintain a minimum of eighty-six (86) hours in their vacation bank after the exchange. The employee must not have received any formal discipline during that payroll calendar year and must have received at least Meet Standards on the most recent annual evaluation. The employee may elect to make one written request per payroll calendar year to the Payroll Preparer. Written requests must be turned into Finance Payroll on or before the second pay period end date in November. The vacation stipend will only be paid in the first paycheck in December of that payroll calendar year. on or before November 15 to receive the twenty-four (24) hours of vacation stipend by the payroll period which includes December 1 of that payroll calendar year. Vacation hours sold will be paid out as pensionable earnings, at the employee’s hourly base rate exclusive of any premium or shift assignment pay in effect at the end of the payroll period following the date this form is provided to the department. Contribution requests will be irrevocable. 4. All unused vacation balances will be added to the employee’s vacation bank and will not exceed 264 hours for 53/50-hour schedule employees and 180 hours for 40-hour schedule employees, at the end of the payroll calendar year. are forfeited at the end of the calendar year, except as determined by the Fire Chief. 33 B. Use of Vacation Leave 1. The use of vacation leave shall be authorized in accordance with Fire Department Regulations. Vacation leave shall be utilized in full day increments only, except when operational demands require an employee to work part of a day for which vacation leave has been previously approved. For 53/50-hour schedule employees, a maximum of seven employees shall be permitted to be absent from any shift for the purpose of personal leave including vacation and floating holidays. For 40- hour schedule employees, including Fire Prevention Inspectors and 53/50-hour schedule employees provided with Light Duty assignments, the Department shall determine the number of employees who may be permitted leave use in accordance with operational demands. 53/50-hour schedule employees who are provided a 40-hour Light Duty schedule shall not be denied the use of previously approved vacation leave, provided they notify the Fire Chief prior to the beginning of the Light Duty assignment of their intent to utilize the previously approved vacation leave. However, should such employees elect to not utilize previously approved vacation leave while on the 40-hour schedule, they shall be responsible for the subsequent scheduling of the days within the available slots or will risk losing the days. The Fire Chief may approve vacation leave for less than 24-hour increments for employees with approved Family Medical Leave Act (FMLA) paperwork on file. The need for time off must be for an approved FMLA need. 2. The borrowing of vacation time prior to its accrual is prohibited. 3. There is no advancing of vacation pay. 4. New employees may not take vacation until they have completed one year of continuous service. 5. If a holiday occurs during vacation leave, the employee will be paid holiday pay. 6. An employee who has more than 90 calendar days of unpaid leave, shall receive no vacation leave for that payroll calendar year. 7. Scheduling of Vacation a) Bargaining unit members will be contacted in the order of department seniority for the selection of vacation. Vacation days may be picked in either a 3- or 6- duty day block for 53/50- hour schedule personnel or a 5- or 10- duty day block for 40-hour schedule personnel the first time through. A block, as published on the vacation schedule issued by the Department, shall consist of a designated 3 or 6 duty day grouping beginning and ending with 4 days off for 53/50-hour schedule personnel, or a designated 5 or 10 duty day grouping beginning and ending with a weekend for 40-hour schedule personnel. When a Kelly Day occurs within a duty block selected for vacation by a 53/50-hour schedule employee, vacation leave will only be charged for the actual duty days and not for the Kelly Day. After all personnel have been contacted for their first pick, the second round will begin. All 53/50-hour schedule personnel who have selected a 3-day block and all 40-hour schedule personnel who have selected a 5-day block on the first round will be recontacted in the order of department seniority for their second selection on the second round. 34 b) After all personnel have been provided the opportunity to pick their primary six or ten days of vacation in blocks, employees will be permitted to submit requests to use any bonus days for 25 years of service, floating holidays, and sick leave incentive days. All personnel will be contacted by reverse seniority for the choosing of bonus days, floating holidays and sick leave incentive days. c) Should employees elect to pass on choosing any days during the vacation selection process above, they shall be responsible for the scheduling of their remaining days, which may be selected in 24- hour increments. 48-hours notice shall be required for the request to utilize such days, however the Fire Chief or his/her designee shall have the sole discretion to approve such requests if practicable when provided with less than 48 hours notice. If the employee waits too long and there are no available slots left, they will risk losing the days. Floating holidays may be submitted for pay in accordance with this Agreement. Additional vacation days will be lost or can be donated to the Department leave pool. However, no employee shall be permitted to donate more than three days of leave per year to the pool. d) All vacation days not submitted are subject to forfeit in accordance with the above except by permission of the Fire Chief. e) The linking of scheduled days for 53/50-hour schedule personnel shall not exceed 9 consecutive duty days, except by special permission of the Fire Chief. If more than 9 days are linked, the employee shall be responsible for any training required to maintain certification that is missed during the scheduled time off. The Department will make every effort to schedule this training while the employee is on duty. If this cannot be done, then it is the employee's responsibility to complete the required training on his/her own time. f) The changing of sick leave incentive days for previously used floating holidays is not allowed. g) When an employee is assigned to a different shift or changes job classification after their his/her vacation selection has been completed and approved by the Department, the employee may request to maintain the previously selected vacation or may request alternate vacation days instead. The Department will attempt to accommodate such requests as staffing levels and operational requirements permit. h) Should any previously chosen vacation days associated with or adjacent to designated City holidays or any additional days designated by the Union at the initial vacation selection period become available due to personnel shift changes, Light duty assignments of personnel, or forfeiture of previously scheduled days, the Union shall be responsible for re-assigning the available days. Re- assignment shall be in accordance with Department standards for staffing and leave. The union shall designate one person per shift as the contact person for the re-assignment of vacation days and who shall be responsible for forwarding the information to the Fire District Commander for scheduling. C. Payment and Accrual During Military Leave 1. An employee granted an extended military leave of absence in accordance with the City Emergency Military Leave Policy shall be permitted to be paid any portion or all of his/her accrued vacation leave when the employee begins the extended military leave. 2. An employee returning from an extended military leave of absence shall accrue vacation leave as provided by law. 35 D. Conversion To Sick Leave or Funeral Leave During Vacation Leave 1. The employee may request that vacation leave be changed to sick leave if the employee or member of the employee's immediate family becomes ill while the employee is on vacation leave. 2. The employee may request that vacation leave be changed to funeral leave provided the request is consistent with the article on Funeral Leave. 3. Requests for such changes must be made in writing to the Fire Chief or designee within 72 hours of the employee's return to work. E. Payment of Unused Vacation Leave 1. Payment of unused vacation leave and banked vacation hours will be paid at the employee's current base rate of pay upon separation of the employee, provided the employee has more than one year of continuous service, or such hours may be utilized to advance the date of retirement. 2. When a bargaining unit member is required to work a partial day on any day that he/she has previously been approved for vacation leave, the employee's vacation leave balance shall not be charged for the hours worked and such hours worked shall be paid at the overtime rate of pay but shall not be subject to the minimum hours assigned to holdover or call back in accordance with this Agreement. Should the number of vacation hours not charged due to such circumstances equal twelve hours or more, the employee shall be permitted to request to use the portion of such hours equaling a twelve-hour block in accordance with Paragraph B.,7. above. The employee shall be permitted at the end of the calendar year to request payment for any remaining balance of less than twelve vacation hours not charged due to having worked a partial day, in accordance with the established provision for the payment of floating holidays as outlined in this Agreement. F. Banking of Vacation 1. The practice of banking vacation for retirement shall be limited to 264 240 hours for 53/50-hour schedule employees and 180 172 hours for 40-hour schedule employees. Section 3. Sick Leave A. Accrual Rate 1. Members of the bargaining unit shall accrue sick leave in accordance with the schedule below: Biweekly Hours Total Hours Accrual Rate Per Pay Hours Capped 106/100 144 134.42 5.538 5.170 2184.00 80 96.01 3.696 1560.00 2. The number of yearly pay periods sick leave is accrued is 26. B. Sick leave may be accumulated for each of the 26 accrual pay periods the employee actually works, up to a maximum as shown above. Actual work includes periods when the employee is using accumulated sick leave (but not sick leave pool), holidays, vacation with pay, and the no- loss-of-pay sick time. Employees shall not accrue sick leave during any other period of time when they are in a non-paid status or utilizing "retirement advancement". 36 C. All accumulated unused sick leave shall be credited to any employee recalled from a lay off, transferred, or certified to another department or classification without break in service, appointed from a reemployment list or returning from a leave of absence. If the employee is promoted, demoted or transferred to another City position with a different Scheduled Pay Period Hours other than that defined above, that employee's sick leave balance will be adjusted to reflect equivalent days of sick leave earned, consistent with his/her new scheduled pay period hours. D. In the event an employee has been separated and paid for accumulated unused sick leave as hereinafter provided or has been dismissed for cause and subsequently is re-employed by the City, his/her subsequent sick leave accumulations shall be calculated as a new employee. E. Under the provisions of this section, an employee may utilize his/her sick leave for absences from duty resulting from illness or injury to the employee or a family member on any of his/her regularly scheduled work days for the number of regular hours he/she would otherwise have been scheduled to work on that day had not such absence occurred. Absence for a fraction of a day that is chargeable to sick leave in accordance with these provisions shall be charged by rounding to tenths of an hour according to the following: Minutes Tenths of an Hour 1 - 6 .1 7 -12 .2 13 -18 .3 19 - 24 .4 25 -30 .5 31 – 36 .6 37 -42 .7 43 – 48 .8 49- 54 .9 55 - 60 1.0 F. Sick leave shall not be considered a privilege to be used at the employee's discretion, but shall be used only for absences: 1. Due to personal illness or physical incapacity caused by factors over which the employee has no reasonable immediate control. 2. Necessitated by exposure to contagious disease in which the health of others would be endangered by his/her attendance on duty. 3. Due to medical or dental appointments, or other personal sickness prevention measures, the scheduling of which at times other than during his/her regular working hours is impossible or unreasonable. 4. Due to illness of a member of his/her immediate family which requires his/her personal care and attention. The term "Immediate Family" as used in this paragraph shall be limited to spouse or domestic partner of record, as defined in accordance with criteria, policies, and procedures determined by the City, or the employee’s or employee’s spouse’s or domestic partner’s child, parent, foster-child(ren), minor-guardianship(s), brother, sister, grandparent, grandchild, great-grandchild, stepparent, or stepchild, domestic. Employees may be required to produce legal justification for Foster Child(ren)/Minor Guardianship(s). 37 Sick leave will be accrued on a biweekly basis based on hours in a paid status. An employee may utilize his/her accumulated sick time due to an illness in his/her immediate family (as that term is defined above). 5. If an employee is under a doctor's care or if a member of the employee's immediate family is under a doctor's care and the doctor certifies that the employee's personal care and/or attention is required, said time of absence shall not be considered as grounds for any discipline, provided that personal sick leave is not used in excess of accumulated sick leave. G. An employee absent for one of the reasons mentioned above shall inform his/her immediate supervisor as early as possible on the first day of absence. Failure to do so may be the cause for denial of sick leave with pay for the period of absence. In any event, the Departmental Rules shall govern the notification requirements. H. Payment for Unused Sick Leave Upon separation from City service, an employee shall be paid one-half of his/her accumulated unused sick leave. The rate of payment shall be based on the regular hourly rate (excluding shift differential or any other addition to base pay) of the employee on the last day worked prior to separation. The employee qualifies for payment if: 1. The employee has had at least 20 years of continuous service with the City. Leaves of absence without pay, suspensions and layoffs followed by subsequent re-employment shall not be considered as breaks in service. The length of such time off or layoff shall be deducted from the total length of service. Military leaves and leaves during which the employees are receiving Workers' Compensation shall not be deducted from continuous service; or 2. The separation is involuntary on the part of the employee including disability (incurred on or off the job) and layoffs; or 3. The employee's estate shall receive payment if an employee dies. An employee who has been dismissed for cause or who resigns voluntarily shall have no claim for sick leave payment. An employee who may otherwise be eligible for retirement under the City Employees' Pension Plan or Federal Social Security, or who may be approaching such eligibility date, and whose purpose in leaving is to retire under either program, may utilize one-half of his/her accumulated unused sick leave to the extent thereof to advance his/her retirement date. In that event, the employee shall execute a resignation to become effective on the date that such accumulated unused sick leave would be exhausted. Such resignation shall be irrevocable, and retirement shall begin at the time such resignation becomes effective. In the interim, payment for accumulated unused sick leave shall be made as a continuation of the employee's regular pay from which all regular payroll deductions shall be made in order to preserve his/her retirement status. Accumulated unused sick leave will be charged as outlined in paragraph (1) of this subsection. I. An employee may not utilize his/her accumulated sick leave absence for absences resulting from an injury arising out of and in the course of employment, other than City employment, for which monetary or other valuable consideration is received or expected. Any employee who utilizes accumulated sick leave, or who attempts to utilize accumulated sick leave, for absences resulting from an injury arising out of and in the 38 course of employment, other than City employment, may be terminated or suspended, as in the City's judgment, is appropriate. J. Except in the cases of injury incurred in the line of duty with the City, employees shall not be entitled to use sick leave until the completion of six calendar months of continuous service following the date of original appointment. K. The employee may be required to submit evidence "in the form of a medical certificate, of the adequacy of the reasons for his/her absence during the period of time for which sick leave is granted when requested by the Department Director. L. An on-duty employee injured in an accident, arising out of and in the course of his/her City employment, may elect to be continued on the payroll to the extent of his/her accumulated unused sick leave as hereinafter provided. An employee receiving sick leave with pay under the provisions of this subsection who simultaneously receives income under the Workers' Compensation Act shall receive, for the duration of such income and to the extent of his/her accumulated unused sick leave, only that portion of his/her regular rate of pay (see Article 9, Section 4) which will, together with said income equal his/her regular rate of pay at the time of injury. In that event, the employee's accumulated unused sick leave shall be charged only in the same proportion as his/her sick leave payment is to his/her regular biweekly salary which shall be deemed to be that same proportion of the number of regular hours he/she would otherwise have been scheduled to work for the day, week or other period involved, rounded out to the nearest tenth of an hour. M. The use of sick leave for purposes other than those designated herein will be considered a major rule infraction. N. Sick Leave Incentive Program 1. Following any full payroll calendar year period that a bargaining unit employee uses no sick leave, the employee will be allowed to convert two days of sick leave to Sick Leave Incentive Days or the cash equivalent based upon the employee's current base hourly rate of pay. 2. Following any full payroll calendar year that a bargaining unit employee uses between one-tenth of an hour and the equivalent of two days of sick leave the employee will be allowed to convert one day of sick leave to a Sick Leave Incentive Day or the cash equivalent based upon the employee's current base rate of pay. 3. Employees shall be required to submit notice of their choice of the above within 30 days of Sick Leave Incentive eligibility notification or shall have no sick days converted. 0. Sick Leave Pool A joint leave pool will be established by members of the International Association of Fire Fighters bargaining unit, such leave pool to be available for use by members subject to the following provisions: 1. The purpose of the leave pool is to provide leave to bargaining unit members who face significant time off without pay due to a serious illness or injury, whether job-connected or non-job-connected, or serious illness or injury to a family member covered under the family sick leave policy. The leave pool may not be used for short time periods where an employee may be without pay. Short time shall be defined as less than 30 calendar days. 39 2. A committee shall be formed and the committee shall determine use of the leave pool days, subject to the above purpose and limitations. a) The committee shall consist of three members designated by the bargaining unit, one management employee designated by the Fire Chief, and one management designee of the City Manager. b) The committee shall review employee needs and circumstances consistent with the provisions of the leave pool and shall determine eligibility for and the amount of pool leave time that may be provided to employees. The committee may establish procedures, forms, and other rules necessary for its effective operation, provided they are consistent with the provisions of this section. c) The committee's decisions are final and are not grievable. 3. Bargaining unit members may donate days from their vacation, floating holiday, or sick leave balances to the leave pool one time per year in January. a) No employee shall be permitted to donate more than three days of leave per year to the pool. In the event that the leave pool becomes insufficient to provide leave days, the committee may, with the prior approval of the City Manager or designee, open up the opportunity for additional donations to be made during the calendar year. This shall be limited to one time per year; however, the 3-day donation limit shall not be modified. b) All donations of pool leave time must be in full-day increments based on the employee's full-time regularly scheduled day (i.e. an 8-hour or 24-hour day is a full day). c) Donations of pool leave time are irrevocable. d) No dollar value shall be placed on leave donations. All donations and all authorized usage shall be computed as day for day. 4. When pool leave time is authorized by the committee for use by an employee, it shall be on a day-for- day basis, irrespective of whether the employee works an 8-hour or 24-hour shift. An employee using leave pool time shall receive regular base pay and his/her regular shift pay; however, other pays shall not be provided with leave pool days (e.g., lead pay, acting pay, special assignment pay, etc.). 5. Pool leave time not used in a given year by the employee receiving the donated pool leave time shall be returned to the leave pool and carried over to the next year. No donated pool leave time will be refunded to the donor. Section 4. Funeral Leave A. 53/50-hour schedule employees shall be allowed up to three (3) consecutive shifts off with pay and 40 hour schedule employees shall be allowed up to four (4) consecutive duty days off with pay in the event of a death in the immediate family which shall be limited to spouse or domestic partner of record, as defined in accordance with criteria, policies, and procedures determined by the City, or the employee's or employee's spouse's or domestic partner’s child, parent, foster-child(ren), minor-guardianship(s), brother, sister, grandparent, grandchild, great-grandchild, stepparent, or stepchild. This is not chargeable to sick leave. Employees may be required to produce legal justification for foster Child(ren)/Minor Guardianship. B. 53/50-hour schedule employees shall be allowed up to two (2) consecutive shifts and 40- hour schedule 40 employees shall be allowed up to three (3) consecutive duty days in the event of a death of a member of the “Close” family chargeable to sick leave. “Close” family shall be defined as the following family members: step-brother, step-sister, brother’s wife, sister’s husband, uncle, aunt, nephew, niece, or other member of the employee’s immediate household. C. Additional time off may be granted by the Fire Chief, or their his/her designee and shall be chargeable to sick leave. Furthermore, any employee availing himself/herself of a provision in this section must notify the Fire Chief or their his/her Fire District Commander of such intent as soon as possible. Section 5. Absence Without Leave A. Any employee who is absent from duty for two consecutive work days for 53/50-hour schedule employees and three consecutive work days for 40-hour schedule employees without notice and valid reason therefore shall be deemed to have voluntarily terminated his/her City employment and to have vacated his/her position and will be separated from the payroll as a dismissal unless a leave of absence is subsequently granted under any of these rules. B. The failure of an employee to report for duty at the expiration of a leave of absence or vacation leave with or without pay, shall be deemed an absence without leave. Section 6. Time Off From Duty A. An employee may be granted necessary time-off from his/her duties with compensation for any of the following reasons, when such time off does not, in the judgment of the Fire Chief, interfere with the operation of the Department. 1. Attendance at professional or other conventions, institutes, courses, classes, seminars or meetings when such attendance is approved in advance by the Fire Chief or his/her designee. Attendance will be at the discretion of the Fire Chief except when the requested leave is for promotional exams which will get first priority. 2. Attendance at in-service training and other in-service meetings when approved by the Fire Chief or his/her designee. The provisions of this paragraph shall be deemed to include authorized safety meetings. 3. The President, Secretary-Treasurer, or designee of the Union shall be granted Union time-off to attend state and international conventions, provided a minimum of one month's written notice is given to the Fire Chief. B. The Union may, upon request, be allowed up to 400 duty hours per fiscal year to be excused for Union business, conferences, training, and Executive Board meetings pertaining to the City of Clearwater. Any such request must be initiated in writing to the Fire Chief or designee, and will give the name of the person wanting off, date the person is to be off, and the number of hours the person will be off. Time off from duty under this provision must be approved by the Fire Chief or his/her designee and must be taken in not less than four-hour increments. Absences for Union time excluding the Union president/designee shall count toward the total number of seven employees permitted to be absent for personal leave on any given shift. Any unused portion of the balance is to be carried over into the next contract year. Any use of City facilities for Union-related business shall require written request at least 48 hours in advance to the Fire Chief, which may be granted or denied at his/her sole discretion. Executive Board 41 members only shall be permitted to conduct/attend Executive Board meetings while on duty with no charge to the aforementioned Union time, with the prior approval of the Fire Chief or his/her designee, provided 48 hours notice is given, and further provided that such meetings will cause no adverse impact to Department operations. Off-duty Executive Board members shall not be eligible to receive any compensation for time spent attending such meetings. Union officials utilizing union time shall not be eligible during the time of utilization for Worker's Compensation benefits in case of injury. In any event, absence from duty for union business shall not be approved which requires a union official to be off duty for periods in excess of three consecutive scheduled work shifts. Extension of any consecutive time off for union officials, over and above the three consecutive shifts, may be granted solely at the discretion of the Fire Chief. Requests for union time off must be made on the designated form. Jointly related business between the City and the Union shall not be subject to deduction from the bank, however, the Union acknowledges that such time needed for arbitration hearings will be chargeable to the account. In any event, the Fire Chief or his/her designee, may at his/her discretion deny any request not made at least 72 hours in advance and submitted by a Union Officer, or which renders the Department staffed below that level which the Chief determines to be necessary. Section 7. Right to Contribute Work In the event that an employee's illness or physical incapacity should continue beyond the point where his/her accumulated sick leave, if any, has been exhausted, he/she may request to have other qualified employees of the Department perform his/her regular duties; provided that such substitution would not require overtime compensation for the substitute and the maximum allowable contributed time to any one employee is a total of 90 calendar days for the duration of this contract. Section 8. Military Leave Any regular or probationary employee in the classified service being inducted or otherwise entering the armed forces of the United States in time of war, or pursuant to the Selective Service Act of 1948 as amended, or of any other law of the United States, shall be granted military leave of absence without pay for the period of the military service required of him/her, and on completion thereof be reinstated in the City service in accordance with the following regulations: A. Military leaves shall be granted in accordance with the provisions herein except where said provisions may be superseded by Federal or Florida Law: 1. For inductees, the minimum period of time required to be served. 2. For enlistees in time of war, the period of the first minimum enlistment, or for such additional period of time required to be served. 3. For reservists, the minimum period of time required to be served. 4. For pre-induction physical examination when so ordered by a Selective Service Board, time off shall be granted for the minimum period necessary to comply with such order, but shall in no case exceed two (2) regularly scheduled work days. 5. For required active or inactive training duty as a member of a Reserve Component or the National Guard falling on the employee's regularly scheduled work days, the employee shall be allowed up to a maximum of two hundred and forty (240) working hours per calendar year without loss of 42 pay. Absences from duty for required military reserve training in excess of two hundred and forty (240) working hours per calendar year or for any non-required military reserve training for which the employee initially volunteered shall not be compensated for by the City. A copy of the employee's military orders certifying his/her training assignment shall be submitted by the employee to the Fire Chief and the Human Resources Department immediately upon receipt by the employee. An employee who is required to attend military duty training which falls or occurs during regular working hours and which exceeds the two hundred and forty (240) working hours provided above will be granted time off without pay. Due to the unique 24 hours shift schedule, the employee may break the absence time into 12 hour blocks and will be charged for a 6 hour block of time in order to facilitate travel and military duty requirements. The employee shall be required to provide timely notice of such training assignments to the City of such training assignments. Failure to provide any of the timely notices herein required of an employee's military orders to the Fire Chief and the Human Resources Department shall be considered just cause for disciplinary action not to exceed a three (3) day suspension. B. For the purposes of this Section, "armed forces" shall be defined to include: 1. The Army, Navy, Marine Corps, Air Force and Coast Guard. 2. The auxiliary services directly necessary to and actually associated with the armed forces of the United States, as may be determined by the City. C. Application for reinstatement must be made within 90 calendar days from date of discharge or release, or from hospitalization continuing after discharge for a period of not more than one year. Such application shall be in writing to the Human Resources Director and shall be accompanied by evidence of honorable discharge or release. D. Upon return from military leave, the employee shall be reinstated in the City service in accordance with the following regulations: 1. If still qualified to perform duties of his/her former position, the employee shall be restored to position or to a position of like seniority, status and pay; or 2. If not qualified to perform the duties of his/her former position by reason of disability sustained during such service but qualified to perform the duties of any other position in the employ of the City, the employee shall be restored to such other position, the duties of which the employee is qualified to perform, as will provide the employee with like seniority, status and pay, or the nearest approximation thereof consistent with the circumstances in his/her case. 3. In the event no vacancy exists in the appropriate class and there is an employee in such class serving a probationary period who has not acquired regular status, then such probationary employee shall be laid off and the returning employee reinstated. 4. If a returning employee has regular status and cannot be reinstated under the prov1s1ons of paragraph (3) above, then the employee having been employed in the appropriate class for the shortest period of time shall be laid off and the returning employee reinstated. 5. A returning employee shall have the same status as prior to the beginning of his/her military leave. The employee shall be allowed to take any subsequently administered examination for promotion after return that he/she would have been eligible to take had he/she not been on military leave, and shall be required to complete any uncompleted period of probation. No grievance shall be filed or processed by any other employee or the Union in connection with this paragraph. 43 6. The employee shall submit to such medical and/or physical examinations as the City Manager shall deem necessary to determine whether or not such military service has in any way incapacitated him/her for the work in question; provided however, that as far as practicable any employee returning with disabilities shall be placed in such employment as the City Manager shall deem suitable under the circumstances. 7. Any regular or probationary employee receiving a dishonorable discharge from the armed forces shall not be reinstated to any position in the City service. 8. An employee granted a military leave of absence shall, insofar as possible, have all the rights and privileges he/she would have had if he/she had remained on duty including cumulative seniority, and except as otherwise provided in these Rules and Regulations, all other benefits dependent on length of employment to the same extent as if the employee had not been absent on such leave. An employee returning from military service shall be reinstated to active City service at the earliest possible date following application for such reinstatement, consistent with the best interests of the City service and taking into consideration necessary adjustments of staff. However, in no event shall this period be more than thirty (30) calendar days. The City shall have the right as part of directing the employee's duties upon returning to work, to assign the employee to such training as is necessary in its judgment to ensure the employee's familiarity with job duties and knowledge. 9. Eligible employees will be paid in accordance with Sections 115.09 and 115.14, Florida Statutes. Section 9. Parental Leave The City will provide up to three shifts for 53/50-hour weekly schedule employees and one week (40 hours) for 40-hour weekly schedule employees of paid parental leave following the birth of an employee’s child or the legal permanent placement of a child with an employee in connection with adoption or foster care. This paid leave will run concurrently and in conjunction with the Family and Medical Leave Act. Eligible employees must meet the following criteria: (i) Have been employed with the City for at least 12 months. (ii) Have worked at least 1,250 hours during the 12 consecutive months immediately preceding the date the leave would begin. (iii) Be a regular full-time employee. Employees must be taking leave for one of the reasons listed below: (i) To bond with the newborn child within one year of birth. (ii) The legal permanent placement of a child with the employee for adoption or foster care and to care for the newly placed child within one year of placement. The fact that a multiple birth, adoption or placement occurs (e.g., the birth of twins or adoption of siblings) does not increase the total amount of paid parental leave granted for that event. In addition, in no event will an employee receive more than three shifts for 50-hour weekly schedule employees and one week (40 hours) for 40- hour weekly schedule employees of paid parental leave in a rolling 12-month period, regardless of whether more than one birth, adoption or foster care placement event occurs within that 12-month time frame. Paid parental leave is compensated at 100 percent of the employee’s regular, straight-time weekly pay. Paid 44 parental leave will be paid on a biweekly basis on regularly scheduled pay dates. Approved paid parental leave may be taken at any time during the 12-month period immediately following the birth, adoption or legal permanent placement of a child with the employee. Paid parental leave may not be used or extended beyond this 12-month time frame. Employees must take paid parental leave in one continuous period of leave and must use all paid parental leave during the 12-month time frame indicated above. Any unused paid parental leave will be forfeited at the end of the 12-month time frame. The employee will provide their supervisor and the Human Resources Department with notice of the request for leave at least 30 days prior to the proposed date of the leave (or if the leave was not foreseeable, as soon as possible). Employees must return to work for the City for at least 6 months following the paid parental leave. An employee will be responsible for repayment if this commitment is not fulfilled. The repayment will be deducted from the employee’s sick time balance first, followed by their personal floating holiday and then vacation. ARTICLE 9 WAGES AND COMPENSATION Section 1. Pay Schedule Base for October 2021 Base for October 2022 Base for October 2023 Firefighter $46,000 - $73,000 $48,200 - $75,200 $50,400 - $77,400 Firefighter/Driver Operator Fire Inspector I $53,000 - $80,000 $55,200 - $82,200 $57,400 - $84,400 Fire Medic $58,000 - $85,000 $60,200 - $87,200 $62,400 - $89,400 Fire Lieutenant Fire Inspector II $66,000 - $93,000 $68,200 - $95,200 $70,400 - $97,400 Fire Medic Lieutenant $74,000 - $101,000 $76,200 - $103,200 $78,400 - $105,400 The Pay Schedules shall be in accordance with Appendix A. Effective on the first day of the payroll period that includes October 1, 2024 2021, all employees will be paid in accordance with the new annual rate of pay as provided in Appendix A. Effective for the period from October 1, 2024, through September 30, 2025, employee shall advance in Step as provided in this Article 9. Employees may not exceed the maximum annual rate of pay as provided in Appendix A. pay ranges for all classifications are set forth in this Section 1 Pay Schedule. Employees will receive a one-time pay adjustment. This adjustment is calculated by adding $1,800.00 for each year of completed service with the Clearwater Fire & Rescue Department, as of October 1, 2021, (up to a maximum of 15 years) to the base starting salary of the employee’s job classification. Employees shall not exceed the maximum annual rate of pay as provided in this Section 1 Pay Schedule. Employees who are above the maximum annual rate of pay will not receive any increase in pay. 45 Effective on the first day of the payroll period that includes October 1, 2025 2022, the City shall provide a 4% $2,200.00 general wage increase for all employees, as set forth in Appendix A. this Section 1 Pay Schedule. Effective for the period from October 1, 2025, through September 30, 2026, employee shall advance in Step as provided in this Article 9. Employees shall not exceed the maximum annual rate of pay as provided in Appendix A. this Section 1 Pay Schedule. Employees who are above the maximum annual rate of pay will not receive any increase in pay. Effective on the first day of the payroll period that includes October 1, 2026 2023, the City shall provide a 3% $2,200.00 general wage increase for all employees, as set forth in Appendix A. this Section 1 Pay Schedule. Effective for the period from October 1, 2026, through September 30, 2027, employee shall advance in Step as provided in this Article 9. Employees shall not exceed the maximum annual rate of pay as provided in Appendix A. this Section 1 Pay Schedule. Employees who are above the maximum annual rate of pay will not receive any increase in pay. Any further step advancements and general wage increases after September 30, 2027 2024 will be dependent upon and subject to negotiations in any successor Agreement. Section 2. Pay Schedule Format: Merit Pay Increases Pay increases are not automatic but are management review rates and may be granted only upon receiving a rating of Meets Standards or better on the annual performance review. Eligibility for review for within pay schedule increases shall be as follows: Step 1 — Original appointment Step 2 — At the end of one year of satisfactory service in step 1. Step 3 — At the end of one year of satisfactory service in step 2. Step 4 — At the end of one year of satisfactory service in step 3. Step 5 — At the end of one year of satisfactory service in step 4. Step 6 — At the end of one year of satisfactory service in step 5. Step 7 — At the end of one year of satisfactory service in step 6. Step 8 — At the end of one year of satisfactory service in step 7. Step 9 — At the end of one year of satisfactory service in step 8. Step 10 — At the end of one year of satisfactory service in step 9. Step 11 — At the end of one year of satisfactory service in step 10. Step 12 — At the end of one year of satisfactory service in step 11. Step 13 — At the end of one year of satisfactory service in step 12. Step 14 — At the end of one year of satisfactory service in step 13. Step 15 — At the end of one year of satisfactory service in step 14. Step pay increases shall provide for approximately a 3% increase over the preceding step for each step advancement as provided in Appendix A. Beginning on the first day of the payroll period that includes October 1, 2022 to the last day of the payroll period that ends prior to October 1, 2024, employees who receive a rating of Meets Standards or better on their annual performance review shall be provided Merit Pay of $1,800.00. Merit Pay will be paid in the payroll period that includes the date of the employee’s annual performance review. Employees shall not exceed the maximum annual rate of pay as provided in the Article 9, Section 1 pay schedule. Employees who are above the maximum annual rate of pay will not receive any increase in pay. Any further continuation of Merit Pay after September 30, 2024 will be dependent upon and subject to negotiations in any successor Agreement. 46 Section 3. Merit Pay Review - Increases and Delay or Denial Employees who receive a merit eligibility evaluation rating of Meet Standards or better shall be advanced provided a Merit Pay Increase as provided in Section 2 above. Employees who receive a merit eligibility evaluation rating of less than Meet Standards shall not be granted a merit step advancement. Merit Pay Increase. Such employees shall be reevaluated after three months and if then rated Meet Standards, shall be granted a merit step pay adjustment as of the date of the three-month follow- up evaluation. The effective date of the increase shall be utilized for the purpose of determining eligibility for future merit pay adjustments. If the initial three months follow-up evaluation rating is still less than Meet Standards, the employee shall be evaluated again in three more months. If then rated Meet Standards or higher, the employee shall be granted a merit step pay adjustment as of the end of that second three-month follow-up period. The effective date of this increase shall be utilized for the purpose of determining eligibility for future merit pay adjustments. If the employee is rated less than Meet Standards on the second three-month follow-up evaluation, no merit step pay adjustment shall be made,; and the employee will be evaluated again one year from the date of the initial annual evaluation which was less than Meet Standards. Section 4. Rates of Pay A. Base rate of pay is defined as compensation at the rate prescribed for the job class in the Pay Schedule. B. Regular rate of pay is defined as base pay and any assignment pay if regularly assigned. C. Overtime is defined as one and one-half times an employee's regular rate of pay. Section 5. Annual Personal Resource Allowance A. All members of the bargaining unit who are actually working on January 1st of each year shall be provided an annual allowance of $540.00 $440 per year, which shall be utilized to cover (1) the costs of laundering coat, shirts, pants, jumpsuit, and bed linens, (2) the replacement of personal items such as glasses, watches, hearing aids, etc., and (3) time spent attending the annual physical, except for 40-hour schedule personnel who shall attend on duty, but shall still receive the allowance. B. An employee who is on extended sick leave (60 days or more) or has been approved for regular disability retirement by the Pension Advisory Committee shall no longer be eligible for the personal resource allowance. C. The annual resource allowance shall be paid on a quarterly basis to eligible bargaining unit members who are actually working at the time of the quarterly payment, and shall reflect the appropriate amounts subject to withholding and not subject to withholding for tax purposes. Section 6. Mileage Reimbursement A. For each move a member of the bargaining unit is required to make, and use his/her own vehicle, after he/she has reported to his/her duty station, the City will provide reimbursement to the employee in accordance with Sec. 2.328 of the City of Clearwater Code of Ordinances; or, the City may elect to provide transportation. 47 B. The mileage reimbursement rate shall be consistent with City Policy. C. This distance will be computed by the City, so that both the City and employee can refer to a standard table to ascertain the distance between any two Fire Stations. D. Request forms for mileage reimbursement must be made to the Fire Chief’s office monthly. E. In the event that an employee is transported in a City vehicle under the provisions of this part, the City will provide the employee transportation back to his/her duty station at or before the end of the employee's tour of duty if the employee so requests. Section 7. Special Teams Any employee who meets the current certification guidelines set forth by the Fire Chief and is specifically assigned to a Special Team on a scheduled shift shall receive $60.00 fifty dollars ($50) per payroll period in addition to the current base rate of pay. Bargaining unit members who meet the current certification guidelines set forth by the Fire Chief and are assigned as team leaders shall not receive the Special Team pay as described above, but shall instead receive $70.00 sixty dollars ($60) per payroll period in addition to the current base rate of pay. Special Team training and assignments shall be made at the discretion of the Fire Chief or his/her designee and Special Team Pay will be provided to a maximum number of employees as follows: Dive Team - 6 per shift plus one team leader Technical Rescue Team- 8 per shift plus one team leader Emergency Response (SWAT) Team-4 per shift plus one team leader Employees may participate on more than one Special Team but shall be eligible to be compensated for up to two one Special Teams only. Additional employees may be permitted to participate in the training process only based on availability of funds. The department shall provide the initial issue of clothing and equipment particular to Special Teams and the replacement of clothing (shirt, pants, coat, and jumpsuit) will be the responsibility of the employee through the use of the annual Personal Resource Allowance. Initial issue Special Team clothing shall be the following: DIVE 1 x Jacket 1 x Jumpsuit 1 x Swim Trunks 1 x Shirt 1 x Shorts TECH RESCUE 3 x Shirts 3 x Boots SWAT 2 x Shirts 2 x Pants 1 x Boots MARINE 1 x Shirt 1 x Swim Trunks An employee may be removed from a Special Team assignment if he/she is unable to participate for a period of 30 days or more for reasons other than scheduled leave. Special Team pay may be discontinued at any time should the City no longer continue to provide the designated service. Section 8. EMS Wages A. All employees shall receive pay in accordance with Pay Schedule. B. Employees who serve in the non-Paramedic job classifications of Firefighter, Firefighter/Driver-Operator, and Fire Lieutenant, and who are State of Florida and Pinellas County certified as a Paramedic, shall receive a 48 Paramedic certification pay differential of $225.00 per payroll period. These employees shall be required to perform the duties of a State of Florida and Pinellas County certified Paramedic., C. Employees assigned to the non-Paramedic classifications of Firefighter, Firefighter/Driver-Operator, and Fire Lieutenant who are State of Florida and Pinellas County certified as a Paramedic, and who agree in writing to be willing to serve in an acting capacity as a Fire Medic or to be assigned as a Paramedic on an ALS unit when called upon by the Department to do so, shall receive a Paramedic certification pay differential of $100.00 per payroll period. Such employees shall be eligible to receive Acting Pay in accordance with Paragraph C below in addition to the biweekly certification pay. Such employees who elect to receive the Paramedic certification pay differential shall be required to provide written notice of their intent to no longer be willing to serve in an Acting capacity as a Fire Medic or as an assigned Paramedic on an ALS unit and thereby no longer receive the $100.00 per payroll period certification pay differential at least 30 calendar days prior to the end of the payroll period in which they wish to effect the change. Upon the effecting of such requests by the Department, the affected employees shall not be eligible to receive the Paramedic certification pay differential for a period of six months. Employees assigned to the non-Paramedic classifications of Firefighter, Firefighter/Driver- Operator, and Fire Lieutenant who are State of Florida and Pinellas County certified as a Paramedic and who do not agree to be willing to serve in an Acting capacity as a Fire Medic or as an assigned Paramedic on an ALS unit and thereby not receive the $100.00 per payroll period certification pay differential shall be eligible to elect to be assigned as a Paramedic to an ALS unit on a voluntary basis, and when so assigned on an ALS unit shall be compensated in accordance with paragraph C below. D. Employees assigned to the non-Paramedic classifications of Firefighter, Firefighter/Driver-Operator, or Fire Lieutenant who are state and county certified as an E.M.T. or Paramedic, and who are not receiving Acting pay, and who are assigned on an ALS unit will receive assignment pay of 5% above the employee's current base rate of pay for all hours served on the ALS unit. E. The Department agrees to publish a semiannual list of the dates of expiration of all E.M.T. and Paramedic certifications. Section 9. Training, Tuition Refund, Bilingual and Incentive Pay Training and Tuition Refund A. Members of the bargaining unit shall be entitled to participate in a tuition reimbursement program provided that all classes are off-duty, except for promotional courses for the positions of Lieutenant and/or Fire District Commander where department policy will be followed. However, the City and the Union may agree to pro rate such tuition reimbursement for classes which cross both on-duty and off- duty time. B. The tuition refund for members of the bargaining unit shall be up to $2,000.00 $1700 per year for each year of the agreement. However, if classes taken by a bargaining unit member pertain to an advanced degree program (Master’s Degree or higher), then up to $2,200.00 $2000 of tuition paid for such classes shall be reimbursable. C. Participation in Tuition Refund will not imply any eligibility for school time pay nor will it impose any obligation to the City under FLSA. D. Except for training requirements occasioned by extended vacations, when a bargaining unit member is directed by the Department to attend classes, the member will be compensated for the hours spent in accordance with the law. 49 E. The City shall provide and maintain reasonable training grounds and facilities. F. The City agrees to pay the tuition only for classes required as part of a State of Florida Paramedic certification program for up to one bargaining unit member per shift or 3 members total, whichever is greater, for each year of this Agreement provided that the classes are offered in such a manner that the employees may attend the classes during non-duty hours, and such class hours shall not be counted as hours worked. Should such classes not be available in a manner that the employees may attend during non- duty hours, the Fire Chief in his/her sole discretion shall determine whether to release the employees from duty for only the hours necessary to attend the classes. In such case, the employees shall be expected to serve the remaining hours of any shift for which they are scheduled. Any prerequisite classes necessary to participate in a State of Florida Paramedic certification program shall only be subject to the tuition reimbursement provisions outlined in Paragraphs A-D above and in accordance with established Department guidelines to determine whether or not the class hours constitute compensable time. Any existing employee who obtains a State of Florida Paramedic certification through the process outlined in this Section shall be required to comply with the requirements necessary to obtain and maintain certification as a Paramedic in Pinellas County, and shall be required to remain with Clearwater Fire and Rescue and serve as a Fire Medic when called upon to do so for a period of five years or shall be subject to repayment of any costs incurred by the Department for such classes. Should an employee voluntarily leave the department or be permitted to voluntarily demote to a non- paramedic classification in accordance with this agreement before the end of the five year period, the amount of such repayment shall be prorated by 3- month increments with the employee being required to pay the prorated amount corresponding to the number of remaining full 3-month periods not served. G. Any employee who has successfully passed a proficiency exam and has been designated as a certified bilingual interpreter shall be eligible to receive $25.00 per payroll period in addition to the employee’s current base rate of pay. H. Any employee who obtains and meets certification guidelines set forth by the Fire Chief is eligible for two of the following incentive pays. State of Florida Fire Officer 1 $25.00 per payroll period State of Florida Fire Officer 2 $25.00 per payroll period State of Florida Fire Inspector 1 $25.00 per payroll period State of Florida Fire Inspector 2 $25.00 per payroll period State of Florida Arson Investigator $25.00 per payroll period Incentive Pay is only available when the above-referenced certification(s) are not required as part of the employee’s current job description. In the event an employee demotes, promotes, or otherwise transfers to another job position in which the certification(s) are required as part of the employee’s new job description, the employee is no longer eligible for incentive pay. Incentive pay shall be capped at $50.00 per payroll period. Section 10. Clothing and Equipment 50 A. The City shall continue to provide the initial clothing and protective devices currently supplied, or their equivalent, and initial safety equipment currently supplied, without cost to the employee. Employees shall be required to wear or use the clothing or other items provided unless a suitable replacement as determined and approved in advance by the Department is provided by the employee at the employee's own cost. The employee will replace any lost or abused equipment that has been supplied by the Department by purchasing the lost or abused equipment from the Department at the value of the lost or abused equipment, as determined by the Fire Chief. Initial issuance for all new employees shall be in compliance with the table below. Item Description Suppression / EMS Inspection Bunker Cost 1 As Assigned Bunker Pants 1 As Assigned Firefighting Boots 1 As Assigned Firefighting Gloves 1 As Assigned Firefighting Helmet 1 As Assigned Firefighting Mask 1 As Assigned Firefighting Regulator 1 As Assigned Firefighting Suspenders 1 As Assigned Nomex Hood 2 As Assigned Safety Vest 1 As Assigned Howd Strap 1 As Assigned Flashlight 1 As Assigned Item Description Suppression / EMS Inspection Coat 1 1 Pants 6 8 Shorts 2 T-Shirt Short Sleeve 8 T-Shirt Long Sleeve 3 Class A – Short Sleeve 6 3 Class A – Long Sleeve 1 1 Sweatshirt 1 Jumpsuit 1 1 Hat 1 Tie 1 Badge 1 2 Nametag 1 1 Collar Insignia Sets 2 1 Blanket 1 Pillow 1 ID – City 1 1 ID – County 1 1 Safety Shoes 2 pairs 2 pairs Personal Escape Rope 1 Polo Shirt *Lt. Rescue receives 2 4 B. All employees will be provided an initial issue of any new items in addition to those on the list above when such items are required by the Department. Equivalent variations of clothing items on the list above, such as coats, shirts, and pants, may be provided by the Department to all newly hired employees and shall be available to existing incumbent employees through the use of the personal resource allowance as defined in this Agreement. 51 C. All items issued by the Department shall be returned to the Department before an employee leaves the service of the Department either by termination, resignation, retirement, etc. Should any such items not be returned, the City shall withhold from the employee's final paycheck an amount sufficient to reimburse the City at a pro-rated replacement cost of the equipment. D. The Department shall issue and maintain uniforms and equipment to personnel it determines necessary in order to provide an Honor Guard presence as the City deems appropriate and subject to the availability of funds. It is understood that the decision whether to have an Honor Guard, and who shall be designated to participate, rests with the Fire Chief in his sole discretion. Any items issued to Honor Guard personnel shall remain the property of the Department and shall be returned upon separation in accordance with Paragraph C of this Section above. E. The Department shall annually replace the established by the Department. following uniform items m accordance with procedures Pants Pants (tactical) Shorts Short Sleeve Tee Shirts Short Sleeve Shirt Jump Suit Long Sleeve Tee Shirts Polo Shirt (Inspection Only) Polo Shirt (Lt. Rescue) Safety Shoes 3 2 pair 1 2 pair 1 pair 6 1 1 every 2 years 3 2 1 2 Pairs upon hire and will be replaced as needed 52 Section 11. Standby A. Fire Prevention Inspectors, Fire Inspector II, and Fire Inspector I, (both primary and back-up), who are assigned to remain in a standby status while not on duty shall be paid at the following rates during the term of this agreement: Monday through Friday $40.00 $50.00 per night Weekends $50.00 $75.00 per day Extended Time During Designated Holidays $50.00 $75.00 per day B. Standby assignments are mutually exclusive of call-in and holdover provisions of this agreement. Nightly standby (Monday - Friday) shall begin at the end of each regular workday and shall end at the beginning of the next workday (16-hour period). Weekend standby shall begin at the time which would be the employee's normal starting time on Saturday and shall conclude at the beginning of the employee's regular workday on Monday (48-hour period). Extended Time During Designated Holiday shall apply when the employee assigned to standby continues in standby assignment for an 8-hour extended period on a designated holiday. In addition to the above, an employee who is called out to work while on nightly or weekend standby duty shall be credited with one hour work time or the actual hours worked during the entire standby period, whichever is greater. C. The Department retains the discretion but is not required to assign a take- home vehicle to Fire Prevention Inspectors who are subject to standby. Section 12. Paycheck Issuance All employees are encouraged to enroll in direct deposit. Paychecks will be issued biweekly via direct deposit for employees enrolled in direct deposit. Paychecks will be issued biweekly via pay card for employees not enrolled in direct deposits. Pay advice shall be available via the Employee Self Service (ESS) Portal. Employees shall be required to elect to receive the entirety of the pay in either standard hard copy paycheck format or through direct deposit by electronic transfer, and will not be permitted to split their pay between the two mediums. Employees electing to receive standard hard copy paychecks may pick them up from Fire Administration during normal business hours. Employees may elect to change from one payment medium to the other at any time provided written notice of fourteen calendar days is given to the City's Payroll division. 53 ARTICLE 10 INSURANCE Section 1. Life Insurance All life insurance premium contributions and plans currently in force shall continue for the duration of this Agreement. The selection of an insurance company shall be free and without prejudice and of the employee’s choice from the companies offered by the City, with the approval of the Insurance Committee. The Union agrees to participate with the Insurance Committee in making decisions regarding life insurance. The City shall no longer permit any new enrollment in the 1% Life Insurance Program. Bargaining unit employees who are enrolled as of the effective date of this Agreement may continue to participate provided, they maintain their participation on a continuous basis thereafter. Any employees who currently participate and choose to discontinue their enrollment will not be permitted to re-enroll in this benefit again at a later date. Section 2. Death Benefits The current practice of paying accrued rights and benefits to the designated beneficiary or next-of-kin upon the death of an employee shall continue. Section 3. Health Insurance The City agrees to meet with the I.A.F.F. and other City of Clearwater union representatives to review the health insurance program for the purpose of reducing the cost of such program for the City and the employees. The City further agrees to provide the I.A.F.F. with such information as would be required to formulate such a benefit package and to cooperate with the I.A.F.F. and other unions to obtain pertinent information from the present carrier. The City agrees that for the calendar year occurring within the first year of the agreement, the City shall contribute toward the medical insurance premiums for employees and their dependents in the amount approved for the plans approved by the City Council. The City agrees to maintain the current Benefits Committee recommendation process culminating in final action by the City Council to determine medical insurance premiums for employees and their dependents for the duration of this Agreement. The City further agrees that during the life of the agreement, the City will make available to employees the option of at least one health insurance plan for which the City shall pay 100% of the premium for the employee only base benefit plan cost, it being understood that such base plan may provide a different level of benefit than that which is currently provided. Additional coverage for the family or spouse, as well as any enhancements or “buy ups” to the base plan will continue to be paid for by the employee. Any information received by either party from the consultant or from another carrier will be shared with the other party. 54 ARTICLE 11 PERFORMANCE AND DISCIPLINE The City and the Union agree that any system of discipline or performance management should be continually reviewed for its effectiveness. The system may be modified from time to time to better meet the needs of the employees and the City. Any changes will be consistent with sound personnel practices. All discipline will be for just cause and consistent with due process. Employees have the right to Union representation any time they believe a meeting may lead to disciplinary action. The City-wide and Fire Department standards shall be in writing. The Union will provide input as the standards are developed and/or modified. If the Union refuses to participate or provide input, the City and the Fire Department maintain the right to change the process. The City recognizes that members of the Fire Department are protected by the “Firefighter Bill of Rights” and any disciplinary action will conform to the guidelines of that law. ARTICLE 12 CITY’S DRUG AND ALCOHOL PROGRAM POLICY A. The City's Drug and Alcohol Program Policy delineates drug and alcohol test procedures. Revisions governing testing standards and job classification specifications shall be made as revisions to laws or regulations of state or federal government or agencies deem permissible. Union representatives will be furnished with copies of the policies upon such revision. Whenever the City or the Union proposes to amend or change any policy affecting drug and alcohol testing, the City or the Union shall provide notice and a copy of the proposed amendments or changes to the other party a reasonable period of time in advance of the proposed effective date of the change. The Union and the City shall have the right to bargain such proposed amendments or changes in accordance with the law and the terms of this agreement. B. References to CDL and "safety-sensitive" employees and positions shall not apply to IAFF bargaining unit members. As such, IAFF bargaining unit members shall not be subject to the following provisions of the City Drug and Alcohol Program Policy or agreed to by the parties: Section II, B. Section II, C. Section II, E. 2. Section II, E. 4. 55 ARTICLE 13 RETIREMENT Section 1. The City and the Union agree that prior to retiring an employee may use his/her vacation leave balance at 100% value and sick leave balance at 50% value to advance the employee's date of retirement. Section 2. The employee will be considered a regular employee for service credit to the pension plan. The City and the employee will continue to contribute to the pension plan. Section 3. During the period of "retirement advancement", the employee will not be eligible to receive or accrue any benefits except retirement credit, and Educational Incentive Pay. The benefits that will stop include, but are not limited to, vacation and sick leave accrual, insurance premium payments, workers' compensation, holidays and holiday pay, allowances, reimbursements, and special payments of any kind. ARTICLE 14 SENIORITY, LAYOFF, AND RECALL Section 1. Seniority A. Definition -- Seniority is hereby defined as the length of continuous service in City employment except as applied to vacation preference, promotions, layoffs, and assignments. B. How Measured 1. In the event an employee transfers from the Fire Department to another position within the City and, at a later date, transfers back to the Fire Department, the seniority date for the purpose of layoff, promotions, and transfers, shall be the date the employee transfers back into the Department. 2. Any employee who transfers from another City department to the Fire Department shall retain full City seniority with regards to vacation and sick leave accrual. However, for purposes of layoff, departmental seniority shall prevail. In regards to pay and pensions, the applicable civil service rules or City Pension ordinance shall apply. 3. In the event two or more employees have the same seniority date, the employee whose first letter of his/her last name is closest to the letter "A" shall have more seniority. 4. The seniority list on the date of this agreement shall reflect names, job titles, and seniority dates (departmental and City) of all employees. 5. The City will maintain a current seniority list at all times and will provide the Union with copies of such list in December and June of each year. 56 6. Emergency, provisional, seasonal, and temporary part-time employees shall not accumulate seniority during any period of such employment. C. Continuous service shall mean employment by the City in a position in the classified service without interruption or break, except that the following shall not be considered as breaks in employment: 1. Leaves of absence or time off with or without compensation granted pursuant to this Contract. The length of any such leave shall not be deducted from the length of continuous service in computing seniority. 2. Layoffs for lack of work, lack of funds, abolition of position, or because of material changes in duties or organization, not exceeding one year in length, followed by reinstatement or by appointment from the reemployment list. The length of any such layoff shall not be deducted from the length of continuous service in computing seniority. 3. Disability retirement if and when followed by reinstatement. The length of any such disability retirement shall not be deducted from the length of continuous service in computing seniority. 4. Suspensions of less than three months in accordance with this Agreement. The length of any such suspension of more than three months shall be deducted from the length of continuous service in computing seniority. 5. Dismissals subsequently withdrawn or modified by the Appointing Authority, arbitration award, grievance decision, or the Civil Service Board in accordance with this Agreement. 6. Resignations subsequently withdrawn, in accordance with this Agreement, within six months after acceptance, followed by reinstatement or appointment from the reemployment list; provided, however, that the actual length of separation from the service shall be deducted from the length of continuous service in computing seniority. D. Uses -- In addition to the circumstances and conditions wherein, by the provisions of this Agreement and/or these Rules, seniority has been determined to be the controlling factor, it shall also be given reasonable consideration in determining the order of layoff, the order of names on a reemployment list and in promotions in accordance with the rules governing those procedures. E. Transfer -- In the event of a transfer or appointment from certification to another department, an employee shall retain all accumulated seniority. 57 Section 2. Layoffs A. In the event of layoffs, all probationary status employees in the class involved shall be laid off before any permanent status employees in the class involved. The order of layoff of probationary employees shall be determined by management evaluations of the performance and potential of the employees. B. In the event further layoffs are required, such layoffs shall be accomplished by class groups of Firefighter, Firefighter/Driver-Operator, Fire Medic, Fire Lieutenant, Fire Medic Lieutenant, and Fire Prevention Inspector. Notwithstanding anything to the contrary contained in this Agreement, Management shall determine the number of employees to be laid off and the class or classes involved. An employee who is designated to be laid off shall have the opportunity to revert to the position he/she held prior to his/her current classification. If this movement requires further reduction in the work force, the same procedure shall be utilized for subsequent positions in accordance with this section, and the process continued through the ranks thereafter. Within the involved classes, layoffs shall be accomplished by the following groupings: 1. Group A -- Employees with one through three years of service in the Clearwater-Fire Department. 2. Group B -- Employees with four through six years of service in the Clearwater Fire Department. 3. Group C -- Employees with seven through nine years of service in the Clearwater Fire Department. 4. Group D -- Employees with 10 through 12 years of service in the Clearwater Fire Department. 5. Group E -- Employees with 13 through 15 years of service in the Clearwater Fire Department. 6. Group F -- Employees with 16 through 18 years of service in the Clearwater Fire Department. 7. Group G -- Employees with 19 or more years of service in the Clearwater Fire Department. All employees in Group A must be laid off before any employees listed in Group B; all employees in Group B must be laid off before any employees listed in Group C; etc. Within each group, employees shall be ranked by management and employees laid off by the rank order established. Management rating of employees can be based upon performance evaluations by management of the preceding 3-year period (if available), disciplinary actions, and physical ability to perform the job. When other qualifications are substantially equal, Fire Department seniority will govern. Management will provide a list of the rank order within Groups prior to the layoff. 58 Section 3. No new employee shall be hired until the employee on layoff has been given an opportunity to return to work at his/her original seniority date and position; provided, that after one year of layoff the employee shall cease to accrue seniority and that such reemployment rights shall cease after two years from the date of layoff. Section 4. The Fire Chief shall give written notice to the Human Resources Director and to the affected employee(s) including the President of the Union, on any such proposed layoff. Such notice shall state the reason thereof and shall be submitted 30 days before the effective date of proposed layoff. ARTICLE 15 DURATION, MODIFICATION, AND TERMINATION Section 1. Amendments This Agreement may be amended at any time by the mutual written consent of the parties, but no such attempted amendment shall be of any force or effect until placed in writing and executed or ratified as required by each party hereto. Section 2. Severability and Waiver A. In the event that any clause or clauses in this Agreement shall be finally determined to be in violation of any law, such clause or clauses only shall be deemed of no force and effect and unenforceable, without impairing the validity and enforceability of the rest of the contract, including any and all provisions in the remainder of any clause, sentence or paragraph in which the offending language may appear. B. The exercise or non-exercise by the City or the Union of the rights covered by this Agreement shall not be deemed to waive any such right or the right to exercise them in some other way in the future. C. In the event of invalidation of any article or section, both the City and the Union agree to meet within 30 days of such determination for the purpose of arriving at a mutually satisfactory replacement for such articles or sections. 59 Section 3. Duration This Agreement shall be effective as of October 1, 2024 2021, and shall continue in full force and effect until September 30, 2027. 2024, At least 120 days At any time commencing January 1 of the year in which this Agreement terminates, but no later than 90 days prior to the termination of this Agreement, either party hereto shall notify the other, in writing, of its intention to modify, amend or terminate this Agreement. Failure to notify the other party of intention to modify, amend or terminate, as herein above set forth, will automatically extend the provisions and terms of this Agreement for a period of one year, and each year thereafter absent notification. IN WITNESS WHEREOF, the parties hereto have hereunder set their hands and seals this day of , 20252. ATTEST: CITY OF CLEARWATER, FLORIDA Rosemarie Call, City Clerk Jon Jennings Jennifer Poirrier, City Manager Approved as to form Countersigned: David Margolis, City Attorney Frank Hibbard Bruce Rector, Mayor INTERNATIONAL ASSOCIATION OF FIREFIGHTERS, AFL-CIO, Local 1158 WITNESSES: David Sowers, President, Local 1158 60 APPENDIX A – WAGES FIREFIGHTER PAY RANGE 5540 (106/100 HOURS) Step October 2024 Biweekly October 2025 Biweekly October 2026 Biweekly 1 $ 2,192.31 $ 2,280.00 $ 2,348.40 2 $ 2,258.08 $ 2,348.40 $ 2,418.85 3 $ 2,325.82 $ 2,418.85 $ 2,491.42 4 $ 2,395.59 $ 2,491.42 $ 2,566.16 5 $ 2,467.46 $ 2,566.16 $ 2,643.14 6 $ 2,541.49 $ 2,643.14 $ 2,722.44 7 $ 2,617.73 $ 2,722.44 $ 2,804.11 8 $ 2,696.26 $ 2,804.11 $ 2,888.24 9 $ 2,777.15 $ 2,888.24 $ 2,974.88 10 $ 2,860.46 $ 2,974.88 $ 3,064.13 11 $ 2,946.28 $ 3,064.13 $ 3,156.05 12 $ 3,034.67 $ 3,156.05 $ 3,250.73 13 $ 3,125.71 $ 3,250.73 $ 3,348.26 14 $ 3,219.48 $ 3,348.26 $ 3,448.70 15 $ 3,316.06 $ 3,448.70 $ 3,552.17 FIREFIGHTER/DRIVER-OPERATOR/Fire Inspector I PAY RANGES 5530 (106/100 HOURS) and 5505 (80 HOURS) Step October 2024 Biweekly October 2025 Biweekly October 2026 Biweekly 1 $ 2,500.00 $ 2,600.00 $ 2,678.00 2 $ 2,575.00 $ 2,678.00 $ 2,758.34 3 $ 2,652.25 $ 2,758.34 $ 2,841.09 4 $ 2,731.82 $ 2,841.09 $ 2,926.32 5 $ 2,813.77 $ 2,926.32 $ 3,014.11 6 $ 2,898.19 $ 3,014.11 $ 3,104.54 7 $ 2,985.13 $ 3,104.54 $ 3,197.67 8 $ 3,074.68 $ 3,197.67 $ 3,293.60 9 $ 3,166.93 $ 3,293.60 $ 3,392.41 10 $ 3,261.93 $ 3,392.41 $ 3,494.18 11 $ 3,359.79 $ 3,494.18 $ 3,599.01 12 $ 3,460.58 $ 3,599.01 $ 3,706.98 13 $ 3,564.40 $ 3,706.98 $ 3,818.19 14 $ 3,671.33 $ 3,818.19 $ 3,932.73 15 $ 3,781.47 $ 3,932.73 $ 4,050.72 61 FIRE MEDIC PAY RANGE 5515 (106/100 HOURS) Step October 2024 Biweekly October 2025 Biweekly October 2026 Biweekly 1 $ 2,615.38 $ 2,720.00 $ 2,801.60 2 $ 2,693.85 $ 2,801.60 $ 2,885.65 3 $ 2,774.66 $ 2,885.65 $ 2,972.22 4 $ 2,857.90 $ 2,972.22 $ 3,061.38 5 $ 2,943.64 $ 3,061.38 $ 3,153.23 6 $ 3,031.95 $ 3,153.23 $ 3,247.82 7 $ 3,122.91 $ 3,247.82 $ 3,345.26 8 $ 3,216.59 $ 3,345.26 $ 3,445.61 9 $ 3,313.09 $ 3,445.61 $ 3,548.98 10 $ 3,412.48 $ 3,548.98 $ 3,655.45 11 $ 3,514.86 $ 3,655.45 $ 3,765.12 12 $ 3,620.30 $ 3,765.12 $ 3,878.07 13 $ 3,728.91 $ 3,878.07 $ 3,994.41 14 $ 3,840.78 $ 3,994.41 $ 4,114.24 15 $ 3,956.00 $ 4,114.24 $ 4,237.67 FIRE INSPECTOR II PAY RANGE 5500 (80 HOURS) Step October 2024 Biweekly October 2025 Biweekly October 2026 Biweekly 1 $ 3,076.92 $ 3,200.00 $ 3,296.00 2 $ 3,169.23 $ 3,296.00 $ 3,394.88 3 $ 3,264.31 $ 3,394.88 $ 3,496.73 4 $ 3,362.24 $ 3,496.73 $ 3,601.63 5 $ 3,463.10 $ 3,601.63 $ 3,709.68 6 $ 3,567.00 $ 3,709.68 $ 3,820.97 7 $ 3,674.01 $ 3,820.97 $ 3,935.60 8 $ 3,784.23 $ 3,935.60 $ 4,053.66 9 $ 3,897.75 $ 4,053.66 $ 4,175.27 10 $ 4,014.69 $ 4,175.27 $ 4,300.53 11 $ 4,135.13 $ 4,300.53 $ 4,429.55 12 $ 4,259.18 $ 4,429.55 $ 4,562.43 13 $ 4,386.96 $ 4,562.43 $ 4,699.31 14 $ 4,518.57 $ 4,699.31 $ 4,840.29 15 $ 4,654.12 $ 4,840.29 $ 4,985.50 62 FIRE LIEUTENANT PAY RANGE 5520 (106/100 HOURS) Step October 2024 Biweekly October 2025 Biweekly October 2026 Biweekly 1 $ 3,115.38 $ 3,240.00 $ 3,337.20 2 $ 3,208.85 $ 3,337.20 $ 3,437.32 3 $ 3,305.11 $ 3,437.32 $ 3,540.44 4 $ 3,404.26 $ 3,540.44 $ 3,646.65 5 $ 3,506.39 $ 3,646.65 $ 3,756.05 6 $ 3,611.58 $ 3,756.05 $ 3,868.73 7 $ 3,719.93 $ 3,868.73 $ 3,984.79 8 $ 3,831.53 $ 3,984.79 $ 4,104.34 9 $ 3,946.48 $ 4,104.34 $ 4,227.47 10 $ 4,064.87 $ 4,227.47 $ 4,354.29 11 $ 4,186.82 $ 4,354.29 $ 4,484.92 12 $ 4,312.42 $ 4,484.92 $ 4,619.47 13 $ 4,441.79 $ 4,619.47 $ 4,758.05 14 $ 4,575.05 $ 4,758.05 $ 4,900.79 15 $ 4,712.30 $ 4,900.79 $ 5,047.81 FIRE MEDIC LIEUTENANT PAY RANGE 5510 (106/100 HOURS) Step October 2024 Biweekly October 2025 Biweekly October 2026 Biweekly 1 $ 3,384.62 $ 3,520.00 $ 3,625.60 2 $ 3,486.15 $ 3,625.60 $ 3,734.37 3 $ 3,590.74 $ 3,734.37 $ 3,846.40 4 $ 3,698.46 $ 3,846.40 $ 3,961.79 5 $ 3,809.41 $ 3,961.79 $ 4,080.64 6 $ 3,923.70 $ 4,080.64 $ 4,203.06 7 $ 4,041.41 $ 4,203.06 $ 4,329.16 8 $ 4,162.65 $ 4,329.16 $ 4,459.03 9 $ 4,287.53 $ 4,459.03 $ 4,592.80 10 $ 4,416.16 $ 4,592.80 $ 4,730.59 11 $ 4,548.64 $ 4,730.59 $ 4,872.50 12 $ 4,685.10 $ 4,872.50 $ 5,018.68 13 $ 4,825.65 $ 5,018.68 $ 5,169.24 14 $ 4,970.42 $ 5,169.24 $ 5,324.32 15 $ 5,119.53 $ 5,324.32 $ 5,484.05 63 ADDENDUM MILITARY AND PRIOR FIREFIGHTER BUYBACK Military and prior firefighter buybacks (1) Buyback of prior fire service. The years or fractional parts of years that a Member previously served as a firefighter for any other municipal, county or state fire department in the State of Florida shall be added to his or her years of credited service provided that: (a) The member contributes to the fund an actuarially determined amount so that the crediting of the purchased service does not result in any cost to the fund plus payment of costs for all professional services rendered to the board in connection with the purchase of years of credited service. A member who does not purchase years of credited service shall be responsible for the payment of costs for all professional services rendered to the board in connection with the purchase of years of credited service. (b) Multiple requests to purchase credited service pursuant to this section may be made at any time prior to retirement. A firefighter member may only purchase prior firefighter service. (c) Payment by the member of the required amount can be made by either lump sum payment or equal biweekly installments. Payment by lump sum shall be made within six months of the request for credit. Payment by payroll deductions shall be in equal biweekly installments for a period which shall not exceed the number of years being purchased. A member making installment payments shall be charged interest based on the actuarially assumed rate of return at the time the purchase is made and shall complete all required payments prior to payment of any benefit under this section. (d) The maximum credit under this section for service other than with the City of Clearwater when combined with credited service purchased pursuant to section (2) military service prior to employment, shall be five years of credited service and shall count for all pension purposes, except vesting and eligibility for disability benefits off-duty. (e) In no event, however, may credited service be purchased pursuant to this section for prior service with any other municipal, county or state fire department, if such prior service forms or will form the basis of a retirement benefit or pension from another retirement system or plan. (f) For purposes of determining credit for prior fire service as a firefighter as provided for in this section, in addition to service as a firefighter in this state, credit may be given for federal, other state, or county service if the firefighter provides proof to the board that such service is equivalent to the service required to meet the definition of a firefighter under section 2.412. (2) Military service prior to employment. The years or fractional parts of years that a firefighter serves or has served on active duty in the military service of the Armed Forces of the United States, the United States Merchant Marine or the United States Coast Guard, voluntarily or involuntarily and honorably or under honorable conditions, prior to first and initial employment with the city of Clearwater fire departments shall be added to his or her years of credited service provided that: (a) The member contributes to the fund an actuarially determined amount so that the crediting of the purchased service does not result in any cost to the fund plus payment of costs for all professional services rendered to the board in connection with the purchase of 64 years of credited service. A member who does not purchase years of credited service shall be responsible for the payment of costs for all professional services rendered to the board in connection with the purchase of years of credited service. (b) Multiple requests to purchase credited service pursuant to this section may be made at any time prior to retirement. (c) Payment by the member of the required amount can be made by either lump sum payment or equal biweekly installments. Payment by lump sum shall be made within six months of the request for credit. Payment by payroll deductions shall be in equal biweekly installments for a period which shall not exceed the number of years being purchased. A member making installment payments shall be charged interest based on the actuarially assumed rate of return at the time the purchase is made and shall complete all required payments prior to payment of any benefit under this section. (d) The maximum credit under this section when combined with credited service purchased pursuant to section (1), buyback of prior fire service for service other than with the City of Clearwater shall be five years. (e) Credited service purchased pursuant to this section shall count for all pension purposes, except vesting and eligibility for disability benefits off-duty. AGREEMENT Between CITY OF CLEARWATER and INTERNATIONAL ASSOCIATION OF FIRE FIGHTERS, AFL-CIO Local 1158 Fiscal Years 2024-2025 2025-2026 2026-2027 Our Mission is to work cooperatively with labor and management to provide cost effective, top quality Emergency services while ensuring and improving the safety and benefits for our Members i Page No. Table of Contents ........................................................................................................................ i-iv Preamble ............................................................................................................................1 ARTICLE 1 Recognition and General Provisions ..............................................................1 Section 1 Exclusive Bargaining Agent ..............................................................................1 Section 2 New Classifications ...........................................................................................1 Section 3 Contract Constitutes Entire Agreement .............................................................1 ARTICLE 2 Representatives of Parties ...............................................................................2 ARTICLE 3 Rights of Parties ........................................................................................... 2-5 Section 1 Management Rights ...........................................................................................2 Section 2 Emergency Conditions .......................................................................................2 Section 3 Union Rights ......................................................................................................3 Stewards .............................................................................................................3 Checkoff .............................................................................................................3 Posting of Agreement ........................................................................................3 Bulletin Boards ..................................................................................................3 Employee Orientation ........................................................................................4 Section 4 No Discrimination ..............................................................................................4 Section 5. Disability Retirement Process ............................................................................5 ARTICLE 4 No Strike ...........................................................................................................5 ARTICLE 5 Labor-Management Cooperation ...................................................................6 ARTICLE 6 Grievance Procedure ................................................................................... 6-8 Section 1 Definition ...........................................................................................................6 Section 2 Filing Procedures ........................................................................................... 6-7 Section 3 Arbitration ..........................................................................................................8 Section 4 Grievance Initiated by the City ..........................................................................8 Section 5 Time Limit Exceptions ......................................................................................8 Section 6 Grievance Initiated by Employee .......................................................................8 ARTICLE 7 Personnel Practices .................................................................................... 9-29 Section 1 Work Schedule ...................................................................................................9 Section 2 Assignments .....................................................................................................10 ii ARTICLE 7 Personnel Practices (cont.) Page No. Section 3 Extra Pay Assignment ................................................................................ 10-14 Section 4 Exchange of Duty Time (Swaps) ............................................................... 14-15 Section 5 Call-In, Holdover, and Court Time ............................................................ 15-16 Section 6 Daylight Savings Time ....................................................................................16 Section 7 State EOC/FEMA Deployment........................................................................16 Section 8 Pay Plan Administration ............................................................................ 16-18 Promotions ................................................................................................. 16-17 Demotions ........................................................................................................17 Acting Pay .................................................................................................. 17-18 Fair Labor Standards Exemption .....................................................................18 Section 9 Promotional Process................................................................................... 18-20 Announcements................................................................................................18 Eligibility .........................................................................................................18 Disqualification of Applicants .........................................................................19 Scope and Character of Evaluation Process.....................................................19 Notification of Results .....................................................................................20 Appeals from Ratings ......................................................................................20 Section 10 Open and Promotional Eligibility Lists ...........................................................20 Section 11 Appointments ............................................................................................. 20-21 Section 12 Probation ..........................................................................................................21 Section 13 Light Duty .................................................................................................. 21-22 Section 14 Line-of-Duty Injury Pay ............................................................................ 22-23 Section 15 EMS Classifications ................................................................................... 24-25 Section 16 Firefighter/Driver-Operator ....................................................................... 25-26 Section 17 Work Rules and Prevailing Rights ...................................................................26 Section 18 Subcontracting .................................................................................................26 Section 19 Indemnification ................................................................................................27 Section 20 Sports Activities On Duty ................................................................................27 Section 21 Lawn Maintenance ...........................................................................................27 Section 22 Physical Examination................................................................................. 27-28 Frequency of Physicals ....................................................................................27 iii ARTICLE 7 Personnel Practices (cont.) Page No. Sect 22 (cont.) Types of Exams................................................................................................27 Immunizations and Inoculations ................................................................ 27-28 Physical Fitness ................................................................................................28 Department Physician ......................................................................................28 Wellness Re-Opener ........................................................................................28 Section 23 Employee Fitness & Wellness Incentive ................................................... 28-29 Section 24 Residency Requirement ...................................................................................29 Section 25 Tobacco Product Usage ...................................................................................29 ARTICLE 8 Leaves of Absence .................................................................................... 29-45 Section 1 Holidays ..................................................................................................... 29-31 Observed Holidays ..................................................................................... 29-30 Floating Holidays .............................................................................................30 Selection of Floating Holidays.........................................................................30 Payment for Floating Holidays ........................................................................31 Conversion of Floating Holidays to Personal Leave .......................................31 Section 2 Vacations.................................................................................................... 31-36 Accrual of Vacation Leave ........................................................................ 31-33 Use of Vacation Leave ............................................................................... 33-35 Accrual During Military Leave ........................................................................35 Conversion to Other Leave ........................................................................ 35-36 Payment for Unused Vacation .........................................................................36 Banking of Vacation ........................................................................................36 Section 3 Sick Leave .................................................................................................. 36-40 Accrual of Sick Leave ................................................................................ 36-38 Payment for Unused Sick Leave ................................................................ 38-39 Sick Leave Incentive Program .........................................................................39 Sick Leave Pool ......................................................................................... 39-40 Section 4 Funeral Leave...................................................................................................41 Section 5 Absence Without Leave ...................................................................................41 Section 6 Time Off From Duty .................................................................................. 41-42 Section 7 Right to Contribute Work ................................................................................42 iv Section 8 Military Leave ............................................................................................ 42-44 Section 9 Parental Leave ..................................................................................................45 ARTICLE 9 Wages and Compensation ....................................................................... 46-52 Section 1 Pay Schedule ....................................................................................................46 Section 2 Pay Schedule Format ................................................................................. 46-47 Section 3 Merit Pay Review ............................................................................................47 Section 4 Rates of Pay .....................................................................................................47 Section 5 Annual Personal Resource Allowance .............................................................47 Section 6 Mileage Reimbursement ............................................................................ 47-48 Section 7 Special Teams ..................................................................................................48 Section 8 EMS Wages .....................................................................................................49 Section 9 Training and Tuition Refund ..................................................................... 49-50 Section 10 Clothing and Equipment ............................................................................ 50-52 Section 11 Standby ............................................................................................................52 Section 12 Paycheck Issuance ...........................................................................................52 ARTICLE 10 Insurance ........................................................................................................53 ARTICLE 11 Performance and Discipline ..........................................................................54 ARTICLE 12 Drug and Alcohol Policy ................................................................................54 ARTICLE 13 Retirement ......................................................................................................55 ARTICLE 14 Seniority, Layoff, and Recall................................................................... 55-57 Section 1 Seniority ..................................................................................................... 55-56 Section 2 Layoffs ....................................................................................................... 56-57 Section 3 Reemployment Rights ......................................................................................57 Section 4 30-Day Notification .........................................................................................57 ARTICLE 15 Duration, Modification, and Termination ............................................. 58-59 Section 1 Amendments ....................................................................................................58 Section 2 Severability and Waiver ...................................................................................58 Section 3 Duration ...........................................................................................................59 Signature Page .......................................................................................................................59 Appendix A Wages ........................................................................................................ 60-62 1 PREAMBLE This Agreement is entered into by the City of Clearwater, Florida, hereinafter referred to as the "City," and Local 1158 of the International Association of Fire Fighters, AFL-CIO, hereinafter referred to as the "Union". The Agreement has been negotiated in good faith for the purpose of promoting harmonious relations, establishing an orderly and peaceful procedure to settle differences which might arise, and setting forth the basic and full agreement between the parties concerning wages, rates of pay, hours of work, and all other terms and conditions of employment. ARTICLE 1 RECOGNITION AND GENERAL PROVISIONS Section 1. Exclusive Bargaining Agent The City recognizes the Union as the exclusive bargaining representative in accordance with Chapter 447, Florida Statutes, as amended, for all employees in the bargaining unit defined by the Public Employees Relations Commission and issued Certification number 122 in Case No. SH-RA-756-1129 dated September 3, 1975. All persons in the classifications designated Firefighter, Firefighter/Driver-Operator, Fire Medic, Fire Lieutenant, Fire Medic Lieutenant, Fire Inspector I, Fire Inspector II, and Fire Prevention Inspector shall be included in the bargaining unit. All others shall be excluded. Any incumbent of the Fire Prevention Inspector job classification as of the effective date of this Agreement shall be permitted to maintain such job classification designation. There shall be no further bargaining unit members allocated to the Fire Prevention Inspector job classification after the effective date of this Agreement. Section 2. New Classifications Should the City and the Union agree to establish new job classifications within the Fire Department which may be in the bargaining unit, the City shall provide notice to the Union not less than 30 days prior to staffing such classification. The parties shall submit a Unit Clarification Petition to the Public Employees Relations Commission and shall negotiate appropriate wage rates, hours, and terms and conditions of employment for such classification. Section 3. Contract Constitutes Entire Agreement of the Parties This Agreement contains the entire contract, understanding, undertaking, and agreement of the parties hereto, and finally determines and settles all matters of collective bargaining for and during its term, except regarding the City's Pension Plan and as may be otherwise specifically provided herein. The Parties agree to bargain proposed changes to the City's Pension Plan at the same time that bargaining occurs for this agreement and successor agreements. 2 ARTICLE 2 REPRESENTATIVES OF PARTIES Section 1. The City agrees that during the term of this Agreement it will deal only with the authorized representatives of the Union in matters requiring mutual consent or other official action called for by this Agreement. Authorized representatives shall be defined as the elected Officers of the Union and duly elected or appointed stewards. The Union agrees to notify the City of the name of such authorized representatives as of the execution of this agreement, and any change in elected Officers or appointed stewards shall be provided by the Union to the Office of the Fire Chief within 72 hours of the change. Section 2. The Union likewise agrees that during the term of this Agreement the Union and the employees covered hereunder shall deal only with the City Manager or his/her representative in matters requiring mutual consent or other official action. The Union specifically agrees that neither the Union nor the employees covered hereunder shall seek to involve the City's elected officials in the administration of this Agreement or otherwise in the operation of the City's Fire Department; provided that nothing contained herein shall restrict an employee's opportunity to present non-employment related matters to such elected officials. ARTICLE 3 RIGHTS OF PARTIES Section 1. Management Rights Except as expressly limited by any provision of this Agreement, the City reserves and retains exclusively all of its normal and inherent rights with respect to the management of its operations, whether exercised or not, including, but not limited to, its rights to determine, and from time to time redetermine, the number, location and type of its various operations, functions and services; the methods, procedures and policies to be employed; to discontinue the conduct of any operations, functions or services, in whole or in part; to transfer its operations, functions or services from or to, either in whole or in part, any of its departments or other divisions; to select and direct the working force in accordance with requirements determined by the City; to create, modify or discontinue job classifications; to establish and change working rules and regulations; to establish and change work schedules and assignments; to transfer, promote or demote employees; to lay off, furlough, terminate or otherwise relieve employees from work for lack of work, lack of funds, or other legitimate reason; to suspend, discharge or otherwise discipline employees for proper cause; to alter or vary past practices and otherwise to take such measures as the City may determine to be necessary to the orderly and efficient operation of its various operations, functions and/or services. Section 2. Emergency Conditions If in the sole discretion of the City Manager or Mayor it is determined that civil emergency conditions exist, including, but not limited to, riots, civil disorders, strikes, hurricane conditions, or similar catastrophes or disorders, the provisions of this Agreement may be suspended by the City Manager or Mayor during the term of the declared emergency provided that wage rates and other direct monetary payments shall not be suspended. 3 Section 3. Union Rights A. Stewards: There shall be one (1) Union Official or designee for all bargaining unit members on each shift for line personnel and one additional Union Official or designee for Fire Prevention personnel. An employee working on duty shall be represented by the respective (line or inspection) "on-duty" representative or other union official. An employee having a grievance shall have the right to take the matter up with his/her Shift Steward or other Union Officer during working time, provided that neither the employee nor the Shift Steward may leave their assigned Fire Station or work area outside a Fire Station without prior permission of the Fire Chief or his/her specifically designated representative, and, provided further, that the employee and the Union Official shall not interfere with the normal operations of the Department. It shall be the employee's responsibility to obtain a representative when the Fire Chief or his/her designee determines that the on-duty representative cannot be made available due to operational demands. All members of the bargaining unit may wear the I.A.F.F. pin on their uniforms. B. Checkoff: The City shall deduct and provide to the Union on a biweekly basis dues and uniform assessments owed by the employee to the Union in an amount certified to be correct by the Union Secretary-Treasurer. Prior to such deduction. the Union shall provide the City with a signed statement from each employee authorizing such deduction in a form satisfactory to the City. Any authorization for dues deduction may be canceled by the employee upon 30 days written notice to the City and the Union. The Union shall indemnify, defend and hold the City, its officers, officials, agents, and employees harmless against any claim, demand, suit, or liability (monetary or otherwise) and for all legal costs arising from any action taken or not taken by the City, its officials, agents, and employees correctly complying with this Section. The Union shall promptly refund to the City any funds received in accordance with this Agreement which are in excess of the amount of basic and uniform membership dues which the City has agreed to deduct. Nothing contained herein shall require the City to deduct from a salary or be otherwise involved in the collection of Union fines, penalties or special assessments. In the event an employee's salary earnings within any pay period, after deductions for withholding, pension or social security, health and/or other standard deductions, are not sufficient to cover dues it will be the responsibility of the Union to collect its dues for that pay period from the employee. C. Posting of Agreement: In accordance with the City’s Greenprint Sustainability Plan, the City and the Union agree that this Agreement shall be posted by the City on the City’s Launchpad and Website. D. Bulletin Boards: The City agrees to provide a 2 feet x 4 feet space on bulletin boards at each Fire Station for posting by the Union of notices of meetings or other official Union information; provided, the Fire District Commander or his/her designee shall first review such posting, and if found to be outside of the scope of this Section, such posting shall be modified to the mutual agreement of the parties. The Fire District Commander will continue to include the Union notices in the intra-departmental mail which he/she delivers to the stations. 4 E. Employee Orientation: The City shall permit the Union to make a presentation to all new bargaining unit members at the City new employee orientation. Subject matter of the Union presentation and any Union materials to be distributed must be approved by the City Manager or his/her designee. Section 4. No Discrimination The City and the Union specifically agree that the provisions of this Agreement shall be equally applicable to all employees covered herein without regard to race, color, religion, sex, national origin, membership or non-membership in labor organization, sexual orientation, or age, as provided by law. Any claim of discrimination under Federal or State civil rights laws by an employee against the City, its officers or representatives shall not be grievable or arbitrable under the provisions of Article 6 but shall be subject only to the method of review prescribed by law. Nothing herein contained shall preclude the right of an employee to grieve and arbitrate disciplinary action taken by the City, except as otherwise herein provided. Section 5. Disability Retirement Process Upon receipt of a complete application for a disability pension, which includes the most recent medical conclusions known to the applicant at the time of submittal, the City shall request and obtain an independent medical evaluation (“IME”). If disabilities are claimed that involve multiple specialties, one IME per specialty shall be selected. Any costs directly or indirectly relating to IME’s shall be paid by the pension plan. After receiving the completed IME report(s), the application and any other records the City deems relevant to the application, the City Attorney’s Office shall either review or arrange for outside legal counsel to review, on behalf of the City, the merits of the application. The City Attorney’s Office, or legal counsel hired by the City Attorney’s Office for this purpose, shall recommend to the City Manager either a stipulated approval or an evidentiary hearing. The City Manager shall take the recommendation under advisement and consider any other factors he/she deems relevant to the application and determine on behalf of the City whether to enter a stipulated approval, or whether to schedule an evidentiary hearing. If the City Manager enters into a stipulated approval, an agenda item shall be brought before the Pension Trustees confirming the stipulation. The role of the Pension Trustees in said approval shall be ministerial in nature. Upon approval by the Pension Trustees, the City shall finalize and distribute the disability pension benefits to which the applicant is entitled. If the City Manager opts for an evidentiary hearing, the hearing shall be conducted by the State of Florida Division of Administrative Hearings (“DOAH”). The Pension Trustees will enter into a contract with DOAH for this purpose. It shall be the duty of the hearing officer to review the application for a disability retirement, determine whether the claim meets the criteria for awarding a disability pension benefit, and issue a recommended order. During the formal hearing, the applicant and City shall have the right to be heard, to be represented by a person of their choice, and to present evidentiary facts. Each party shall pay its own expense for its representative, counsel, and witnesses. At the formal hearing, the technical rules of evidence shall not apply. The hearing officer shall have the power to administer oaths, issue subpoenas, compel the production of books, papers and other documents and receive evidence. The hearing officer shall utilize a procedure similar to that set forth in F.S. §§ 120.569 and 120.57. The hearing officer shall have no authority to award attorney’s fees to the prevailing party. 5 All recommended orders prepared by the hearing officer shall conform with the requirements for such orders as set forth in F.S. §§ 120.569 and 120.57. The hearing officer shall then transmit the recommended order composed of findings of fact, conclusions of law, and disposition to the Pension Trustees. The Pension Trustees may adopt the recommended order as the final order. The Pension Trustees in its final order may reject or modify the conclusions of law over which it has substantive jurisdiction and interpretation of administrative rules over which it has substantive jurisdiction. When rejecting or modifying such conclusion of law or interpretation of administrative rule, the Pension Trustees must state with particularity its reasons for rejecting or modifying such conclusion of law or interpretation of administrative rule and must make a finding that its substituted conclusion of law or interpretation of administrative rule is as or more reasonable than that which was rejected or modified. Rejection or modification of conclusions of law may not form the basis for rejection or modification of findings of fact. The Pension Trustees may not reject or modify the findings of fact unless the Pension Trustees first determines from a review of the entire record, and states with particularity in the order, that the findings of fact were not based upon competent substantial evidence or that the proceedings on which the findings were based did not comply with essential requirements of law. The Pension Trustees may accept the recommendation in the recommended order but may not reduce or increase it without a review of the complete record and without stating with particularity its reasons therefore in the order, by citing to the record in justifying the action. Any party adversely affected shall have the right to have the administrative proceeding reviewed by filing a petition for certiorari with the circuit court of Pinellas County as provided by Rule 9.100 of the Florida Rules of Appellate Procedure. ARTICLE 4 NO STRIKE Section 1. The Union agrees that during the term of this Agreement, it shall not authorize, instigate, condone, excuse, ratify or support any strike, slowdown, sit-down, work stoppage or any other act of like or similar nature likely to interfere with the efficient operation of the City's affairs engaged in or supported by members of the Union and/or employees represented by the Union or other agents or representatives of the Union. The parties specifically incorporate herein the provisions of FS. 447.505, 447.507 and 447.509. Section 2. Should the Union or employees covered by this Agreement within the City's Fire Department breach this Article, the City may then proceed against the Union as covered in FS 447 and such sections of state and federal law that may apply. The City would also be entitled to obtain an injunction with notice at ex-parte hearing for breach of this Article. Section 3. Should any member of the bargaining unit be found guilty of striking as defined in Chapter 447, Florida Statutes, he/she shall be subject to dismissal, and it is expressly agreed that such violation constitutes just cause for dismissal. 6 ARTICLE 5 LABOR-MANAGEMENT COOPERATION A. The City and Union agree to maintain a cooperative Labor/Management committee for the IAFF Local 1158 bargaining units. The committee shall consist of an equal number of members of each party not to exceed a total of eight (8) members. It is understood that this committee in no way is a substitute for the grievance procedure or the right of collective bargaining but has been established for the purpose of discussion and input from both sides on matters that may be mutually resolved by the parties or may eventually become items of collective bargaining, grievances, or litigation. The Labor/Management Committee will meet quarterly or as deemed necessary by the Committee. Either side may cancel a meeting with 24-hours notice. A cancelled meeting may be rescheduled with mutual consent. The Committee will draft bylaws addressing administrative protocols. Adoption and any changes to bylaws shall require a simple majority vote among all members of the Committee. The City will maintain a written brief summary of the events of the meetings. The Union will be permitted to add comments to the summary if necessary. B. Department Safety Committee 1. Authority. The Clearwater Fire and Rescue Occupational Health and Safety Committee shall be established in accordance with the direction as outlined in Florida Stature 633.810, "Workplace safety committees and safety coordinators." 2. Membership. The committee shall be made up of an equal number of bargaining unit members to be appointed by the Union and Fire Department management staff officers to be appointed by the Fire Chief or his/her designee, not to exceed a total of eight members. 3. Workplace Safety Coordinator. A Clearwater Fire and Rescue Chief Officer shall be designated as the department Workplace Safety Coordinator for the purpose of chairing the committee and providing administrative support. 4. Meetings. Upon approval of this agreement by the City Council, the committee shall meet within thirty calendar days thereafter to establish those duties and procedures as outlined in, but not limited to, Florida Statute 633.810, and as approved by the Fire Chief or his/her designee. ARTICLE 6 GRIEVANCE PROCEDURE Section 1. A grievance shall be defined as any difference, dispute or complaint regarding the interpretation or application of the terms of this Agreement, except as exclusions are noted in other articles of this Agreement. The grieving party must state in writing the remedy sought to resolve the grievance. Section 2. All grievances filed shall be submitted on the appropriate form (City form #9900-0061, IAFF Grievance Form), and shall refer to the specific Article and section of this Agreement upon which the grievance is based, and shall contain a concise written statement of the facts alleged to support the grievance, and shall be signed by the grievant or representative. A Grievant may be accompanied by a representative of the 7 Union at any time during the Grievance Procedure. Newly hired probationary employees shall not have access to the Grievance Procedure for any matter of discipline (including discharge), assignments, scheduling, or access to training opportunities during the probationary period. Any grievance by a permanent employee relating to suspension or dismissal shall be initiated at Step 2. On behalf of employees covered by this Agreement, the Union hereby waives all rights of these employees to utilize and appeal to the Civil Service Board concerning any matter defined in this Agreement. This shall specifically include appeals and grievances relating to suspensions, demotions and dismissals. Grievances may be filed and processed by the Union except grievances of discipline that must be initiated by the disciplined employee. As used in this Article, the term "employee" may also mean a group of employees having the same grievance. In such event, one employee shall be designated by the group of employees to act as a spokesperson and shall be responsible for processing the grievance. All employees in the group shall be identified, however only the spokesperson needs to sign the grievance. For purposes of this Grievance Procedure, normal working hours shall be considered 8:00 a.m. to 5:00 p.m. and normal workdays shall be considered Monday through Friday, holidays excepted. STEP l The grievant shall present his/her grievance in writing to their Fire District Commander or Fire Marshal within 30 calendar days after the grievant has knowledge or constructive knowledge of the occurrence of the action giving rise to the grievance. The Fire District Commander or Fire Marshal shall arrange for a meeting with the grievant within 14 calendar days of receipt of the grievance. Discussions will be informal for the purpose of settling differences in the simplest and most direct manner. The Fire District Commander or Fire Marshal shall review the grievance and submit a decision in writing to the grievant within 30 calendar days from the date of the meeting. If the grievance is not resolved at Step 1, the grievance may be appealed to Step 2. STEP 2 If the grievance is not settled at the first step, the grievant shall, within 30 calendar days of the date of written notification from the Fire District Commander or Fire Marshal, present the written grievance to the Fire Chief or designee. The Fire Chief or designee shall obtain the facts concerning the alleged grievance and shall, within 14 calendar days following receipt of the written grievance, meet with the grievant. The Fire Chief or designee shall review the grievance and notify the grievant of his/her decision in writing not later than 30 calendar days following the meeting day. If the grievance is not resolved at Step 2, the grievance may be appealed to Step 3. STEP 3 If still unresolved, the grievance may be submitted to the City Manager or designee within 30 calendar days of the date of written notification from the Fire Chief or designee. At the request of the grievant, the City Manager or designee shall meet with the grievant. The grievant must make this request to meet with the City Manager at the time of submission of the grievance to the City Manager or designee. If so requested, the City Manager or designee shall arrange a meeting with the grievant within 30 calendar days of the request. The City may determine who shall meet with the employee. Within 30 calendar days of the meeting, the City Manager or designee shall notify the employee, in writing, of their decision. 8 If no meeting is requested by the grievant at the time of submission of the grievance to the City Manager or designee, the City Manager or designee shall notify the employee of their decision in writing within 30 calendar days of receipt of the grievance. If a grievance is not submitted to the City Manager or designee, it shall be deemed to have been resolved at Step 2 to the grievant’s satisfaction. The City shall notify the Union in writing of any change in the City Manager's designee for the receipt or hearing of grievances. Section 3. In the event that the grievance is still unresolved, the matter may be submitted to final and binding arbitration as provided in this section. · A. Within 30 calendar days of the decision of the City Manager, the aggrieved party shall notify the City Manager of their intent to arbitrate. Within 30 calendar days of the notice of intent to arbitrate, said party shall request from the Federal Mediation and Conciliation Service a list of seven names of qualified arbitrators. Each party shall have the right to unilaterally reject one list of arbitrators received from FMCS. Thereafter, a list may only be rejected by mutual consent of the parties. Within 21 calendar days after the receipt of such a list, representatives of the parties shall meet and each party shall strike three names. A flip of the coin shall determine who shall strike the first name, and then the other party shall strike a name. The process shall then be repeated until one name remains and the remaining name shall be the arbitrator selected and notified of his/her selection as arbitrator. As promptly as can be arranged but not more than 60 calendar days unless mutually agreed by the City and Union, the arbitration hearing shall be held. Each party shall pay its own expense for its representative, counsel and witnesses. The charges of the arbitrator shall be shared equally by the City and the aggrieved party. The decision of the arbitrator shall be final and binding on both parties, except that either party may seek review as provided by law. The arbitrator shall have no power to add to, subtract from, modify or alter the terms of this Agreement. B. Copies of the decision of the arbitrator made in accordance with the jurisdiction and authority of this Agreement shall be furnished to both parties within 30 calendar days from the close of the hearing or as otherwise agreed to by both parties. Section 4. Formal Processing of Grievance Initiated By The City Where any provision of this Agreement involves responsibility on the part of the Union which, in the view of the City, is not properly being carried out, the City may present the issue to the Union as a grievance. If such grievance cannot be resolved by discussion between the City and the unit representative on an informal basis, the grievance may be formally filed in writing by the City Manager or his/her designee by giving written notice to the business agent of the Union. Such notice shall indicate the provision(s) of the Agreement which the City contends is/are not properly being carried out by the Union. If not resolved within 30 work days following receipt by the Union of the written grievance, the City may submit the grievance to arbitration under the provisions of Section 3 of this Article. Section 5. All of the time limits contained in this Article may be extended by mutual written consent of the parties. If the grievant fails to submit or advance a grievance at any step in the process within the prescribed time limit as defined above, the written determination received by the grievant from the respondent at the prior step shall be considered accepted by the grievant, and the grievance shall be considered resolved. If the City fails to respond to a grievant at any step in the process within the prescribed time limit as defined above, the Union may advance the grievance to the next step in the process. Section 6. If an employee chooses to process their own grievance, the Union must be invited to attend any meeting where the resolution of the grievance may occur. FS 447.301(4). 9 ARTICLE 7 PERSONNEL PRACTICES Section 1. Work Schedule A. Hours and Days of Work: Shifts shall start at 8:00 A.M. each work day and end at 8:00 AM. the following morning. Total: 24 hours. Coverage shall consist of three shifts: "A", "B", and "C", which will work in the following rotation (see sample monthly work schedule below): Sunday Monday Tuesday Wednesday Thursday Friday Saturday 1 work 2 off 3 work 4 off 5 work 6 off 7 off 8 off 9 off 10 work 11 off 12 work 13 off 14 work 15 off 16 off 17 off 18 off 19 work 20 off 21 work 22 off 23 work 24 off 25 off 26 off 27 off 28 work 29 off 30 work, etc. B. Inspection Division: Fire Inspectors will work 7:30 AM. to 4:00 P.M., Monday through Friday, with a 30-minute lunch break for each inspector. The Chief reserves the right to assign the necessary personnel to each shift which, in his/her judgment, provides for most effective departmental operations. C. Kelly Days: 1. Employees will be awarded a Kelly Day after every 18 days worked. This means they will be scheduled to work 18 consecutive shift days and will be scheduled off the 19th scheduled shift day. This will result in a 53.0526 hour average work week. Effective no later than the first day of the payroll period that includes October 1, 2026, employees will be awarded a Kelly Day after every 8 days worked. This means employees will be scheduled to work 8 consecutive shift days and will be scheduled off the 9th scheduled shift day. This will result in a 50.3077- hour average work week. 2. Kelly Day rotations for each position will be determined by the Department. Individual employees Kelly Day rotations will not be changed except when an employee changes job classification or shift. It is understood that when an employee changes job classification or shift, he/she will be assigned to the Kelly Day rotation for the position being filled. Employees may exchange Kelly Days in accordance with the procedures for exchanges of on-duty time as set forth in Article 7, Section 4 of this Agreement. A Kelly Day may be exchanged only one time between two employees, and once exchanged may not be exchanged again thereafter with another employee 3. When a Kelly Day occurs within a block of days that have been selected by an employee for vacation, the Kelly Day shall not be counted against the employee's vacation leave accrual balance and the vacation leave hours may be used toward a single vacation day request instead. The single vacation day in such case may be submitted during the vacation pick process after the two rounds of vacation "block" selections and before the selection of any "bonus" days, floating holidays, or sick leave incentive days. The single vacation day may also be submitted at any time during the year, subject to availability and the operational demands of the Department, in accordance with Article 8, Section 2, B of this Agreement. 10 Section 2. Assignments A. New and existing employees may be reassigned for Light Duty, training, out-of-area deployments, or voluntary special project opportunities. Employees shall continue to be paid their standard biweekly pay during such assignments. All hours actually worked during such assignments shall be counted toward the calculation of overtime at the end of the established FLSA cycle in accordance with Article 7, Section 8, D. B. Additional work hours assigned through the Mandatory list and Relief list for staffing of response units (seat pay), and for staffing of special events units, shall be paid at the overtime rate as defined in Article 9 Section 4. All other hours worked shall be compensated in accordance with the Federal Fair Labor Standards Act. Section 3. Extra Pay Assignments Department policy may require the scheduling of Extra Pay and/or mandatory Holdover assignments. The department shall attempt to equalize Extra Pay and mandatory Holdover to the extent practicable. The selection of certified and/or individuals who possess specialty qualification(s) may be required and shall be allowed. The Fire Chief shall determine the method(s) for administering Extra Pay and mandatory Holdover provided that methods used shall be in compliance with the requirements herein. Extra Pay and mandatory Holdover administration shall be coordinated at the Fire District Commander level except as otherwise assigned by the Fire Chief or his/her designee. Upon ratification of this agreement, the department shall have up to 90 days to implement the methodology for Extra Pay and mandatory Holdover administration contained herein. During the implementation period, all practices and procedures currently in effect shall be maintained. Extra Pay work shall be defined as that time worked by an employee in addition to the employees regularly scheduled hours where the employee is assigned through the TeleStaff Sign-up list and Mandatory Holdover list for staffing of response units (seat pay; for staffing of special events units, and shall be compensated at the overtime rate as defined in Article 9 Section 4. All other hours worked shall be compensated in accordance with the Federal Fair Labor Standards Act. A. Extra Pay Signup 1. Employees shall be responsible for signing up for Extra Pay eligibility on the specific days they elect to work Extra Pay. Employees may sign up to work only from 0800-2000; or only from 2000-0800; or both time periods. Employees may modify their sign-up to include a specific time-frame. Employees will only be considered for Extra Pay vacancies that span the time frame included in the sign-up. Sign-up access shall be available at each fire station, through the TeleStaff program. 2. Personnel may sign-up, or remove a sign-up, at any time prior to the filling of Extra Pay vacancies. The department may begin filling Extra Pay vacancies as the vacancies become known Extra Pay Vacancies in a three-shift work cycle ("Trick") may be filled anytime after the start of the three-shift work cycle that immediately precedes the work cycle where the vacancies exist. 3. Personnel shall be responsible for maintaining their Extra Pay contact numbers in a manner so that an employee can be contacted. 11 B. Extra Pay Credits 1. Employees shall be assigned credits hour for hour based on the Extra Pay hours worked in a regular shift assignment. 2. Employees who sign-up for Extra Pay and then refuse an Extra Pay offer when contacted between 07:00 and 08:00 hours on the morning where the Extra Pay vacancy occurs, shall be assigned credits equaling the number of hours of the Extra Pay vacancy. No credits shall be added for a refusal after 08:00 hours. No credits shall be added for refusal of shifts less than 12 hours. Inability to contact an employee who has signed up for Extra Pay shall not be cause for adding credits. 3. New employees shall be eligible for Extra Pay assignment after six months of continuous service. These employees shall be assigned a number of credits equal to the average accumulated by all employees in the same classification at that time. 4. Extra Pay credits shall not be carried over from year to year and shall be zeroed out effective January 1 of each year. Initial Extra Pay assignments at the start of each year shall be made on the basis of Department seniority among employees in the same classification. Should two or more employees have the same seniority they shall initially be arranged on the list alphabetically by last name. 5. The department shall maintain overtime credit lists as referenced in the various sections of this article. In addition, the department shall maintain a master Credits list to include all personnel from all shifts, which shall include all types of Extra Pay work. The credit lists shall be used to equalize Extra Pay to the best extent possible. All lists maintained by the Department are maintained in the TeleStaff Program, which is available to all users shall be made available to the Union upon request. C. Shift Extra Pay Selection Procedures 1. The Fire District Commander shall be responsible for the assignment of on-duty personnel to provide adequate staffing according to the Department's minimum staffing requirements. Employees who are on current promotion eligibility lists or who are placed on established "Acting" eligibility lists upon meeting the minimum qualifications and having been deemed qualified by the Department for the necessary classification shall be transferred, assigned laterally, or utilized in an Acting capacity prior to the scheduling of Extra Pay. However, if an employee has taken the most recent promotional exam for that position and not passed, they shall not be deemed as meeting qualifications. Employees shall be chosen who will result in the least amount of disruption to operations. The Department will attempt to equalize acting opportunities among eligible employees to the extent practicable. When the number of on-duty personnel is sufficient to provide coverage to meet the Department's minimum staffing requirements, no assignment of an individual to an Acting capacity shall occur if it will result in the necessity of Extra Pay 2. When the Department determines that a operational vacancy requires Extra Pay, the Fire District Commander shall initiate procedures to offer the Extra Pay assignment to personnel who are signed up for the that vacancy period. When the Extra Pay vacancy is filled greater than 12 hours prior to the start of the shift where the vacancy exists, Extra Pay offers shall be made in the following order: a. Qualified personnel who hold the same classification as the position necessitating the Extra Pay; sorted by least number of credits; then department seniority; then alphabetical order of surname. b. Qualified personnel who are deemed qualified to act either up or down in the position necessitating the Extra Pay; sorted by least number of credits; then department seniority; then 12 alphabetically by last name. c. Employees will have the first right of refusal to work the Extra Pay shift (24 hours) on their assigned Kelly Day, provided the employee has signed up for Extra Pay. 3. If none of the employees who hold the same classification as the Extra Pay vacancy (paragraphs 2a, above) accept the Extra Pay offer, the Fire District Commander shall have the option to fill that vacancy with on-duty personnel who are deemed qualified to act in that position, and then backfill the resulting vacancy. The Department shall not be obligated to fill the vacancy with an employee who signs-up after this option is implemented. Employees who have failed the most recent promotional exam for the position on shall not be deemed qualified to act in that position. 4. When an Extra Pay vacancy occurs following 1700 hours on the previous shift (same shift-label as the vacancy); the Fire District Commander shall be permitted to fill the Extra Pay at the level of classification of that vacancy. 5. When a vacancy occurs on short-notice and affects operations by placing apparatus below minimum staffing levels, the Fire District Commander may fill the vacancy in the most expeditious manner available at that time, in the manner as close to the regular established procedures (in paragraph C.2. above) as possible. 6. If an employee cancels leave that had created a vacancy, the Extra Pay employees who were selected to fill that vacancy may be cancelled regardless of credits or seniority. There will be no credits assigned to employees who are cancelled. 7. Short-term Extra Pay vacancies created by travel between stations and other short duration events that occur at shift change will be filled by the employee from the previous shift that is in the position creating the vacancy. That employee may arrange for another employee to holdover, subject to approval by the applicable Fire District Commander. D. Mandatory Holdover Extra Pay 1. The Mandatory Holdover Extra Pay procedures will be utilized by the Department when vacancies cannot be staffed with Shift Extra Pay Selection procedures (Para C. above); however, Mandatory Holdover Extra pay shall not be applied until the shift before the Extra Pay vacancy will occur. Mandatory Holdover Extra Pay assignments will be rotated among all employees in accordance with the employee's respective job classification and shift. Employee names will be initially arranged at the first of each year on the Mandatory Extra Pay list by job classification in the order of least senior to most senior. 2. Mandatory Holdover Extra Pay assignments will not exceed 12 hours in duration. Start and end times will be determined by the Fire District Commander. 3. When the need to utilize Mandatory Holdover Extra Pay arises, the Fire District Commander will first use the Mandatory Holdover Extra Pay list from the shift working the day previous to the Holdover Extra Pay vacancy. Employees shall be chosen from the same classification as the vacancy creating the Holdover. Exceptions to the same-classification clause may be made when a vacancy requires a specialty that cannot be fulfilled using same-classification. 3. The list will be utilized in descending order using the first employee in that classification that is qualified to fill the position creating the vacancy. Employees not present at shift change due to approved leave will be bypassed and their position on the list will remain the same. 13 4. An employee selected for Mandatory Holdover Extra Pay assignment will have the opportunity to arrange for a substitute to fill the assignment. The substitute must be approved by the applicable Fire District Commander. The employee who was initially assigned Mandatory Holdover Extra Pay shall not be relieved of duty until approval for the substitution is issued by the Fire District Commander. When an approved substitute fulfils the Mandatory Holdover Extra Pay assignment, the employee initially subject to the assignment will be moved to the bottom of the list and the position of the substitute employee will remain unchanged on the list. 5. An employee who will not be present at their next-shift start time due to scheduled approved leave will not be subject to assignment from the Mandatory Holdover Extra Pay list from the end of his/her last shift immediately preceding the leave, until the start of his/her first shift immediately following the leave, and the next applicable employee on the list will be selected instead. When an employee is bypassed for a Mandatory Holdover Extra Pay based on this exemption, they shall maintain their current position on the Mandatory Extra Pay list. 6. Failing all of the above, the Fire District Commander will contact the Fire Division Chief to determine the appropriate course of action. Until the appropriate course of action is determined, apparatus will remain in service utilizing the employee who is currently in the position creating the vacancy. E. Special Event Extra Pay 1. The Department will provide notification of Special Event Extra Pay opportunities to all members of the bargaining unit. Notification will include the type and location of the event, the anticipated start and end times of the event, the number of personnel, respective job classifications and specialties needed, and deadline to respond. Employees may signup, or remove a signup, for special event Extra Pay up to the point that the Extra Pay is assigned which may occur anytime after the published deadline. 2. The selection of certified and/or individuals who possess specialty qualification(s) may be required and shall be allowed. Special Event Extra Pay offers shall be made in the following order: a. Qualified personnel who hold the same classification as the position necessitating the Extra Pay sorted by least number of credits; then department seniority; then alphabetically by last name. b. Qualified personnel who are deemed qualified to act either up or down in the position necessitating the Extra Pay sorted by least number of credits; then department seniority; then alphabetically by last name. However, if an employee has taken the most recent promotional exam for that position and not passed, they shall not be deemed as meeting qualifications. 3. If none of the employees who hold the same classification as the Extra Pay vacancy (paragraphs 2a, above) accept the Extra Pay offer, the Fire District Commander shall have the option to fill the special event vacancy with on-duty personnel who are deemed qualified for that position, and then backfill the resulting shift vacancy. 4. Employees shall be assigned credits hour for hour based on the Extra Pay hours worked in a special event assignment. Credits shall be applied to the same credit "bucket" as shift Extra Pay credits. 5. When there are an insufficient number of employees available from the special event Extra Pay sign-up list, mandatory assignment may be utilized in accordance with the procedures described in paragraph D above. If the vacancies cannot be filled with personnel from the shift prior to the Special Event, the mandatory list for the shift on four-days off may be utilized subject to the provisions of paragraph D. 14 6. Employees who are signed up for a special event assignment and subsequently refuse that assignment will be assigned credits equaling the number of hours of the event refused. 7. New employees shall be eligible for special event Extra Pay after six months of continuous service. These employees shall be assigned a number of credits equal to the average accumulated by all employees in the same classification at that time. 8. Extra Pay credits shall not be carried over from year to year and shall be zeroed out effective January 1 of each year. Initial special event Extra Pay assignment each year shall be made on the basis of Department seniority among employees in the same classification. F. Emergency Conditions Extra Pay When the Fire Chief determines that a state of emergency does or may exist, including, but not limited to natural or manmade disaster, civil disturbance, or other situation necessitating increased staffing for operational effectiveness, the procedures listed above may be bypassed during the state of emergency and staffing will be established according to operational needs. However, compensation for Extra Pay assignments shall still be in effect. Section 4. Exchange of Duty Time Employees within the Department may exchange on-duty time upon the following conditions: A. That the employee filling in be acceptable to the applicable Fire District Commander prior to the change. With the approval of the applicable Fire District Commander, Fire Medic Lieutenants and Acting Fire Medic Lieutenant - qualified Fire Lieutenants shall be permitted to exchange on-duty time. B. That the employees desiring the exchange notify the company officer of the anticipated change not less than 24 hours prior to the start of the anticipated changed unless such exchange arises under emergency situations. C. That no employee may be allowed to exchange more than 192 hours (8 days) per fiscal year. Additional Exchange of Duty Time hours may be granted by the Fire Chief or his/her designee. Each time an employee is permitted to allow another employee to work in his/her place in accordance with this exchange provision, the number of hours to be exchanged will be counted toward the established limit only for the employee who has been permitted to allow another employee to work in his/her place. D. That the employee working the time will be covered by all applicable benefits in case of injury while filling in, but will not receive pay for this period. E. If the employee agreeing to loan or fill in time is sick or fails to appear for the exchange, his/her appropriate leave account or pay will be charged. F. The employee agreeing to fill in for another member is obligated to remain on duty in the absence of the person with whom the exchange is made. G. Notwithstanding any provision to the contrary above, the City shall not be required to allow an exchange if doing so would impose upon the City liability for any additional overtime compensation over what persons may otherwise be entitled to. Prior to discontinuing the exchange allowance for this reason the City shall 15 notify the Union concerning the legal basis for the decision to do so. H. Time exchange is subject to a one hour minimum and at one-hour increments. Any premium of acting pay shall be in accordance with this Agreement and Departmental policy. I. Kelly Days may be exchanged between bargaining unit members in the same job classification only. An exception to this restriction may be made if the employees involved and department management all agree to the exchange. Kelly Day exchanges shall not count towards the 192 hours allotted for swaps in a year. J. Bargaining unit members on a Kelly Day shall not be counted towards the total allotted number of employees allowed off for any given day. Section 5. Call-in/Holdover/Court Time A. When an employee is called in to work less than 48 hours prior to the start of his/her regularly scheduled shift to perform the duties and responsibilities of an established Fire Department job classification, he/she will be paid a minimum of four hours at the overtime rate of pay. The City may require the employee to remain on duty for the duration of the four-hour period or for as long as he/she is needed, at the option of the City. The procedures outlined in Article 7, Section 3 of this agreement shall be used to fill positions when a call-in is necessary. All hours actually worked during such call-in shall be counted toward the calculation of overtime at the end of the established FLSA cycle in accordance with Article 7, Section 8, D of this Agreement. B. When an employee is held over past the end of his/her regularly scheduled shift to perform the duties and responsibilities of an established Fire Department job classification, the time held over shall be paid at the overtime rate of pay and shall be counted as time worked toward the calculation of overtime at the end of the established FLSA cycle in accordance with Article 7, Section 8, D of this Agreement. The City may require the employee to remain on duty until a relief employee arrives, in order to maintain staffing levels when the absence of such employee or employees would result in the removal of a unit or units from service. The holdover provision above will be utilized only until the position can be filled by use of the overtime procedures outlined in Article 7, Section 3 of this Agreement. C. Any employee whose appearance is required in Circuit Court or County Court as the result of a matter arising out of the course of his/her employment, shall receive a minimum of two hours pay if such attendance is during the employee's off-duty hours. This time will be paid at the regular rate of pay and will be counted as hours worked toward the calculation of overtime. This same provision shall also apply when the employee is subpoenaed to appear at the State Attorney's Office, Public Defender's Office, or a private attorney's office, in a criminal case arising from the employee's course of employment. However, this provision shall not apply when an employee or the Union has brought an action against the City or any City official. D. Leave with pay will be granted for those hours spent by an employee on jury duty that fall during the employee's scheduled work hours only. The employee will notify his/her Fire District Commander immediately upon learning of selection for jury duty. Scheduled work hours that the employee is released from work with pay for jury duty shall not count as hours worked for the purpose of determining overtime. The employee may be required to provide evidence of jury duty service in order to receive compensation for such hours. E. Employees who participate in meetings or on committees at the request of the City shall have all such time counted as hours worked and shall be paid at their regular rate of pay. The holdover and call-in 16 provisions as outlined in this Section shall not apply to time spent participating in meetings or on City committees. Section 6. Daylight Savings Time All bargaining unit members on the regularly scheduled shift in the Fall that as a result of Daylight Saving Time actually work (sweat) twenty-five hours shall receive their standard biweekly rate of pay plus one additional hour in the affected pay period. The additional hour actually worked shall be counted towards the calculation of Overtime at the end of the respective FLSA cycle. All bargaining unit members on the regularly scheduled shift in the Spring that as a result of Daylight Saving Time actually work (sweat) twenty three hours shall receive their standard biweekly rate of pay in the affected pay period. The additional hour not actually worked shall count as hours actually worked and shall be counted towards the calculation of Overtime at the end of the respective FLSA cycle. Vacation, Floating Holiday, and Sick Leave days used on the affected days shall count as 24 hours (if the entire shift is used) in either of the above instances. Exchanges of on-duty time (swaps) on the affected days shall be treated in accordance with Section 4 of this Article. As such, the regularly scheduled employee shall be entitled to credit for the additional hour in the Fall. Section 7. State EOC/FEMA Initiated Emergency Deployment It is understood that the Department may deploy personnel to render aid and assistance to other jurisdictions in accordance with State EOC and or FEMA initiatives. No bargaining unit employee will be involuntarily assigned to deploy under this paragraph. Such deployments shall not be subject to the call-in provisions as outlined in Section 5 of this Article. Employees subject to such deployments shall not suffer a loss of any regular pay the employee would otherwise have received if not dispatched as a result of the assignment. However, any pay above and beyond the employee's regular pay shall be based upon and subject to Section 2 of this Article and the reimbursing agency guidelines. Where such guidelines are available, they shall be provided to the employees at the time of assignment. Employees who are deployed in accordance with the provisions above shall be eligible for any applicable insurance, including Workers Compensation, to the extent provided by the plan terms or applicable law for the duration of such deployment. Section 8. Pay Plan Administration A. Promotions: 1. Upon promotion from one classification to a higher level classification, an employee shall be placed into the step number in the higher level classification which is the same as the step number to which the employee is assigned in their current classification. (For example, a Step 6 Firefighter would be promoted into Step 6 of the Fire Medic range. A Step 5 Fire Medic would be promoted into Step 5 of the Fire Lieutenant range.) Under no circumstances will the employee's promotional base rate of pay exceed the established pay range maximum. 17 2. A higher level classification shall be deemed to be one having a higher maximum rate of pay. A promoted employee shall maintain their existing annual performance review date for the purpose of determining eligibility for subsequent annual performance reviews. B. Demotions: 1. An employee who is demoted for any reason shall be placed into the step number in the lower level classification which is the same as the step number to which the employee is assigned in their current classification. (For example, a Step 6 Fire Medic would be demoted into Step 6 of the Firefighter range. A Step 5 Fire Lieutenant would be demoted into Step 5 of the Firefighter/Driver-Operator range.) An employee may be allowed, with the prior approval of the Fire Chief, to demote only to a lower level classification for which a position vacancy exists and for which the employee meets the minimum eligibility requirements at the time of demotion. A demoted employee shall maintain their existing annual performance review date for the purpose of determining eligibility for subsequent annual performance reviews. A demotion shall be defined as any change of an employee from a position in one class to a position in a class of a lower level. A lower level classification shall be deemed to be one having a lower maximum rate of pay. For non-voluntary, non-disciplinary demotions, such employee shall be placed at the head of the reemployment list for the class from which he/she was demoted. 2. An employee who is appointed from layoff from the reemployment list to a position in the department in which he/she previously served shall be paid the equivalent to what he/she was receiving upon separation, and shall be eligible for step advancement when he/she shall have been re-employed a sufficient number of days to make up the number of days he/she lacked for eligibility at the time of separation. C. Acting Pay 1. Acting pay shall be provided to any employee who is assigned in an acting capacity to a position in a class of a higher level for a minimum of four hours. An employee shall be deemed qualified and shall be required to act in a higher level classification if he/she is on the existing eligibility list, or if he/she is placed on an established "Acting" eligibility list upon being determined, after agreeing to participate in a process to be conducted by the Department, to meet guidelines established by the Department for the higher level classification. The Fire District Commander shall fill Acting assignments when the Department is at or above minimum staffing levels by choosing employees who will result in the least amount of disruption to operations and in accordance with Article 7, Section 3, C. 2. Acting Pay shall be 5% above the employee's current base rate of pay. 3. Acting Pay Removal Acting pay shall cease to be paid to a bargaining unit member when: The employee is reassigned, transferred, demoted or promoted to any position not involving the performance of the acting function, or the acting position is removed by the Department or other appropriate authority pursuant to provisions of the collective bargaining Agreement. Acting pay terminates at the time of the job function change or at the time of the formal assignment removal. Any employee who has elected to be included on the established "Acting" eligibility list may, with 30 days notice, be voluntarily removed from the list. The Department at its discretion may at any 18 time remove an employee from the "Acting" eligibility list. The Department will provide the employee with the reason for removal from the list. Those Paramedic certified employees who are assigned to the non-Paramedic classifications of Firefighter and Firefighter/Driver-Operator, and who elect to voluntarily be removed from the "Acting" eligibility list and no longer be eligible for a Paramedic certification pay differential, shall not be permitted to request reinstatement to the established "Acting" eligibility list for a period of six months from the time they are removed from the list. 4. Acting Eligibility List Shortages In the event the Department determines that an insufficient number of employees are willing or qualified to serve in an Acting capacity for a given job classification, the Union agrees to discuss and, if necessary, negotiate changes or impacts as required by law. This includes but is not limited to changes such as qualification requirements for classifications and promotion, modification of external hiring and employment criteria, modification or elimination of job classifications, or changes to Acting requirements. D. Fair Labor Standards, Section 7(k) Exemption 1. The City of Clearwater Fire Department, pursuant to the Fair Labor Standards Section 7(k) exemption, has established a 28-day work cycle for employees in the bargaining unit who work 106 hours average biweekly schedule. 2. All employees in the bargaining unit with the exception of Fire inspection personnel shall be paid overtime only for all regular hours actually worked in excess of 212 hours during the designated 28- day work cycle. Fire inspection personnel assigned to a 40-hour weekly schedule shall be eligible for overtime for all hours actually worked in excess of 40 hours per work week. Section 9. Promotional Process A. Promotional evaluation announcements will be posted in each station at least 30 days prior to the filing deadline. B. Each announcement of a promotional evaluation shall state: 1. The title of the class for which the eligibility list is to be created. 2. The nature of the work to be performed. 3. The minimum qualifications which may be required for admission to the evaluation process. 4. The general scope of the evaluation process to be used. C. Eligibility for promotional evaluation processes may be restricted to persons employed in designated lower classes and/or in designated organizational units. 19 D. Disqualification of Applicants The Human Resources Director, on behalf of the City, may reject the application of any person for admission to any evaluation process or refuse to evaluate any applicant or to certify the name of an eligible for appointment if, in his/her opinion, it is found: 1. That the applicant fails to meet the established qualification requirements for the classification. 2. That the application was not filed on or before the closing date for receipt of applications specified in the public announcement. 3. That the applicant has made an intentional false statement as to any material fact, has practiced or attempted to practice deception or fraud in his/her application or in securing eligibility or appointment. This provision shall be interpreted to include the use of any other than the applicant's legal name in making application. 4. That the applicant has a record of previous unsatisfactory service in City employment or elsewhere for the past two years of such a nature as to demonstrate unsuitability for employment in a position of the class for which he/she is applying. 5. That the applicant fails to meet standards for the position that are required by State and/or Federal law or applicable rules under such laws. 6. Any person who, by order of the Human Resources Director, is denied permission to compete in any promotional evaluation process or whose eligibility is canceled under the provisions of this section may make a written appeal to the City Manager for a final decision. E. Scope and Character of Evaluation Processes 1. Provisions applying to promotional evaluation processes: a. All promotional evaluation processes shall be competitive. b. All evaluation processes shall be of such character as to fairly determine the qualifications, fitness and ability of applicants to perform the duties of the classification to which appointment is to be made. c. Evaluation processes may be written, oral, physical or performance, or a combination of these types. They may take into consideration such factors (including experience, education, aptitude, capacity, knowledge, character, physical fitness, and other qualifications) as, in the judgment of the Human Resources Director, enter into the determination of the relative fitness of the applicants and may include inquiry into the moral character, or any other pertinent quality or attribute of the applicant. d. Evaluation processes shall include established criteria for determining a passing grade, score, or mark. 20 F. Notification of Results Each candidate shall be notified in writing of his/her name being placed on the eligible list or his/her failure to attain a place on the list. Any candidate may, within 15 calendar days following the mailing date of his/her notice of results, request permission from the Human Resources Department to review his/her evaluation results, and will be given reasonable opportunity to do so, provided the test is not proprietary. If the test is proprietary, then a summary of his/her results shall be furnished to the applicant upon request, provided such request is made in writing within 15 days after the last section of the examination is administered and the summary is made available by the vendor. Any costs associated with the summary shall be paid one-half by the employee and one- half by the Fire Department. G. Appeals from Ratings 1. Any candidate who fails to attain status on an eligibility list may, within 15 calendar days from the date of notification of such, notify the Human Resources Director in writing that error, other than error of judgment, exists. The Human Resources Director shall thereupon conduct a review. If upon review, errors other than error of judgment, are found, such errors shall be corrected. In the event such review discloses error affecting other candidates, the other candidates shall also be corrected. 2. An error correction may cause names to be added or subtracted from the eligibility list, however no change made in the ratings of any candidate shall be deemed to invalidate or in any way affect any certification or appointment previously made. Section 10. Open and Promotional Eligibility Lists All employees deemed eligible through the evaluation process shall be placed on the appropriate eligibility list for a period of two years from the date of placement on and establishing of such list by the Human Resources Department. The individual dates of initial eligibility shall appear next to the candidates' names and may differ when concurrent eligibility lists exist. The names of all persons who may be lawfully appointed and who have achieved a passing score on the evaluation process shall be placed on the appropriate eligibility list in the order of their final score without regard to the time of their test. The names of two or more eligibles having the same final score will be arranged in alphabetical order. Section 11. Appointments A. In certifying from an external eligibility list for entry hire positions, the Human Resources Department shall certify an open list of all candidates achieving a passing score on the evaluation process. In certifying from an internal eligibility list for the filling of a promotional vacancy, the Human Resources Department shall certify the names of the candidates in the top five score groups at the time of the certification. Selection from an open or promotional list shall be at the sole discretion of the Fire Chief. Selection criteria shall be developed and may include such factors as seniority, experience, education, aptitude, capacity, knowledge, character, physical fitness, and other qualifications. B. Selection criteria shall be announced at least 30 days prior to the selection process. 21 C. Selection processes shall be competitive; shall be of such character as to fairly determine the qualifications, fitness, and ability of applicants to perform the duties of the classification to which appointment is to be made; may be written, oral, physical, performance, or a combination of these types; shall include criteria to determine the relative fitness of applicants; and shall not include questions or evaluations framed to be discriminatory in nature. When skills and qualifications are substantially equal, seniority shall prevail in selection determinations for positions within the bargaining unit. D. The Department shall counsel with any eligible employee who is not selected for promotion upon the written request of the employee. Such counseling shall include an explanation and written summary of the selection criteria whereby improvement may make the employee not selected better qualified. Section 12. Probation A. A newly hired employee or an employee promoted from a class outside the bargaining unit to a class within the bargaining unit shall serve a probationary period of 12 months of active service during which he/she shall have the opportunity to demonstrate to the satisfaction of the Fire Chief his/her suitability for the job. In the event the employee is, for any reason, absent from duty for any reason other than floating holidays or on light duty for an accumulated period equal to two weeks scheduled work hours or more, then all such time shall be added to the probationary period. B. A newly hired employee who, during the probationary period, does not demonstrate suitability for the class, as determined by the Fire Chief, shall be notified in writing of the reason(s) and shall be terminated. An employee promoted from a class outside the bargaining unit to a class within the bargaining unit who, during the probationary period, does not demonstrate suitability for the class as determined by the Fire Chief, shall be returned to his/her position held prior to the promotion or to another position at the same or lower level for which the employee is determined to be qualified, provided there is no cause for dismissal. An employee shall not have access to the grievance procedure regarding the termination during probation. C. An employee promoted or demoted from a class within the bargaining unit to a class within the bargaining unit shall serve a probationary period of six months of active service during which he/she shall have the opportunity to demonstrate to the satisfaction of the Fire Chief his/her suitability for the job. In the event the employee is absent from duty for any reason other than scheduled leave or on light duty for an accumulated period equal to one week scheduled work hours or more, then all such time shall be added to and thereby extend the probationary period. D. An employee promoted from a class within the bargaining unit to a class within the bargaining unit who, during the probationary period, does not demonstrate suitability for the class, as determined by the Fire Chief, shall be notified in writing and shall be demoted to his/her former classification. A promoted employee serving a probationary period within the bargaining unit shall not be entitled to appeal his/her non-successful probationary period and his/her return to his/her former position. Section 13. Light Duty Light duty shall be defined as those activities which an employee can perform which do not require any type of physical activity which may aggravate an existing injury. An employee must be released by the treating physician for light duty and must have approval from Risk Management and the Fire Chief. Employees on either a job-related or non-job-related injury, illness or other medical condition may be assigned to light duty. 22 53/50-hour weekly schedule employees placed on light duty shall continue to be paid their standard biweekly pay in accordance with Article 7, Section 2. All hours actually worked while in a light duty status shall be counted toward overtime at the end of the FLSA cycle in accordance with Article 7, Section 8., D. Employees who are authorized time off while assigned to light duty shall have the number of hours equivalent to the time off deducted from the applicable leave balance. Medical appointments, approved by the Risk Management Department, related to a line of duty injury shall not be deducted from the applicable leave balance. Employees injured on duty who are approved for light duty shall continue to receive Special Teams pay if applicable. For off duty injuries, Special Teams pay shall cease after 90 calendar days of assignment to light duty. 40-hour weekly schedule employees shall maintain their 40-hour schedule while on light duty. All employees on light duty shall have their medical status reviewed periodically as directed by the City to determine whether maximum medical improvement has been achieved and/or the employee is fit to return to full duty. If needed, the City may require a second medical evaluation; and if so required, this shall be done at the City's expense. Light-duty assignments may be limited in number and scope at the sole discretion of the Fire Chief. Section 14. Line-of-Duty Injury Pay The City hereby agrees to pay the following compensation to any employee injured in the line of duty in accordance with the following definitions, terms and conditions. A. Line-of-duty compensation shall be payable under this section only with respect to disability as the result of injury to an employee where such injury is incurred in the line of duty. B. An injury shall be deemed to have been incurred in the line-of-duty if and only if such injury is compensable under the Florida Workers' Compensation Law. C. The amount of line-of-duty compensation paid shall be the amount required to supplement funds received from the Florida Workers' Compensation Law and any other disability or other income plan provided by the City, either by law or by agreement, to the point where the sum of the line-of-duty supplement herein provided and all other payments herein described equal the employee’s regular rate of pay at the time of the injury. D. No line-of-duty compensation under this section shall be allowed for the first seven calendar days of disability (except as provided below); provided, however, that if the injury results in disability of more than 21 calendar days, compensation shall be paid from the commencement of the disability. (It is understood that this paragraph is so stated to be in compliance with current workers' compensation law. Changes in workers' compensation law will modify this paragraph accordingly.) E. The term disability as used in this section means incapacity because of the line-of-duty injury to earn in the same or any other employment the wages which the employee was receiving at the time of injury. F. It is the intent of this section to provide supplemental compensation for line-of-duty injuries only, and this section shall not be construed to provide compensation in the event of death or injury incurred in any manner other than in the line of duty. In the event of any dispute or disagreement concerning the interpretation of the terms of this section, then the decisions concerning definition of those terms issued under the Florida Workers' Compensation Law shall control. 23 G. The City will provide line-of-duty compensation in the amount necessary to supplement funds received from the Florida Workers Compensation Law in order to equal the employee's regular rate of pay with no charge to the employee's accrued paid leave. When an employee with less than three (3) years of service is injured on the job to the extent that such employee misses scheduled work time. The maximum period for which payment may be made under this section shall be 90 calendar days from the date of injury for each injury during the first year of employment, 60 calendar days during the second year of employment, and 30 calendar days during the third year of employment. H. Line-of-duty injury pay will be provided from the first day of injury for those defined in (G) above; however, the amount paid shall be only that amount required to supplement funds received by the employee from the Florida Workers' Compensation Law and any other disability or other income plans provided by the City, to the point where the sum of all payments is equal to the employee's regular base pay rate at the time of injury. At such time as the employee receives his/her initial workers' compensation payment, the City shall approximate the differential needed to equal the employee's base pay and shall provide such line-of-duty injury pay to equal the employee's regular base pay rate at the time of injury. Any adjustment to the City's line-of-duty injury pay under this policy will be made following the employee's return to work or at the expiration of the period for which line-of-duty injury pay is provided. I. Line-of-duty pay shall not be provided from the first day of injury to any employee after the third year of employment. Following the time limits prescribed for the provision of line of duty compensation in paragraph (G) above, employees shall be required to utilize accrued paid leave time to supplement funds received from the Florida Workers Compensation Law in order to maintain a paid status. Employee shall be permitted to utilize accrued paid leave time only in the amount necessary to supplement funds received from the Florida Workers Compensation Law in order to equal the employee's regular rate of pay at the time of the injury. J. It is the intention of the parties that nothing in this Agreement shall interfere with the normal procedures under the Workers' Compensation Laws or the requirements of the City's workers' compensation insurance carrier. Should any language of this Agreement conflict with provisions of the Workers' Compensation Law, the provisions of the Law shall prevail. An employee may choose his/her approved Workers' Compensation treating physician if prior approval is obtained through the Risk Management Division. K. If an employee is killed in the line of duty, the City shall pay to the spouse, or if there is no surviving spouse, the estate, of such deceased employee his/her accumulated severance pay. Within 48 hours of the death of the employee, the City shall deliver to the spouse or surviving children or the employee's dependent beneficiary a check for the sum of one month's current salary of the employee. L. Upon return from working a fire, the employee may request a physical examination by the City physician to ensure the employee is stable and capable of returning to work. This right may be rescinded on an individual basis if repeatedly abused. The City shall have the right to require the employee undergo a physical examination by a physician of its choice prior to receiving or continuing to receive compensation under this Section. M. Failure to immediately report a line-of-duty injury to the employee's immediate supervisor or to the Risk Management Division within 24 hours of the time of occurrence of the injury, shall result in a loss of all line- of-duty pay under this Article unless such failure to report was: (a) caused solely by and as a direct result of the employee's injuries or (b) resulted from the occurrence of an event over which the employee had no control in the opinion of the City Manager. 24 Section 15. EMS Classifications A. The paramedic classifications of Fire Medic and Fire Medic Lieutenant are employees within the City's Fire Department who are appointed by the Department to perform emergency medical services in an emergency medical services program and who have successfully completed and passed a Paramedic training program recognized by the Department and approved by Florida Statute and the Pinellas County Medical Director's office. A Fire Medic is a classification which is responsible for maintaining EMS equipment and performing emergency medical services on an ALS Unit in the area of medical procedures and patient care in addition to any assigned fire suppression duties. B. The City retains the right to hire qualified external applicants into the Fire Medic job classification, or to offer promotional opportunities to qualified existing bargaining unit or other City personnel. Should the City cease to operate emergency medical services, those employees classified as Fire Medic or Fire Medic Lieutenant shall continue to be employed by the City on the same basis as any other employee in the bargaining unit, provided that employees who are demoted shall have their compensation fixed at the same step in the respective range as that which they are assigned in their classification prior to demotion. C. EMS Status 1. All Fire and Rescue Department employees shall be required as a condition of employment to possess and maintain the appropriate EMS certifications in accordance with their respective job description. It shall be each individual employee's responsibility to ensure that all requirements are met to maintain the active status of his/her respective applicable required EMS certification. The Department shall provide opportunities for employees to meet such requirements during work hours, but employees who are unable to take advantage of such opportunities due to absence or operational demands shall not be required to make arrangements for attending to the requirements on their own. The following bargaining unit members shall be exempt from the above requirement to possess and maintain the applicable EMS certifications: Jones, Michael Employees assigned through initial hire or promotion to the classifications of Fire Medic and Fire Medic Lieutenant are required to maintain the appropriate Paramedic certifications as determined by the Department as a condition of continued employment. Depending on the staffing level of Department Paramedic positions and the availability of vacancies in non-Paramedic positions, Fire Medics and Fire Medic Lieutenants may be permitted to voluntarily demote to non-Paramedic positions for which they are determined by the Department to be qualified, with the corresponding reduction in pay in accordance with Article 7, Section 8. Approval of such demotions shall be at the sole discretion of the Fire Chief. If voluntary demotion is not approved by the Fire Chief and there is no other vacant position in the City for which such an employee is deemed by the City to be qualified, the employee may be subject to applicable provisions of the City's policies and procedures, including involuntary demotion or layoff. The City reserves the right to hire into the classification of Fire Medic new employees who possess the appropriate Paramedic certifications, and to require that such certifications be maintained as a condition of continued employment. 2. Employees who have their required EMS certifications revoked by the State of Florida or the Office of the Pinellas County Medical Director, and who appeal the action within the established timeframe through the appropriate administrative procedure, shall be maintained as employees in the Clearwater 25 Fire and Rescue Department until a Final Order is rendered by the Division of Administrative Hearings. Said date shall not include any further appellate proceedings by the employee. Such employees who do not take advantage of this appeal procedure, or who do not have their EMS certifications fully reinstated through this procedure, shall be required to find alternate employment within the City or shall be subject to layoff 30 days from the date of the Final Order of the Division of Administrative Hearings, not including any further appellate proceedings by the employee, and shall be placed on the reemployment list for a period of one year from the date of the layoff. The Fire Chief shall have the discretion to not institute layoff based on individual circumstances, and such decisions shall be considered by the parties to be non-precedent setting. The actions of the City pursuant to this Paragraph shall not be subject to the grievance and arbitration/appeal procedure under this Agreement or under the Civil Service Rules. 3. The Fire Department and all bargaining unit members shall comply with Florida Statutes and the Pinellas County EMS Rules and Regulations regarding Quality Assurance and ACLS and BTLS certification. The decisions of the County Medical Director in such matters shall not be subject to the City grievance procedure but shall be addressed through the appropriate appeals procedure. 4. The demotion of an employee required to possess an EMS certification shall not be subject to the contractual grievance procedure or Civil Service appeal procedure when the demotion or removal of pay is based upon loss of EMS certification due to action taken by the office of the Medical Director of Pinellas County or by the State of Florida. 5. The demotion of an employee required to perform EMS services or the removal of Paramedic certification pay shall be subject to the contractual grievance procedure or the Civil Service appeal procedure only if such demotion or removal of pay is the result of a disciplinary action not related to the above referenced loss of EMS certification. 6. The Arbitrator shall not have the power to substitute his/her judgment for that of the Department, the Medical Director, or the State of Florida with whom EMS personnel work in relation to performance of employees to the standards of excellence desired by the City the Medical Director, or the State of Florida. D. The parties agree that Fire Medics and Fire Medic Lieutenants are healthcare professionals but shall not be considered "professional" employees within the meaning of the Florida Public Employees Relations Act. E. If the application of this Article, or any part thereof, whether or not relating to pay, is superseded by action of a superior governmental agency, then the City will be absolved of complying with this Agreement to the extent of the conflict. Section 16. Firefighter/Driver-Operator A. Classification The classification of Firefighter/Driver-Operator shall be for those employees within the Fire Department who are the drivers and operators of the following type vehicles: Fire Engines, Aerial Apparatus (including operation of the tiller), and Squad. 26 B. Appointments All Firefighter/Driver-Operator positions shall be filled by a competitive eligibility and selection process. All employees who successfully complete the eligibility determination process shall be eligible for consideration in the selection process. The minimum qualifications shall be in accordance with the respective City job description. C. Wages All employees assigned as driver shall have at least 4 years on the department and shall receive pay in accordance with Appendix A. Section 17. Work Rules and Prevailing Rights A. It is understood and agreed by both parties that the duties performed by members of the bargaining unit cannot always be covered by job descriptions and, therefore, members of the bargaining unit may be required to perform duties in addition to all those listed within the current job descriptions which are, in the judgment of the City, related to the purposes of the Fire Department, which judgment shall not be arbitrary, capricious or unreasonable. B. Any Fire Department Rule or Regulation in conflict with this Agreement shall be of no force and effect. C. Prior to the implementation of any changes in the existing Fire Department Rules and Regulations, the Fire Chief must provide twenty calendar days notice for the Union to identify any bargaining as required in accordance with Florida Statutes, Chapter 447. If requested by the Union, the change will be referred to the next Labor/Management Committee meeting, which shall be scheduled within 14 calendar days to meet and discuss such change. If the Union provides no response, the rule will be implemented after the initial twenty day notice unless the time is extended by the Chief. The issue of whether such change conflicts with this Agreement shall be subject to the grievance procedure contained herein. The time for filing said grievance shall commence on the date the rule is implemented. D. All rights and working conditions, enjoyed throughout the Department by the employees at the present time which are not included in this Agreement shall be presumed to be reasonable and proper and shall not be changed by the City in an arbitrary or capricious manner; provided that nothing contained herein shall limit the City's rights under Paragraphs A, B and C of this Section or as expressly provided elsewhere in this contract or by law. Section 18. Subcontracting During the term of this Agreement, the City shall not subcontract out to private concerns any fire suppression, Emergency Medical Service and rescue services of the Department. Any action of the state of Florida or Pinellas County to assume control of any basic fire suppression, Emergency Medical Service or rescue services shall not be deemed subcontracting. 27 Section 19. Indemnification The City agrees to defend any employee when the employee is sued on any claim arising out of his/her employment with the City and acting within the scope of his/her duties. The employee agrees to cooperate in his/her defense. The City also agrees to pay any judgment rendered against an employee for acts committed when the employee is acting within the scope of his/her City employment, provided that the employee did not act intentionally, with malice, or with gross negligence. Section 20. Sports Participation in sporting activities while on duty shall be permitted in accordance with Fire Department SOP/SDP. Section 21. Lawn Maintenance Employees covered by the contract shall not be required to perform lawn maintenance at the fire stations. Section 22. Physical Examination A. Employees covered by this labor agreement shall be required to undergo an annual physical examination. B. The employer shall bear the cost of each examination. Additionally, 53/50 hour schedule employees shall be provided an allowance for attending the physical during off-duty hours. The City agrees 40 hour schedule employees may attend their physical during on-duty hours with no loss of pay. The results of these physicals shall be made available to the City and to each employee upon completion of the physical and shall be maintained as confidential medical records in accordance with law. Physicals shall include but not necessarily be limited to the following: 1. 12 Lead EKG 2. SMA Profile 12 (liver, blood sugar, etc.) 3. Chest X-Ray – (as required) 4. Complete Blood Count 5. Urinalysis 6. Rectal Cancer Exam (optional for employee) 7. Doctor's Physical (eyesight, reflexes, hearing, throat, etc.) 8. Breast/Cervical Cancer Exam (Females- optional for employee) 9. Audiometric Evaluation 10. Spirometry (Pulmonary Function) 11. Titers for Hepatitis A and B C. The City agrees to pay all expenses for inoculation or immunization shots for employees and members of an employee's family residing in his/her household when such becomes necessary as a result of said employee's exposure to contagious disease where said employee had been exposed to said disease in the line of duty; provided that the employee first makes all reasonable efforts to have this service performed at no cost by the County Health Department. The City further agrees to reimburse the co-pay cost for any preventive inoculation 28 or immunization shots an employee may receive from his/her City primary care physician. D. The parties agree that the physical condition of the employee is of great concern to the employee and to the City. All employees whose physical fitness or medical status is deemed deficient in some manner as a result of the physical examination shall be advised by the Department and shall be encouraged to undertake a fitness rehabilitation program in an effort to improve their physical fitness and health. The City shall provide free access for all bargaining unit members, and family members who are currently enrolled on the City’s health insurance plans, to any City recreational facility. Additional fees for programs conducted at such facilities shall be borne by the employee. It is understood by all parties that the decision whether to use such facilities is entirely voluntary on the part of the bargaining unit members, and time spent using such facilities shall neither be paid nor will any accidents or injuries incurred while utilizing such facilities be compensable under workers compensation. E. The City agrees to contract with a licensed physician who shall be selected by the City and agreed to by the Union to act as a Department Physician whose duties shall be to advise the employees and the department in matters concerning the health of the employees. F. The City and Union agree that based upon a mutual agreement of the parties, this Article may be reopened for the purpose of negotiating a Wellness provision only. If the Article is reopened for such purpose and the parties are not able to reach an agreement, the item shall not be subject to the impasse procedure and the Article shall remain status quo in whole and part. Section 23. Employee Fitness & Wellness Incentive 1. During contract year 1 (October 1, 2024 – September 30, 2025) and contract year 2 (October 1, 2025 – September 30, 2026), employees will have the opportunity to earn wellness incentive leave hours for maintaining physical fitness and wellness standards as set forth in departmental policy. This program is voluntary. 2. Employees performing the Fitness & Wellness Assessment shall be covered under workers compensation. 3. The Fitness & Wellness Assessment will consist of two parts: Work Performance Assessment and Injury Resistance Assessment. Each assessment will be worth a maximum of twelve (12) hours for 53-hour employees or four (4) hours for 40-hour employees. This wellness incentive leave may be used in four (4) hour increments subject to the provisions set forth in Article 8, Section 2(B). 4. Scores within the fiftieth (50th) percentile or above will receive wellness incentive leave hours according to the schedule below: 53-hour Employee Incentive Value Percentile Range Reward Value 90-100 24-hours 80-90 20-hours 70-80 16-hours 60-70 12-hours 50-60 8-hours 29 40-hour Employee Incentive Value Percentile Range Reward Value 90-100 8-hours 80-90 7-hours 70-80 6-hours 60-70 4-hours 50-60 2-hours Effective October 1, 2026 and thereafter, employees will no longer be allowed to participate and earn incentive leave hours in this Employee Fitness & Wellness Incentive. Section 24. Residency Requirement All bargaining unit members shall be required to maintain residence within the geographical boundaries of Pinellas, Hillsborough, Pasco, Manatee, and Hernando Counties. This requirement shall continue during their tenure in any position within the fire service of the City of Clearwater. Section 25. Tobacco Product Usage No smoking or use of tobacco on or off the job shall be permitted for any bargaining unit member as a condition of employment and their continued employment within the fire service. Violation of this provision shall be deemed just cause of disciplinary action by the City, up to and including dismissal. 30 ARTICLE 8 LEAVES OF ABSENCE Section 1. Holidays A. The following holidays shall be observed: New Year’s Day Veteran’s Day Martin Luther King Day Thanksgiving Day Memorial Day Day after Thanksgiving Day Juneteenth Day Christmas Day Independence Day Labor Day Holiday pay for the above listed holidays will be paid at the employee's current base rate of pay for the number of hours equaling 10% of the biweekly schedule, except that the following three special holidays will be compensated at the employee's current base rate of pay for the number of hours equaling 15% of the biweekly schedule: Christmas Day, Thanksgiving Day, and New Year's Day. 40-hour per week schedule fire inspection personnel shall not work on designated holidays unless directed to do so by the Fire Marshal or his/her designee. Fire prevention inspection personnel who are required to work on a designated holiday shall receive time-and-one-half their regular pay for all hours actually worked or 4 hours minimum, whichever is greater, on the holiday in addition to the holiday pay described above. When a City- observed holiday falls on a Saturday, the preceding Friday shall be the designated holiday for fire prevention inspection personnel. When a City-observed holiday falls on a Sunday, the following Monday shall be the designated holiday for fire prevention inspection personnel. Designated holidays which fall on a fire prevention inspection employee's regularly scheduled work day shall count as hours actually worked for the purpose of calculating overtime. B. In addition to the holidays listed in Section 1, each employee may receive up to four additional "floating holidays". Effective January 1, 2027, 50-hour employees will only receive up to two “floating holidays.” Floating holidays shall be awarded at the beginning of each payroll calendar year, subject to the restrictions below. For such floating holidays the employee shall receive his/her regular rate of pay for such day if he/she does not work that day, but shall not receive additional compensation. Any day for which an employee is not scheduled to work may not be designated as a floating holiday. Floating holidays shall be subject to the following requirements and conditions: 1. No employee may utilize floating holidays until 30 calendar days after the date of hire. 2. Any person employed between January 1 and March 31 shall receive 100% of floating holidays to be utilized during the year of hire; any person employed between April 1 and June 30 shall receive 75% of floating holidays to be utilized during the year of hire; any person employed between July 1 and September 30 shall receive 50% of floating holidays to be utilized during the year of hire; and any persons employed between October 1 and October 31 shall receive 25% of floating holiday to be utilized during the year of hire. Persons employed after October 31 shall not be eligible for any floating holidays during the year of hire. Effective January 1, 2027, any 50-hour person employed between January 1 and June 30 shall receive 31 100% of floating holidays to be utilized during the year of hire, and any 50-hour person employed after July 1 shall receive 50% of floating holidays to be utilized during the year of hire. 3. Floating holidays may not be carried over from one payroll calendar year to another payroll calendar year and if not taken are forfeited except as provided in Paragraph D of this Section. 4. After the year of hire, employees shall receive four "floating holidays" each payroll year. Effective January 1, 2027, 50-hour employees will only receive two “floating holidays” each payroll calendar year. 5. Upon an employee's separation from the City, the employee may receive a lump sum payment for any remaining floating holiday balance per Paragraph D of this Section, or the remaining floating holiday balance may be used to advance the employee's date of retirement. C. Floating holidays will be selected in reverse seniority after all vacation days and longevity days have been scheduled. It is not necessary for an employee to schedule his/her floating holidays during the vacation selection process. Any employee selecting floating holidays after the vacation selection process will give the Department 48 hours' notice in writing of his/her request. This notice will be given to the Fire District Commander for approval based on vacation selection criteria. This permission shall not be arbitrarily withheld. In case more than one employee requests a particular day and the Department determines that both employees may not be off duty on that particular day, the senior employee shall be given preference. D. If the employee chooses not to take one or more floating holidays, he/she may make a written request to the Fire Chief on or before November 15th to receive 24 hours of regular pay for 53/50-hour week, or 8.0 hours of regular pay for 40-hour week in lieu thereof payable in the payroll period which includes December 1st. Any floaters not taken or requested for payment are forfeited. No more than four floating holidays shall be approved for payment each year. E. Each payroll calendar year, members of the bargaining unit may elect to take one floating holiday as "Personal Leave Time." This personal leave day may be broken into blocks of 4 hours and will be taken in 4-hour increments. Personal Leave Time will be selected after all vacation days, extra vacation days and floating holidays have been scheduled. Any employee selecting Personal Leave Time after the vacation selection process will give the Department 48 hours' notice in writing of his/her request. All requests for Personal Leave Time must comply with all the criteria pertaining to the vacation selection process. If an employee chooses not to use all blocks of Personal Leave Time, he/she may make a written request to the Fire Chief on or before November 15th to receive pay for such remaining blocks, payable in the subsequent payroll period which includes December 1st. Section 2. Vacations A. Accrual of Vacation Leave 1. Vacation leave shall be granted for all full-time employees in accordance with the number of completed years of credited service. A full-time employee shall be deemed to have earned and be eligible for vacation on the first anniversary of his/her employment. For newly hired employees, such vacation shall be prorated for the year of hire according to the following schedule: 32 53/50-Hour Weekly Schedule Employees January/February Hire Date.................................................................. 6 Duty Days March/April Hire Date .......................................................................... 5 Duty Days May/June Hire Date .............................................................................. 4 Duty Days July/August Hire Date........................................................................... 3 Duty Days September/October Hire Date............................................................... 2 Duty Days November/December Hire Date ............................................................. 1 Duty Day 40-Hour Weekly Schedule Employees January/February Hire Date ........................................................................ 80 Hours March/April Hire Date ................................................................................ 64 Hours May/June Hire Date ....................................................................................48 Hours July/August Hire Date................................................................................. 32 Hours September/October Hire Date.....................................................................24 Hours November/December Hire Date ................................................................. 16 Hours Effective in the 2023 payroll calendar year and thereafter, employees shall be deemed to have earned and be eligible for vacation accrual at the beginning of each payroll calendar year. As such, employees on the 50/53-hour weekly schedule shall accrue paid vacation as follows: Years of Service Days 1 (First Anniversary) Pro-rated / up to 6 Days 2-3 6 Days 4-6 7 Days 7-10 8 Days 11-14 9 Days 15-17 10 Days 18-24 11 Days 25 and higher 12 Days Employees on the 40-hour weekly schedule shall accrue paid vacation as follows: Years of Service Hours 1 (First Anniversary) Pro-rate / up to 80 Hours 2 80 Hours 3 88 Hours 4 96 Hours 5 104 Hours 6 112 Hours 7 120 Hours 8-10 128 Hours 11 136 Hours 12 144 Hours 13-15 152 Hours 16 and higher 160 Hours 33 2. Effective in 2023 and thereafter, the vacation year shall be the payroll calendar year. 3. Effective in the 2025 payroll calendar year and thereafter, 53/50-hour employees who have used at least seventy-two (72) vacation hours may receive up to seventy-two (72) hours of vacation stipend in exchange for the same number of vacation hours. The employee must maintain a minimum of one hundred twenty (120) hours in their vacation bank after the exchange. The employee must not have received any formal discipline during that payroll calendar year and must have received at least Meet Standards on the most recent annual evaluation. The employee may elect to make one written request per payroll calendar year to the Payroll Preparer. Written requests must be turned into Finance Payroll on or before the second pay period end date in November. The vacation stipend will only be paid in the first paycheck in December of that payroll calendar year. Vacation hours sold will be paid out as pensionable earnings, at the employee’s hourly base rate exclusive of any premium or shift assignment pay in effect at the end of the payroll period following the date this form is provided to the department. Contribution requests will be irrevocable. 4. Effective in the 2025 payroll calendar years and thereafter, 40-hr employees who have used at least twenty-four (24) vacation hours may receive up to twenty-four hours of vacation stipend in exchange for the same number of vacation hours. The employee must maintain a minimum of eighty-six (86) hours in their vacation bank after the exchange. The employee must not have received any formal discipline during that payroll calendar year and must have received at least Meet Standards on the most recent annual evaluation. The employee may elect to make one written request per payroll calendar year to the Payroll Preparer. Written requests must be turned into Finance Payroll on or before the second pay period end date in November. The vacation stipend will only be paid in the first paycheck in December of that payroll calendar year. Vacation hours sold will be paid out as pensionable earnings, at the employee’s hourly base rate exclusive of any premium or shift assignment pay in effect at the end of the payroll period following the date this form is provided to the department. Contribution requests will be irrevocable. 5. All unused vacation balances will be added to the employee’s vacation bank and will not exceed 264 hours for 53/50-hour schedule employees and 180 hours for 40-hour schedule employees, at the end of the payroll calendar year. B. Use of Vacation Leave 1. The use of vacation leave shall be authorized in accordance with Fire Department Regulations. Vacation leave shall be utilized in full day increments only, except when operational demands require an employee to work part of a day for which vacation leave has been previously approved. For 53/50-hour schedule employees, a maximum of seven employees shall be permitted to be absent from any shift for the purpose of personal leave including vacation and floating holidays. For 40- hour schedule employees, including Fire Prevention Inspectors and 53/50-hour schedule employees provided with Light Duty assignments, the Department shall determine the number of employees who may be permitted leave use in accordance with operational demands. 53/50-hour schedule employees who are provided a 40-hour Light Duty schedule shall not be denied the use of previously approved vacation leave, provided they notify the Fire Chief prior to the beginning of the Light Duty assignment of their intent to utilize the previously approved vacation leave. 34 However, should such employees elect to not utilize previously approved vacation leave while on the 40-hour schedule, they shall be responsible for the subsequent scheduling of the days within the available slots or will risk losing the days. The Fire Chief may approve vacation leave for less than 24-hour increments for employees with approved Family Medical Leave Act (FMLA) paperwork on file. The need for time off must be for an approved FMLA need. 2. The borrowing of vacation time prior to its accrual is prohibited. 3. There is no advancing of vacation pay. 4. New employees may not take vacation until they have completed one year of continuous service. 5. If a holiday occurs during vacation leave, the employee will be paid holiday pay. 6. An employee who has more than 90 calendar days of unpaid leave, shall receive no vacation leave for that payroll calendar year. 7. Scheduling of Vacation a. Bargaining unit members will be contacted in the order of department seniority for the selection of vacation. Vacation days may be picked in either a 3- or 6- duty day block for 53/50- hour schedule personnel or a 5- or 10- duty day block for 40-hour schedule personnel the first time through. A block, as published on the vacation schedule issued by the Department, shall consist of a designated 3 or 6 duty day grouping beginning and ending with 4 days off for 53/50-hour schedule personnel, or a designated 5 or 10 duty day grouping beginning and ending with a weekend for 40-hour schedule personnel. When a Kelly Day occurs within a duty block selected for vacation by a 53/50-hour schedule employee, vacation leave will only be charged for the actual duty days and not for the Kelly Day. After all personnel have been contacted for their first pick, the second round will begin. All 53/50-hour schedule personnel who have selected a 3-day block and all 40-hour schedule personnel who have selected a 5-day block on the first round will be recontacted in the order of department seniority for their second selection on the second round. b. After all personnel have been provided the opportunity to pick their primary six or ten days of vacation in blocks, employees will be permitted to submit requests to use any bonus days for 25 years of service, floating holidays, and sick leave incentive days. All personnel will be contacted by reverse seniority for the choosing of bonus days, floating holidays and sick leave incentive days. c. Should employees elect to pass on choosing any days during the vacation selection process above, they shall be responsible for the scheduling of their remaining days, which may be selected in 24- hour increments. 48-hours notice shall be required for the request to utilize such days, however the Fire Chief or his/her designee shall have the sole discretion to approve such requests if practicable when provided with less than 48 hours notice. If the employee 35 waits too long and there are no available slots left, they will risk losing the days. Floating holidays may be submitted for pay in accordance with this Agreement. Additional vacation days will be lost or can be donated to the Department leave pool. However, no employee shall be permitted to donate more than three days of leave per year to the pool. d. All vacation days not submitted are subject to forfeit in accordance with the above except by permission of the Fire Chief. e. The linking of scheduled days for 53/50-hour schedule personnel shall not exceed 9 consecutive duty days, except by special permission of the Fire Chief. If more than 9 days are linked, the employee shall be responsible for any training required to maintain certification that is missed during the scheduled time off. The Department will make every effort to schedule this training while the employee is on duty. If this cannot be done, then it is the employee's responsibility to complete the required training on his/her own time. f. The changing of sick leave incentive days for previously used floating holidays is not allowed. g. When an employee is assigned to a different shift or changes job classification after their vacation selection has been completed and approved by the Department, the employee may request to maintain the previously selected vacation or may request alternate vacation days instead. The Department will attempt to accommodate such requests as staffing levels and operational requirements permit. h. Should any previously chosen vacation days associated with or adjacent to designated City holidays or any additional days designated by the Union at the initial vacation selection period become available due to personnel shift changes, Light duty assignments of personnel, or forfeiture of previously scheduled days, the Union shall be responsible for re-assigning the available days. Re-assignment shall be in accordance with Department standards for staffing and leave. The union shall designate one person per shift as the contact person for the re- assignment of vacation days and who shall be responsible for forwarding the information to the Fire District Commander for scheduling. C. Payment and Accrual During Military Leave 1. An employee granted an extended military leave of absence in accordance with the City Emergency Military Leave Policy shall be permitted to be paid any portion or all of his/her accrued vacation leave when the employee begins the extended military leave. 2. An employee returning from an extended military leave of absence shall accrue vacation leave as provided by law. D. Conversion To Sick Leave or Funeral Leave During Vacation Leave 1. The employee may request that vacation leave be changed to sick leave if the employee or member of the employee's immediate family becomes ill while the employee is on vacation leave. 2. The employee may request that vacation leave be changed to funeral leave provided the request is consistent with the article on Funeral Leave. 36 3. Requests for such changes must be made in writing to the Fire Chief or designee within 72 hours of the employee's return to work. E. Payment of Unused Vacation Leave 1. Payment of unused vacation leave and banked vacation hours will be paid at the employee's current base rate of pay upon separation of the employee, provided the employee has more than one year of continuous service, or such hours may be utilized to advance the date of retirement. 2. When a bargaining unit member is required to work a partial day on any day that he/she has previously been approved for vacation leave, the employee's vacation leave balance shall not be charged for the hours worked and such hours worked shall be paid at the overtime rate of pay but shall not be subject to the minimum hours assigned to holdover or call back in accordance with this Agreement. Should the number of vacation hours not charged due to such circumstances equal twelve hours or more, the employee shall be permitted to request to use the portion of such hours equaling a twelve-hour block in accordance with Paragraph B.,7. above. The employee shall be permitted at the end of the calendar year to request payment for any remaining balance of less than twelve vacation hours not charged due to having worked a partial day, in accordance with the established provision for the payment of floating holidays as outlined in this Agreement. F. Banking of Vacation 1. The practice of banking vacation for retirement shall be limited to 264 hours for 53/50-hour schedule employees and 180 hours for 40-hour schedule employees. Section 3. Sick Leave A. Accrual Rate 1. Members of the bargaining unit shall accrue sick leave in accordance with the schedule below: Biweekly Hours Total Hours Accrual Rate Per Day Hours Capped 106/100 144 5.538 2184.00 80 96.01 3.696 1560.00 2. The number of yearly pay periods sick leave is accrued is 26. B. Sick leave may be accumulated for each of the 26 accrual pay periods the employee actually works, up to a maximum as shown above. Actual work includes periods when the employee is using accumulated sick leave (but not sick leave pool), holidays, vacation with pay, and the no-loss-of-pay sick time. Employees shall not accrue sick leave during any other period of time when they are in a non-paid status or utilizing "retirement advancement". C. All accumulated unused sick leave shall be credited to any employee recalled from a lay off, transferred, or certified to another department or classification without break in service, appointed from a reemployment list or returning from a leave of absence. If the employee is 37 promoted, demoted or transferred to another City position with a different Scheduled Pay Period Hours other than that defined above, that employee's sick leave balance will be adjusted to reflect equivalent days of sick leave earned, consistent with his/her new scheduled pay period hours. D. In the event an employee has been separated and paid for accumulated unused sick leave as hereinafter provided or has been dismissed for cause and subsequently is re-employed by the City, his/her subsequent sick leave accumulations shall be calculated as a new employee. E. Under the provisions of this section, an employee may utilize his/her sick leave for absences from duty resulting from illness or injury to the employee or a family member on any of his/her regularly scheduled work days for the number of regular hours he/she would otherwise have been scheduled to work on that day had not such absence occurred. Absence for a fraction of a day that is chargeable to sick leave in accordance with these provisions shall be charged by rounding to tenths of an hour according to the following: Minutes Tenths of an Hour 1 - 6 .1 7 -12 .2 13 -18 .3 19 - 24 .4 25 -30 .5 31 – 36 .6 37 -42 .7 43 – 48 .8 49- 54 .9 55 - 60 1.0 F. Sick leave shall not be considered a privilege to be used at the employee's discretion, but shall be used only for absences: 1. Due to personal illness or physical incapacity caused by factors over which the employee has no reasonable immediate control. 2. Necessitated by exposure to contagious disease in which the health of others would be endangered by his/her attendance on duty. 3. Due to medical or dental appointments, or other personal sickness prevention measures, the scheduling of which at times other than during his/her regular working hours is impossible or unreasonable. 4. Due to illness of a member of his/her immediate family which requires his/her personal care and attention. The term "Immediate Family" as used in this paragraph shall be limited to spouse or domestic partner of record, as defined in accordance with criteria, policies, and procedures determined by the City, or the employee’s or employee’s spouse’s or domestic partner’s child, parent, foster-child(ren), minor-guardianship(s), brother, sister, grandparent, grandchild, great- grandchild, stepparent, or stepchild, domestic. Employees may be required to produce legal justification for Foster Child(ren)/Minor Guardianship(s). 38 Sick leave will be accrued on a biweekly basis based on hours in a paid status. An employee may utilize his/her accumulated sick time due to an illness in his/her immediate family (as that term is defined above). 5. If an employee is under a doctor's care or if a member of the employee's immediate family is under a doctor's care and the doctor certifies that the employee's personal care and/or attention is required, said time of absence shall not be considered as grounds for any discipline, provided that personal sick leave is not used in excess of accumulated sick leave. G. An employee absent for one of the reasons mentioned above shall inform his/her immediate supervisor as early as possible on the first day of absence. Failure to do so may be the cause for denial of sick leave with pay for the period of absence. In any event, the Departmental Rules shall govern the notification requirements. H. Payment for Unused Sick Leave Upon separation from City service, an employee shall be paid one-half of his/her accumulated unused sick leave. The rate of payment shall be based on the regular hourly rate (excluding shift differential or any other addition to base pay) of the employee on the last day worked prior to separation. The employee qualifies for payment if: 1. The employee has had at least 20 years of continuous service with the City. Leaves of absence without pay, suspensions and layoffs followed by subsequent re-employment shall not be considered as breaks in service. The length of such time off or layoff shall be deducted from the total length of service. Military leaves and leaves during which the employees are receiving Workers' Compensation shall not be deducted from continuous service; or 2. The separation is involuntary on the part of the employee including disability (incurred on or off the job) and layoffs; or 3. The employee's estate shall receive payment if an employee dies. An employee who has been dismissed for cause or who resigns voluntarily shall have no claim for sick leave payment. An employee who may otherwise be eligible for retirement under the City Employees' Pension Plan or Federal Social Security, or who may be approaching such eligibility date, and whose purpose in leaving is to retire under either program, may utilize one-half of his/her accumulated unused sick leave to the extent thereof to advance his/her retirement date. In that event, the employee shall execute a resignation to become effective on the date that such accumulated unused sick leave would be exhausted. Such resignation shall be irrevocable, and retirement shall begin at the time such resignation becomes effective. In the interim, payment for accumulated unused sick leave shall be made as a continuation of the employee's regular pay from which all regular payroll deductions shall be made in order to preserve his/her retirement status. Accumulated unused sick leave will be charged as outlined in paragraph (1) of this subsection. 39 I. An employee may not utilize his/her accumulated sick leave absence for absences resulting from an injury arising out of and in the course of employment, other than City employment, for which monetary or other valuable consideration is received or expected. Any employee who utilizes accumulated sick leave, or who attempts to utilize accumulated sick leave, for absences resulting from an injury arising out of and in the course of employment, other than City employment, may be terminated or suspended, as in the City's judgment, is appropriate. J. Except in the cases of injury incurred in the line of duty with the City, employees shall not be entitled to use sick leave until the completion of six calendar months of continuous service following the date of original appointment. K. The employee may be required to submit evidence "in the form of a medical certificate, of the adequacy of the reasons for his/her absence during the period of time for which sick leave is granted when requested by the Department Director. L. An on-duty employee injured in an accident, arising out of and in the course of his/her City employment, may elect to be continued on the payroll to the extent of his/her accumulated unused sick leave as hereinafter provided. An employee receiving sick leave with pay under the provisions of this subsection who simultaneously receives income under the Workers' Compensation Act shall receive, for the duration of such income and to the extent of his/her accumulated unused sick leave, only that portion of his/her regular rate of pay (see Article 9, Section 4) which will, together with said income equal his/her regular rate of pay at the time of injury. In that event, the employee's accumulated unused sick leave shall be charged only in the same proportion as his/her sick leave payment is to his/her regular biweekly salary which shall be deemed to be that same proportion of the number of regular hours he/she would otherwise have been scheduled to work for the day, week or other period involved, rounded out to the nearest tenth of an hour. M. The use of sick leave for purposes other than those designated herein will be considered a major rule infraction. N. Sick Leave Incentive Program 1. Following any full payroll calendar year period that a bargaining unit employee uses no sick leave, the employee will be allowed to convert two days of sick leave to Sick Leave Incentive Days or the cash equivalent based upon the employee's current base hourly rate of pay. 2. Following any full payroll calendar year that a bargaining unit employee uses between one-tenth of an hour and the equivalent of two days of sick leave the employee will be allowed to convert one day of sick leave to a Sick Leave Incentive Day or the cash equivalent based upon the employee's current base rate of pay. 3. Employees shall be required to submit notice of their choice of the above within 30 days of Sick Leave Incentive eligibility notification or shall have no sick days converted. O. Sick Leave Pool A joint leave pool will be established by members of the International Association of Fire Fighters bargaining unit, such leave pool to be available for use by members subject to the following provisions: 40 1. The purpose of the leave pool is to provide leave to bargaining unit members who face significant time off without pay due to a serious illness or injury, whether job-connected or non- job-connected, or serious illness or injury to a family member covered under the family sick leave policy. The leave pool may not be used for short time periods where an employee may be without pay. Short time shall be defined as less than 30 calendar days. 2. A committee shall be formed and the committee shall determine use of the leave pool days, subject to the above purpose and limitations. a. The committee shall consist of three members designated by the bargaining unit, one management employee designated by the Fire Chief, and one management designee of the City Manager. b. The committee shall review employee needs and circumstances consistent with the provisions of the leave pool and shall determine eligibility for and the amount of pool leave time that may be provided to employees. The committee may establish procedures, forms, and other rules necessary for its effective operation, provided they are consistent with the provisions of this section. c. The committee's decisions are final and are not grievable. 3. Bargaining unit members may donate days from their vacation, floating holiday, or sick leave balances to the leave pool one time per year in January. a. No employee shall be permitted to donate more than three days of leave per year to the pool. In the event that the leave pool becomes insufficient to provide leave days, the committee may, with the prior approval of the City Manager or designee, open up the opportunity for additional donations to be made during the calendar year. This shall be limited to one time per year; however, the 3-day donation limit shall not be modified. b. All donations of pool leave time must be in full-day increments based on the employee's full- time regularly scheduled day (i.e. an 8-hour or 24-hour day is a full day). c. Donations of pool leave time are irrevocable. d. No dollar value shall be placed on leave donations. All donations and all authorized usage shall be computed as day for day. 4. When pool leave time is authorized by the committee for use by an employee, it shall be on a day- for- day basis, irrespective of whether the employee works an 8-hour or 24-hour shift. An employee using leave pool time shall receive regular base pay and his/her regular shift pay; however, other pays shall not be provided with leave pool days (e.g., lead pay, acting pay, special assignment pay, etc.). 5. Pool leave time not used in a given year by the employee receiving the donated pool leave time shall be returned to the leave pool and carried over to the next year. No donated pool leave time will be refunded to the donor. 41 Section 4. Funeral Leave A. 53/50-hour schedule employees shall be allowed up to three (3) consecutive shifts off with pay and 40 hour schedule employees shall be allowed up to four (4) consecutive duty days off with pay in the event of a death in the immediate family which shall be limited to spouse or domestic partner of record, as defined in accordance with criteria, policies, and procedures determined by the City, or the employee's or employee's spouse's or domestic partner’s child, parent, foster-child(ren), minor- guardianship(s), brother, sister, grandparent, grandchild, great-grandchild, stepparent, or stepchild. This is not chargeable to sick leave. Employees may be required to produce legal justification for foster Child(ren)/Minor Guardianship. B. 53/50-hour schedule employees shall be allowed up to two (2) consecutive shifts and 40- hour schedule employees shall be allowed up to three (3) consecutive duty days in the event of a death of a member of the “Close” family chargeable to sick leave. “Close” family shall be defined as the following family members: step-brother, step-sister, brother’s wife, sister’s husband, uncle, aunt, nephew, niece, or other member of the employee’s immediate household. C. Additional time off may be granted by the Fire Chief, or their designee and shall be chargeable to sick leave. Furthermore, any employee availing himself/herself of a provision in this section must notify the Fire Chief or their Fire District Commander of such intent as soon as possible. Section 5. Absence Without Leave A. Any employee who is absent from duty for two consecutive work days for 53/50-hour schedule employees and three consecutive work days for 40-hour schedule employees without notice and valid reason therefore shall be deemed to have voluntarily terminated his/her City employment and to have vacated his/her position and will be separated from the payroll as a dismissal unless a leave of absence is subsequently granted under any of these rules. B. The failure of an employee to report for duty at the expiration of a leave of absence or vacation leave with or without pay, shall be deemed an absence without leave. Section 6. Time Off From Duty A. An employee may be granted necessary time-off from his/her duties with compensation for any of the following reasons, when such time off does not, in the judgment of the Fire Chief, interfere with the operation of the Department. 1. Attendance at professional or other conventions, institutes, courses, classes, seminars or meetings when such attendance is approved in advance by the Fire Chief or his/her designee. Attendance will be at the discretion of the Fire Chief except when the requested leave is for promotional exams which will get first priority. 2. Attendance at in-service training and other in-service meetings when approved by the Fire Chief or his/her designee. The provisions of this paragraph shall be deemed to include authorized safety meetings. 42 3. The President, Secretary-Treasurer, or designee of the Union shall be granted Union time-off to attend state and international conventions, provided a minimum of one month's written notice is given to the Fire Chief. B. The Union may, upon request, be allowed up to 400 duty hours per fiscal year to be excused for Union business, conferences, training, and Executive Board meetings pertaining to the City of Clearwater. Any such request must be initiated in writing to the Fire Chief or designee, and will give the name of the person wanting off, date the person is to be off, and the number of hours the person will be off. Time off from duty under this provision must be approved by the Fire Chief or his/her designee and must be taken in not less than four-hour increments. Absences for Union time excluding the Union president/designee shall count toward the total number of seven employees permitted to be absent for personal leave on any given shift. Any unused portion of the balance is to be carried over into the next contract year. Any use of City facilities for Union-related business shall require written request at least 48 hours in advance to the Fire Chief, which may be granted or denied at his/her sole discretion. Executive Board members only shall be permitted to conduct/attend Executive Board meetings while on duty with no charge to the aforementioned Union time, with the prior approval of the Fire Chief or his/her designee, provided 48 hours notice is given, and further provided that such meetings will cause no adverse impact to Department operations. Off-duty Executive Board members shall not be eligible to receive any compensation for time spent attending such meetings. Union officials utilizing union time shall not be eligible during the time of utilization for Worker's Compensation benefits in case of injury. In any event, absence from duty for union business shall not be approved which requires a union official to be off duty for periods in excess of three consecutive scheduled work shifts. Extension of any consecutive time off for union officials, over and above the three consecutive shifts, may be granted solely at the discretion of the Fire Chief. Requests for union time off must be made on the designated form. Jointly related business between the City and the Union shall not be subject to deduction from the bank, however, the Union acknowledges that such time needed for arbitration hearings will be chargeable to the account. In any event, the Fire Chief or his/her designee, may at his/her discretion deny any request not made at least 72 hours in advance and submitted by a Union Officer, or which renders the Department staffed below that level which the Chief determines to be necessary. Section 7. Right to Contribute Work In the event that an employee's illness or physical incapacity should continue beyond the point where his/her accumulated sick leave, if any, has been exhausted, he/she may request to have other qualified employees of the Department perform his/her regular duties; provided that such substitution would not require overtime compensation for the substitute and the maximum allowable contributed time to any one employee is a total of 90 calendar days for the duration of this contract. Section 8. Military Leave Any regular or probationary employee in the classified service being inducted or otherwise entering the armed forces of the United States in time of war, or pursuant to the Selective Service Act of 1948 as amended, or of any other law of the United States, shall be granted military leave of absence without pay for the period of the military service required of him/her, and on completion thereof be reinstated in the 43 City service in accordance with the following regulations: A. Military leaves shall be granted in accordance with the provisions herein except where said provisions may be superseded by Federal or Florida Law: 1. For inductees, the minimum period of time required to be served. 2. For enlistees in time of war, the period of the first minimum enlistment, or for such additional period of time required to be served. 3. For reservists, the minimum period of time required to be served. 4. For pre-induction physical examination when so ordered by a Selective Service Board, time off shall be granted for the minimum period necessary to comply with such order, but shall in no case exceed two (2) regularly scheduled work days. 5. For required active or inactive training duty as a member of a Reserve Component or the National Guard falling on the employee's regularly scheduled work days, the employee shall be allowed up to a maximum of two hundred and forty (240) working hours per calendar year without loss of pay. Absences from duty for required military reserve training in excess of two hundred and forty (240) working hours per calendar year or for any non-required military reserve training for which the employee initially volunteered shall not be compensated for by the City. A copy of the employee's military orders certifying his/her training assignment shall be submitted by the employee to the Fire Chief and the Human Resources Department immediately upon receipt by the employee. An employee who is required to attend military duty training which falls or occurs during regular working hours and which exceeds the two hundred and forty (240) working hours provided above will be granted time off without pay. Due to the unique 24 hours shift schedule, the employee may break the absence time into 12 hour blocks and will be charged for a 6 hour block of time in order to facilitate travel and military duty requirements. The employee shall be required to provide timely notice of such training assignments to the City of such training assignments. Failure to provide any of the timely notices herein required of an employee's military orders to the Fire Chief and the Human Resources Department shall be considered just cause for disciplinary action not to exceed a three (3) day suspension. B. For the purposes of this Section, "armed forces" shall be defined to include: 1. The Army, Navy, Marine Corps, Air Force and Coast Guard. 2. The auxiliary services directly necessary to and actually associated with the armed forces of the United States, as may be determined by the City. C. Application for reinstatement must be made within 90 calendar days from date of discharge or release, or from hospitalization continuing after discharge for a period of not more than one year. Such application shall be in writing to the Human Resources Director and shall be accompanied by evidence of honorable discharge or release. 44 D. Upon return from military leave, the employee shall be reinstated in the City service in accordance with the following regulations: 1. If still qualified to perform duties of his/her former position, the employee shall be restored to position or to a position of like seniority, status and pay; or 2. If not qualified to perform the duties of his/her former position by reason of disability sustained during such service but qualified to perform the duties of any other position in the employ of the City, the employee shall be restored to such other position, the duties of which the employee is qualified to perform, as will provide the employee with like seniority, status and pay, or the nearest approximation thereof consistent with the circumstances in his/her case. 3. In the event no vacancy exists in the appropriate class and there is an employee in such class serving a probationary period who has not acquired regular status, then such probationary employee shall be laid off and the returning employee reinstated. 4. If a returning employee has regular status and cannot be reinstated under the prov1s1ons of paragraph (3) above, then the employee having been employed in the appropriate class for the shortest period of time shall be laid off and the returning employee reinstated. 5. A returning employee shall have the same status as prior to the beginning of his/her military leave. The employee shall be allowed to take any subsequently administered examination for promotion after return that he/she would have been eligible to take had he/she not been on military leave, and shall be required to complete any uncompleted period of probation. No grievance shall be filed or processed by any other employee or the Union in connection with this paragraph. 6. The employee shall submit to such medical and/or physical examinations as the City Manager shall deem necessary to determine whether or not such military service has in any way incapacitated him/her for the work in question; provided however, that as far as practicable any employee returning with disabilities shall be placed in such employment as the City Manager shall deem suitable under the circumstances. 7. Any regular or probationary employee receiving a dishonorable discharge from the armed forces shall not be reinstated to any position in the City service. 8. An employee granted a military leave of absence shall, insofar as possible, have all the rights and privileges he/she would have had if he/she had remained on duty including cumulative seniority, and except as otherwise provided in these Rules and Regulations, all other benefits dependent on length of employment to the same extent as if the employee had not been absent on such leave. An employee returning from military service shall be reinstated to active City service at the earliest possible date following application for such reinstatement, consistent with the best interests of the City service and taking into consideration necessary adjustments of staff. However, in no event shall this period be more than thirty (30) calendar days. The City shall have the right as part of directing the employee's duties upon returning to work, to assign the employee to such training as is necessary in its judgment to ensure the employee's familiarity with job duties and knowledge. 9. Eligible employees will be paid in accordance with Sections 115.09 and 115.14, Florida Statutes. 45 Section 9. Parental Leave The City will provide up to three shifts for 53/50-hour weekly schedule employees and one week (40 hours) for 40-hour weekly schedule employees of paid parental leave following the birth of an employee’s child or the legal permanent placement of a child with an employee in connection with adoption or foster care. This paid leave will run concurrently and in conjunction with the Family and Medical Leave Act. Eligible employees must meet the following criteria: (i) Have been employed with the City for at least 12 months. (ii) Have worked at least 1,250 hours during the 12 consecutive months immediately preceding the date the leave would begin. (iii) Be a regular full-time employee. Employees must be taking leave for one of the reasons listed below: (i) To bond with the newborn child within one year of birth. (ii) The legal permanent placement of a child with the employee for adoption or foster care and to care for the newly placed child within one year of placement. The fact that a multiple birth, adoption or placement occurs (e.g., the birth of twins or adoption of siblings) does not increase the total amount of paid parental leave granted for that event. In addition, in no event will an employee receive more than three shifts for 50-hour weekly schedule employees and one week (40 hours) for 40-hour weekly schedule employees of paid parental leave in a rolling 12-month period, regardless of whether more than one birth, adoption or foster care placement event occurs within that 12 month time frame. Paid parental leave is compensated at 100 percent of the employee’s regular, straight-time weekly pay. Paid parental leave will be paid on a biweekly basis on regularly scheduled pay dates. Approved paid parental leave may be taken at any time during the 12-month period immediately following the birth, adoption or legal permanent placement of a child with the employee. Paid parental leave may not be used or extended beyond this 12-month time frame. Employees must take paid parental leave in one continuous period of leave and must use all paid parental leave during the 12-month time frame indicated above. Any unused paid parental leave will be forfeited at the end of the 12-month time frame. The employee will provide their supervisor and the Human Resources Department with notice of the request for leave at least 30 days prior to the proposed date of the leave (or if the leave was not foreseeable, as soon as possible). Employees must return to work for the City for at least 6 months following the paid parental leave. An employee will be responsible for repayment if this commitment is not fulfilled. The repayment will be deducted from the employee’s sick time balance first, followed by their personal floating holiday and then vacation. 46 ARTICLE 9 WAGES AND COMPENSATION Section 1. Pay Schedule The Pay Schedules shall be in accordance with Appendix A. Effective on the first day of the payroll period that includes October 1, 2024, all employees will be paid in accordance with the new annual rate of pay as provided in Appendix A. Effective for the period from October 1, 2024, through September 30, 2025, employee shall advance in Step as provided in this Article 9. Employees may not exceed the maximum annual rate of pay as provided in Appendix A. Effective on the first day of the payroll period that includes October 1, 2025, the City shall provide a 4% general wage increase for all employees, as set forth in Appendix A. Effective for the period from October 1, 2025, through September 30, 2026, employee shall advance in Step as provided in this Article 9. Employees shall not exceed the maximum annual rate of pay as provided in Appendix A. Effective on the first day of the payroll period that includes October 1, 2026, the City shall provide a 3% general wage increase for all employees, as set forth in Appendix A. Effective for the period from October 1, 2026, through September 30, 2027, employee shall advance in Step as provided in this Article 9. Employees shall not exceed the maximum annual rate of pay as provided in Appendix A. Any further step advancements and general wage increases after September 30, 2027 will be dependent upon and subject to negotiations in any successor Agreement. Section 2. Pay Schedule Format: Merit Pay Increases Pay increases are not automatic but are management review rates and may be granted only upon receiving a rating of Meets Standards or better on the annual performance review. Eligibility for review for within pay schedule increases shall be as follows: Step 1 — Original appointment Step 2 — At the end of one year of satisfactory service in step 1. Step 3 — At the end of one year of satisfactory service in step 2. Step 4 — At the end of one year of satisfactory service in step 3. Step 5 — At the end of one year of satisfactory service in step 4. Step 6 — At the end of one year of satisfactory service in step 5. Step 7 — At the end of one year of satisfactory service in step 6. Step 8 — At the end of one year of satisfactory service in step 7. Step 9 — At the end of one year of satisfactory service in step 8. Step 10 — At the end of one year of satisfactory service in step 9. Step 11 — At the end of one year of satisfactory service in step 10. Step 12 — At the end of one year of satisfactory service in step 11. Step 13 — At the end of one year of satisfactory service in step 12. Step 14 — At the end of one year of satisfactory service in step 13. Step 15 — At the end of one year of satisfactory service in step 14. Step pay increases shall provide for approximately a 3% increase over the preceding step for each step 47 advancement as provided in Appendix A. Section 3. Merit Pay Review - Increases and Delay or Denial Employees who receive a merit eligibility evaluation rating of Meet Standards or better shall be advanced as provided in Section 2 above. Employees who receive a merit eligibility evaluation rating of less than Meet Standards shall not be granted a merit step advancement. Such employees shall be reevaluated after three months and if then rated Meet Standards, shall be granted a merit step adjustment as of the date of the three-month follow- up evaluation. If the initial three months follow-up evaluation rating is still less than Meet Standards, the employee shall be evaluated again in three more months. If then rated Meet Standards or higher, the employee shall be granted a merit step adjustment as of the end of that second three-month follow-up period. If the employee is rated less than Meet Standards on the second three-month follow-up evaluation, no merit step adjustment shall be made, and the employee will be evaluated again one year from the date of the initial annual evaluation which was less than Meet Standards. Section 4. Rates of Pay A. Base rate of pay is defined as compensation at the rate prescribed for the job class in the Pay Schedule. B. Regular rate of pay is defined as base pay and any assignment pay if regularly assigned. C. Overtime is defined as one and one-half times an employee's regular rate of pay. Section 5. Annual Personal Resource Allowance A. All members of the bargaining unit who are actually working on January 1st of each year shall be provided an annual allowance of $540.00 per year, which shall be utilized to cover (1) the costs of laundering coat, shirts, pants, jumpsuit, and bed linens, (2) the replacement of personal items such as glasses, watches, hearing aids, etc., and (3) time spent attending the annual physical, except for 40-hour schedule personnel who shall attend on duty, but shall still receive the allowance. B. An employee who is on extended sick leave (60 days or more) or has been approved for regular disability retirement by the Pension Advisory Committee shall no longer be eligible for the personal resource allowance. C. The annual resource allowance shall be paid on a quarterly basis to eligible bargaining unit members who are actually working at the time of the quarterly payment, and shall reflect the appropriate amounts subject to withholding and not subject to withholding for tax purposes. Section 6. Mileage Reimbursement A. For each move a member of the bargaining unit is required to make, and use his/her own vehicle, 48 after he/she has reported to his/her duty station, the City will provide reimbursement to the employee in accordance with Sec. 2.328 of the City of Clearwater Code of Ordinances; or, the City may elect to provide transportation. B. The mileage reimbursement rate shall be consistent with City Policy. C. This distance will be computed by the City, so that both the City and employee can refer to a standard table to ascertain the distance between any two Fire Stations. D. Request forms for mileage reimbursement must be made to the Fire Chief’s office monthly. E. In the event that an employee is transported in a City vehicle under the provisions of this part, the City will provide the employee transportation back to his/her duty station at or before the end of the employee's tour of duty if the employee so requests. Section 7. Special Teams Any employee who meets the current certification guidelines set forth by the Fire Chief and is specifically assigned to a Special Team on a scheduled shift shall receive $60.00 per payroll period in addition to the current base rate of pay. Bargaining unit members who meet the current certification guidelines set forth by the Fire Chief and are assigned as team leaders shall not receive the Special Team pay as described above, but shall instead receive $70.00 per payroll period in addition to the current base rate of pay. Special Team training and assignments shall be made at the discretion of the Fire Chief or his/her designee and Special Team Pay will be provided to a maximum number of employees as follows: Dive Team - 6 per shift plus one team leader Technical Rescue Team- 8 per shift plus one team leader Emergency Response (SWAT) Team-4 per shift plus one team leader Employees may participate on more than one Special Team but shall be eligible to be compensated for up to two Special Teams only. Additional employees may be permitted to participate in the training process only based on availability of funds. The department shall provide the initial issue of clothing and equipment particular to Special Teams and the replacement of clothing (shirt, pants, coat, and jumpsuit) will be the responsibility of the employee through the use of the annual Personal Resource Allowance. Initial issue Special Team clothing shall be the following: DIVE 1 x Jacket 1 x Jumpsuit 1 x Swim Trunks 1 x Shirt 1 x Shorts TECH RESCUE 3 x Shirts 3 x Boots SWAT 2 x Shirts 2 x Pants 1 x Boots MARINE 1 x Shirt 1 x Swim Trunks An employee may be removed from a Special Team assignment if he/she is unable to participate for a period of 30 days or more for reasons other than scheduled leave. Special Team pay may be discontinued at any time should the City no longer continue to provide the designated service. 49 Section 8. EMS Wages A. All employees shall receive pay in accordance with Pay Schedule. B. Employees who serve in the non-Paramedic job classifications of Firefighter, Firefighter/Driver-Operator, and Fire Lieutenant, and who are State of Florida and Pinellas County certified as a Paramedic, shall receive a Paramedic certification pay differential of $225.00 per payroll period. These employees shall be required to perform the duties of a State of Florida and Pinellas County certified Paramedic. C. The Department agrees to publish a semiannual list of the dates of expiration of all E.M.T. and Paramedic certifications. Section 9. Training, Tuition Refund, Bilingual and Incentive Pay A. Members of the bargaining unit shall be entitled to participate in a tuition reimbursement program provided that all classes are off-duty, except for promotional courses for the positions of Lieutenant and/or Fire District Commander where department policy will be followed. However, the City and the Union may agree to pro rate such tuition reimbursement for classes which cross both on-duty and off-duty time. B. The tuition refund for members of the bargaining unit shall be up to $2,000.00 per year for each year of the agreement. However, if classes taken by a bargaining unit member pertain to an advanced degree program (Master’s Degree or higher), then up to $2,200.00 of tuition paid for such classes shall be reimbursable. C. Participation in Tuition Refund will not imply any eligibility for school time pay nor will it impose any obligation to the City under FLSA. D. Except for training requirements occasioned by extended vacations, when a bargaining unit member is directed by the Department to attend classes, the member will be compensated for the hours spent in accordance with the law. E. The City shall provide and maintain reasonable training grounds and facilities. F. The City agrees to pay the tuition only for classes required as part of a State of Florida Paramedic certification program for up to one bargaining unit member per shift or 3 members total, whichever is greater, for each year of this Agreement provided that the classes are offered in such a manner that the employees may attend the classes during non-duty hours, and such class hours shall not be counted as hours worked. Should such classes not be available in a manner that the employees may attend during non- duty hours, the Fire Chief in his/her sole discretion shall determine whether to release the employees from duty for only the hours necessary to attend the classes. In such case, the employees shall be expected to serve the remaining hours of any shift for which they are scheduled. Any prerequisite classes necessary to participate in a State of Florida Paramedic certification program shall only be subject to the tuition reimbursement provisions outlined in Paragraphs A-D above and in accordance with established Department guidelines to determine whether or not the class hours constitute compensable time. Any existing employee who obtains a State of Florida Paramedic certification through the process outlined in this Section shall be required to comply with the requirements necessary to obtain and maintain certification as a Paramedic in Pinellas County, and shall be required to remain with Clearwater Fire and 50 Rescue and serve as a Fire Medic when called upon to do so for a period of five years or shall be subject to repayment of any costs incurred by the Department for such classes. Should an employee voluntarily leave the department or be permitted to voluntarily demote to a non-paramedic classification in accordance with this agreement before the end of the five year period, the amount of such repayment shall be prorated by 3- month increments with the employee being required to pay the prorated amount corresponding to the number of remaining full 3-month periods not served. G. Any employee who has successfully passed a proficiency exam and has been designated as a certified bilingual interpreter shall be eligible to receive $25.00 per payroll period in addition to the employee’s current base rate of pay. H. Any employee who obtains and meets certification guidelines set forth by the Fire Chief is eligible for two of the following incentive pays. State of Florida Fire Officer 1 $25.00 per payroll period State of Florida Fire Officer 2 $25.00 per payroll period State of Florida Fire Inspector 1 $25.00 per payroll period State of Florida Fire Inspector 2 $25.00 per payroll period State of Florida Arson Investigator $25.00 per payroll period Incentive Pay is only available when the above-referenced certification(s) are not required as part of the employee’s current job description. In the event an employee demotes, promotes, or otherwise transfers to another job position in which the certification(s) are required as part of the employee’s new job description, the employee is no longer eligible for incentive pay. Incentive pay shall be capped at $50.00 per payroll period. Section 10. Clothing and Equipment A. The City shall continue to provide the initial clothing and protective devices currently supplied, or their equivalent, and initial safety equipment currently supplied, without cost to the employee. Employees shall be required to wear or use the clothing or other items provided unless a suitable replacement as determined and approved in advance by the Department is provided by the employee at the employee's own cost. The employee will replace any lost or abused equipment that has been supplied by the Department by purchasing the lost or abused equipment from the Department at the value of the lost or abused equipment, as determined by the Fire Chief. Initial issuance for all new employees shall be in compliance with the table below. Item Description Suppression / EMS Inspection Bunker Cost 1 As Assigned Bunker Pants 1 As Assigned Firefighting Boots 1 As Assigned Firefighting Gloves 1 As Assigned Firefighting Helmet 1 As Assigned 51 Item Description Suppression / EMS Inspection Firefighting Mask 1 As Assigned Firefighting Regulator 1 As Assigned Nomex Hood 2 As Assigned Safety Vest 1 As Assigned Howd Strap 1 As Assigned Flashlight 1 As Assigned Coat 1 1 Pants 6 8 Shorts 2 T-Shirt Short Sleeve 8 T-Shirt Long Sleeve 3 Class A – Short Sleeve 6 3 Class A – Long Sleeve 1 1 Sweatshirt 1 Jumpsuit 1 1 Hat 1 Tie 1 Badge 1 2 Nametag 1 1 Collar Insignia Sets 2 1 Blanket 1 Pillow 1 ID – City 1 1 ID – County 1 1 Safety Shoes 2 pairs 2 pairs Personal Escape Rope 1 Polo Shirt *Lt. Rescue receives 2 4 B. All employees will be provided an initial issue of any new items in addition to those on the list above when such items are required by the Department. Equivalent variations of clothing items on the list above, such as coats, shirts, and pants, may be provided by the Department to all newly hired employees and shall be available to existing incumbent employees through the use of the personal resource allowance as defined in this Agreement. C. All items issued by the Department shall be returned to the Department before an employee leaves the service of the Department either by termination, resignation, retirement, etc. Should any such items not be returned, the City shall withhold from the employee's final paycheck an amount sufficient to reimburse the City at a pro-rated replacement cost of the equipment. D. The Department shall issue and maintain uniforms and equipment to personnel it determines necessary in order to provide an Honor Guard presence as the City deems appropriate and subject to the availability of funds. It is understood that the decision whether to have an Honor Guard, and who shall be designated to participate, rests with the Fire Chief in his sole discretion. Any items issued to Honor Guard personnel shall remain the property of the Department and shall be returned upon separation in accordance with Paragraph C of this Section above. 52 E. The Department shall annually replace the following uniform items in accordance with the established by the department. Pants 2 pair Pants (tactical) 2 pair Shorts 2 pair Short Sleeve Tee Shirts 6 Short Sleeve Shirt 1 Jump Suit 1 every 2 year Long Sleeve Tee Shirts 3 Polo Shirt (Inspections Only) 2 Polo Shirt (Lt. Rescue 1 Safety Shoes 2 pairs upon hire and will be replaced as needed Section 11. Standby A. Fire Prevention Inspectors, Fire Inspector II, and Fire Inspector I, (both primary and back-up), who are assigned to remain in a standby status while not on duty shall be paid at the following rates during the term of this agreement: Monday through Friday $50.00 per night Weekends $75.00 per day Extended Time During Designated Holidays $75.00 per day B. Standby assignments are mutually exclusive of call-in and holdover provisions of this agreement. Nightly standby (Monday - Friday) shall begin at the end of each regular workday and shall end at the beginning of the next workday (16-hour period). Weekend standby shall begin at the time which would be the employee's normal starting time on Saturday and shall conclude at the beginning of the employee's regular workday on Monday (48-hour period). Extended Time During Designated Holiday shall apply when the employee assigned to standby continues in standby assignment for an 8-hour extended period on a designated holiday. In addition to the above, an employee who is called out to work while on nightly or weekend standby duty shall be credited with one hour work time or the actual hours worked during the entire standby period, whichever is greater. C. The Department retains the discretion but is not required to assign a take-home vehicle to Fire Prevention Inspectors who are subject to standby. Section 12. Paycheck Issuance All employees are encouraged to enroll in direct deposit. Paychecks will be issued biweekly via direct deposit for employees enrolled in direct deposit. Paychecks will be issued biweekly via pay card for employees not enrolled in direct deposits. 53 ARTICLE 10 INSURANCE Section 1. Life Insurance All life insurance premium contributions and plans currently in force shall continue for the duration of this Agreement. The selection of an insurance company shall be free and without prejudice and of the employee’s choice from the companies offered by the City, with the approval of the Insurance Committee. The Union agrees to participate with the Insurance Committee in making decisions regarding life insurance. The City shall no longer permit any new enrollment in the 1% Life Insurance Program. Bargaining unit employees who are enrolled as of the effective date of this Agreement may continue to participate provided, they maintain their participation on a continuous basis thereafter. Any employees who currently participate and choose to discontinue their enrollment will not be permitted to re-enroll in this benefit again at a later date. Section 2. Death Benefits The current practice of paying accrued rights and benefits to the designated beneficiary or next-of-kin upon the death of an employee shall continue. Section 3. Health Insurance The City agrees to meet with the I.A.F.F. and other City of Clearwater union representatives to review the health insurance program for the purpose of reducing the cost of such program for the City and the employees. The City further agrees to provide the I.A.F.F. with such information as would be required to formulate such a benefit package and to cooperate with the I.A.F.F. and other unions to obtain pertinent information from the present carrier. The City agrees that for the calendar year occurring within the first year of the agreement, the City shall contribute toward the medical insurance premiums for employees and their dependents in the amount approved for the plans approved by the City Council. The City agrees to maintain the current Benefits Committee recommendation process culminating in final action by the City Council to determine medical insurance premiums for employees and their dependents for the duration of this Agreement. The City further agrees that during the life of the agreement, the City will make available to employees the option of at least one health insurance plan for which the City shall pay 100% of the premium for the employee only base benefit plan cost, it being understood that such base plan may provide a different level of benefit than that which is currently provided. Additional coverage for the family or spouse, as well as any enhancements or “buy ups” to the base plan will continue to be paid for by the employee. Any information received by either party from the consultant or from another carrier will be shared with the other party. 54 ARTICLE 11 PERFORMANCE AND DISCIPLINE The City and the Union agree that any system of discipline or performance management should be continually reviewed for its effectiveness. The system may be modified from time to time to better meet the needs of the employees and the City. Any changes will be consistent with sound personnel practices. All discipline will be for just cause and consistent with due process. Employees have the right to Union representation any time they believe a meeting may lead to disciplinary action. The City-wide and Fire Department standards shall be in writing. The Union will provide input as the standards are developed and/or modified. If the Union refuses to participate or provide input, the City and the Fire Department maintain the right to change the process. The City recognizes that members of the Fire Department are protected by the “Firefighter Bill of Rights” and any disciplinary action will conform to the guidelines of that law. ARTICLE 12 CITY’S DRUG AND ALCOHOL PROGRAM POLICY A. The City's Drug and Alcohol Program Policy delineates drug and alcohol test procedures. Revisions governing testing standards and job classification specifications shall be made as revisions to laws or regulations of state or federal government or agencies deem permissible. Union representatives will be furnished with copies of the policies upon such revision. Whenever the City or the Union proposes to amend or change any policy affecting drug and alcohol testing, the City or the Union shall provide notice and a copy of the proposed amendments or changes to the other party a reasonable period of time in advance of the proposed effective date of the change. The Union and the City shall have the right to bargain such proposed amendments or changes in accordance with the law and the terms of this agreement. B. References to CDL and "safety-sensitive" employees and positions shall not apply to IAFF bargaining unit members. As such, IAFF bargaining unit members shall not be subject to the following provisions of the City Drug and Alcohol Program Policy or agreed to by the parties: Section II, B. Section II, C. Section II, E. 2. Section II, E. 4. 55 ARTICLE 13 RETIREMENT Section 1. The City and the Union agree that prior to retiring an employee may use his/her vacation leave balance at 100% value and sick leave balance at 50% value to advance the employee's date of retirement. Section 2. The employee will be considered a regular employee for service credit to the pension plan. The City and the employee will continue to contribute to the pension plan. Section 3. During the period of "retirement advancement", the employee will not be eligible to receive or accrue any benefits except retirement credit, and Educational Incentive Pay. The benefits that will stop include, but are not limited to, vacation and sick leave accrual, insurance premium payments, workers' compensation, holidays and holiday pay, allowances, reimbursements, and special payments of any kind. ARTICLE 14 SENIORITY, LAYOFF, AND RECALL Section 1. Seniority A. Definition -- Seniority is hereby defined as the length of continuous service in City employment except as applied to vacation preference, promotions, layoffs, and assignments. B. How Measured 1. In the event an employee transfers from the Fire Department to another position within the City and, at a later date, transfers back to the Fire Department, the seniority date for the purpose of layoff, promotions, and transfers, shall be the date the employee transfers back into the Department. 2. Any employee who transfers from another City department to the Fire Department shall retain full City seniority with regards to vacation and sick leave accrual. However, for purposes of layoff, departmental seniority shall prevail. In regards to pay and pensions, the applicable civil service rules or City Pension ordinance shall apply. 3. In the event two or more employees have the same seniority date, the employee whose first letter of his/her last name is closest to the letter "A" shall have more seniority. 4. The seniority list on the date of this agreement shall reflect names, job titles, and seniority dates (departmental and City) of all employees. 5. The City will maintain a current seniority list at all times and will provide the Union with copies of such list in December and June of each year. 6. Emergency, provisional, seasonal, and temporary part-time employees shall not accumulate seniority during any period of such employment. 56 C. Continuous service shall mean employment by the City in a position in the classified service without interruption or break, except that the following shall not be considered as breaks in employment: 1. Leaves of absence or time off with or without compensation granted pursuant to this Contract. The length of any such leave shall not be deducted from the length of continuous service in computing seniority. 2. Layoffs for lack of work, lack of funds, abolition of position, or because of material changes in duties or organization, not exceeding one year in length, followed by reinstatement or by appointment from the reemployment list. The length of any such layoff shall not be deducted from the length of continuous service in computing seniority. 3. Disability retirement if and when followed by reinstatement. The length of any such disability retirement shall not be deducted from the length of continuous service in computing seniority. 4. Suspensions of less than three months in accordance with this Agreement. The length of any such suspension of more than three months shall be deducted from the length of continuous service in computing seniority. 5. Dismissals subsequently withdrawn or modified by the Appointing Authority, arbitration award, grievance decision, or the Civil Service Board in accordance with this Agreement. 6. Resignations subsequently withdrawn, in accordance with this Agreement, within six months after acceptance, followed by reinstatement or appointment from the reemployment list; provided, however, that the actual length of separation from the service shall be deducted from the length of continuous service in computing seniority. D. Uses -- In addition to the circumstances and conditions wherein, by the provisions of this Agreement and/or these Rules, seniority has been determined to be the controlling factor, it shall also be given reasonable consideration in determining the order of layoff, the order of names on a reemployment list and in promotions in accordance with the rules governing those procedures. E. Transfer -- In the event of a transfer or appointment from certification to another department, an employee shall retain all accumulated seniority. Section 2. Layoffs A. In the event of layoffs, all probationary status employees in the class involved shall be laid off before any permanent status employees in the class involved. The order of layoff of probationary employees shall be determined by management evaluations of the performance and potential of the employees. B. In the event further layoffs are required, such layoffs shall be accomplished by class groups of Firefighter, Firefighter/Driver-Operator, Fire Medic, Fire Lieutenant, Fire Medic Lieutenant, and Fire Prevention Inspector. Notwithstanding anything to the contrary contained in this. Agreement, Management shall determine the number of employees to be laid off and the class or classes involved. An employee who is designated to be laid off shall have the opportunity to revert to the position 57 he/she held prior to his/her current classification. If this movement requires further reduction in the work force, the same procedure shall be utilized for subsequent positions in accordance with this section, and the process continued through the ranks thereafter. Within the involved classes, layoffs shall be accomplished by the following groupings: 1. Group A -- Employees with one through three years of service in the Clearwater-Fire Department. 2. Group B -- Employees with four through six years of service in the Clearwater Fire Department. 3. Group C -- Employees with seven through nine years of service in the Clearwater Fire Department. 4. Group D -- Employees with 10 through 12 years of service in the Clearwater Fire Department. 5. Group E -- Employees with 13 through 15 years of service in the Clearwater Fire Department. 6. Group F -- Employees with 16 through 18 years of service in the Clearwater Fire Department. 7. Group G -- Employees with 19 or more years of service in the Clearwater Fire Department. All employees in Group A must be laid off before any employees listed in Group B; all employees in Group B must be laid off before any employees listed in Group C; etc. Within each group, employees shall be ranked by management and employees laid off by the rank order established. Management rating of employees can be based upon performance evaluations by management of the preceding 3-year period (if available), disciplinary actions, and physical ability to perform the job. When other qualifications are substantially equal, Fire Department seniority will govern. Management will provide a list of the rank order within Groups prior to the layoff. Section 3. No new employee shall be hired until the employee on layoff has been given an opportunity to return to work at his/her original seniority date and position; provided, that after one year of layoff the employee shall cease to accrue seniority and that such reemployment rights shall cease after two years from the date of layoff. Section 4. The Fire Chief shall give written notice to the Human Resources Director and to the affected employee(s) including the President of the Union, on any such proposed layoff. Such notice shall state the reason thereof and shall be submitted 30 days before the effective date of proposed layoff. 58 ARTICLE 15 DURATION, MODIFICATION, AND TERMINATION Section 1. Amendments This Agreement may be amended at any time by the mutual written consent of the parties, but no such attempted amendment shall be of any force or effect until placed in writing and executed or ratified as required by each party hereto. Section 2. Severability and Waiver A. In the event that any clause or clauses in this Agreement shall be finally determined to be in violation of any law, such clause or clauses only shall be deemed of no force and effect and unenforceable, without impairing the validity and enforceability of the rest of the contract, including any and all provisions in the remainder of any clause, sentence or paragraph in which the offending language may appear. B. The exercise or non-exercise by the City or the Union of the rights covered by this Agreement shall not be deemed to waive any such right or the right to exercise them in some other way in the future. C. In the event of invalidation of any article or section, both the City and the Union agree to meet within 30 days of such determination for the purpose of arriving at a mutually satisfactory replacement for such articles or sections. 59 Section 3. Duration This Agreement shall be effective as of October 1, 2024, and shall continue in full force and effect until September 30, 2027. At any time commencing January 1 of the year in which this Agreement terminates, but no later than 90 days prior to the termination of this Agreement, either party hereto shall notify the other, in writing, of its intention to modify, amend or terminate this Agreement. Failure to notify the other party of intention to modify, amend or terminate, as herein above set forth, will automatically extend the provisions and terms of this Agreement for a period of one year, and each year thereafter absent notification. IN WITNESS WHEREOF, the parties hereto have hereunder set their hands and seals this day of , 2025. ATTEST: CITY OF CLEARWATER, FLORIDA Rosemarie Call, City Clerk Jennifer Poirrier, City Manager Approved as to form Countersigned: David Margolis, City Attorney Bruce Rector, Mayor INTERNATIONAL ASSOCIATION OF FIREFIGHTERS, AFL-CIO, Local 1158 WITNESSES: David Sowers, President, Local 1158 60 APPENDIX A – WAGES FIREFIGHTER PAY RANGE 5540 (106/100 HOURS) Step October 2024 Biweekly October 2025 Biweekly October 2026 Biweekly 1 $ 2,192.31 $ 2,280.00 $ 2,348.40 2 $ 2,258.08 $ 2,348.40 $ 2,418.85 3 $ 2,325.82 $ 2,418.85 $ 2,491.42 4 $ 2,395.59 $ 2,491.42 $ 2,566.16 5 $ 2,467.46 $ 2,566.16 $ 2,643.14 6 $ 2,541.49 $ 2,643.14 $ 2,722.44 7 $ 2,617.73 $ 2,722.44 $ 2,804.11 8 $ 2,696.26 $ 2,804.11 $ 2,888.24 9 $ 2,777.15 $ 2,888.24 $ 2,974.88 10 $ 2,860.46 $ 2,974.88 $ 3,064.13 11 $ 2,946.28 $ 3,064.13 $ 3,156.05 12 $ 3,034.67 $ 3,156.05 $ 3,250.73 13 $ 3,125.71 $ 3,250.73 $ 3,348.26 14 $ 3,219.48 $ 3,348.26 $ 3,448.70 15 $ 3,316.06 $ 3,448.70 $ 3,552.17 FIREFIGHTER/DRIVER-OPERATOR/Fire Inspector I PAY RANGES 5530 (106/100 HOURS) and 5505 (80 HOURS) Step October 2024 Biweekly October 2025 Biweekly October 2026 Biweekly 1 $ 2,500.00 $ 2,600.00 $ 2,678.00 2 $ 2,575.00 $ 2,678.00 $ 2,758.34 3 $ 2,652.25 $ 2,758.34 $ 2,841.09 4 $ 2,731.82 $ 2,841.09 $ 2,926.32 5 $ 2,813.77 $ 2,926.32 $ 3,014.11 6 $ 2,898.19 $ 3,014.11 $ 3,104.54 7 $ 2,985.13 $ 3,104.54 $ 3,197.67 8 $ 3,074.68 $ 3,197.67 $ 3,293.60 9 $ 3,166.93 $ 3,293.60 $ 3,392.41 10 $ 3,261.93 $ 3,392.41 $ 3,494.18 11 $ 3,359.79 $ 3,494.18 $ 3,599.01 12 $ 3,460.58 $ 3,599.01 $ 3,706.98 13 $ 3,564.40 $ 3,706.98 $ 3,818.19 14 $ 3,671.33 $ 3,818.19 $ 3,932.73 15 $ 3,781.47 $ 3,932.73 $ 4,050.72 61 FIRE MEDIC PAY RANGE 5515 (106/100 HOURS) Step October 2024 Biweekly October 2025 Biweekly October 2026 Biweekly 1 $ 2,615.38 $ 2,720.00 $ 2,801.60 2 $ 2,693.85 $ 2,801.60 $ 2,885.65 3 $ 2,774.66 $ 2,885.65 $ 2,972.22 4 $ 2,857.90 $ 2,972.22 $ 3,061.38 5 $ 2,943.64 $ 3,061.38 $ 3,153.23 6 $ 3,031.95 $ 3,153.23 $ 3,247.82 7 $ 3,122.91 $ 3,247.82 $ 3,345.26 8 $ 3,216.59 $ 3,345.26 $ 3,445.61 9 $ 3,313.09 $ 3,445.61 $ 3,548.98 10 $ 3,412.48 $ 3,548.98 $ 3,655.45 11 $ 3,514.86 $ 3,655.45 $ 3,765.12 12 $ 3,620.30 $ 3,765.12 $ 3,878.07 13 $ 3,728.91 $ 3,878.07 $ 3,994.41 14 $ 3,840.78 $ 3,994.41 $ 4,114.24 15 $ 3,956.00 $ 4,114.24 $ 4,237.67 FIRE INSPECTOR II PAY RANGE 5500 (80 HOURS) Step October 2024 Biweekly October 2025 Biweekly October 2026 Biweekly 1 $ 3,076.92 $ 3,200.00 $ 3,296.00 2 $ 3,169.23 $ 3,296.00 $ 3,394.88 3 $ 3,264.31 $ 3,394.88 $ 3,496.73 4 $ 3,362.24 $ 3,496.73 $ 3,601.63 5 $ 3,463.10 $ 3,601.63 $ 3,709.68 6 $ 3,567.00 $ 3,709.68 $ 3,820.97 7 $ 3,674.01 $ 3,820.97 $ 3,935.60 8 $ 3,784.23 $ 3,935.60 $ 4,053.66 9 $ 3,897.75 $ 4,053.66 $ 4,175.27 10 $ 4,014.69 $ 4,175.27 $ 4,300.53 11 $ 4,135.13 $ 4,300.53 $ 4,429.55 12 $ 4,259.18 $ 4,429.55 $ 4,562.43 13 $ 4,386.96 $ 4,562.43 $ 4,699.31 14 $ 4,518.57 $ 4,699.31 $ 4,840.29 15 $ 4,654.12 $ 4,840.29 $ 4,985.50 62 FIRE LIEUTENANT PAY RANGE 5520 (106/100 HOURS) Step October 2024 Biweekly October 2025 Biweekly October 2026 Biweekly 1 $ 3,115.38 $ 3,240.00 $ 3,337.20 2 $ 3,208.85 $ 3,337.20 $ 3,437.32 3 $ 3,305.11 $ 3,437.32 $ 3,540.44 4 $ 3,404.26 $ 3,540.44 $ 3,646.65 5 $ 3,506.39 $ 3,646.65 $ 3,756.05 6 $ 3,611.58 $ 3,756.05 $ 3,868.73 7 $ 3,719.93 $ 3,868.73 $ 3,984.79 8 $ 3,831.53 $ 3,984.79 $ 4,104.34 9 $ 3,946.48 $ 4,104.34 $ 4,227.47 10 $ 4,064.87 $ 4,227.47 $ 4,354.29 11 $ 4,186.82 $ 4,354.29 $ 4,484.92 12 $ 4,312.42 $ 4,484.92 $ 4,619.47 13 $ 4,441.79 $ 4,619.47 $ 4,758.05 14 $ 4,575.05 $ 4,758.05 $ 4,900.79 15 $ 4,712.30 $ 4,900.79 $ 5,047.81 FIRE MEDIC LIEUTENANT PAY RANGE 5510 (106/100 HOURS) Step October 2024 Biweekly October 2025 Biweekly October 2026 Biweekly 1 $ 3,384.62 $ 3,520.00 $ 3,625.60 2 $ 3,486.15 $ 3,625.60 $ 3,734.37 3 $ 3,590.74 $ 3,734.37 $ 3,846.40 4 $ 3,698.46 $ 3,846.40 $ 3,961.79 5 $ 3,809.41 $ 3,961.79 $ 4,080.64 6 $ 3,923.70 $ 4,080.64 $ 4,203.06 7 $ 4,041.41 $ 4,203.06 $ 4,329.16 8 $ 4,162.65 $ 4,329.16 $ 4,459.03 9 $ 4,287.53 $ 4,459.03 $ 4,592.80 10 $ 4,416.16 $ 4,592.80 $ 4,730.59 11 $ 4,548.64 $ 4,730.59 $ 4,872.50 12 $ 4,685.10 $ 4,872.50 $ 5,018.68 13 $ 4,825.65 $ 5,018.68 $ 5,169.24 14 $ 4,970.42 $ 5,169.24 $ 5,324.32 15 $ 5,119.53 $ 5,324.32 $ 5,484.05 63 ADDENDUM MILITARY AND PRIOR FIREFIGHTER BUYBACK Military and prior firefighter buybacks (1) Buyback of prior fire service. The years or fractional parts of years that a Member previously served as a firefighter for any other municipal, county or state fire department in the State of Florida shall be added to his or her years of credited service provided that: (a) The member contributes to the fund an actuarially determined amount so that the crediting of the purchased service does not result in any cost to the fund plus payment of costs for all professional services rendered to the board in connection with the purchase of years of credited service. A member who does not purchase years of credited service shall be responsible for the payment of costs for all professional services rendered to the board in connection with the purchase of years of credited service. (b) Multiple requests to purchase credited service pursuant to this section may be made at any time prior to retirement. A firefighter member may only purchase prior firefighter service. (c) Payment by the member of the required amount can be made by either lump sum payment or equal biweekly installments. Payment by lump sum shall be made within six months of the request for credit. Payment by payroll deductions shall be in equal biweekly installments for a period which shall not exceed the number of years being purchased. A member making installment payments shall be charged interest based on the actuarially assumed rate of return at the time the purchase is made and shall complete all required payments prior to payment of any benefit under this section. (d) The maximum credit under this section for service other than with the City of Clearwater when combined with credited service purchased pursuant to section (2) military service prior to employment, shall be five years of credited service and shall count for all pension purposes, except vesting and eligibility for disability benefits off-duty. (e) In no event, however, may credited service be purchased pursuant to this section for prior service with any other municipal, county or state fire department, if such prior service forms or will form the basis of a retirement benefit or pension from another retirement system or plan. (f) For purposes of determining credit for prior fire service as a firefighter as provided for in this section, in addition to service as a firefighter in this state, credit may be given for federal, other state, or county service if the firefighter provides proof to the board that such service is equivalent to the service required to meet the definition of a firefighter under section 2.412. (2) Military service prior to employment. The years or fractional parts of years that a firefighter serves or has served on active duty in the military service of the Armed Forces of the United States, the United States Merchant Marine or the United States Coast Guard, voluntarily or involuntarily and honorably or under honorable conditions, prior to first and initial employment with the city of Clearwater fire departments shall be added to his or her years of credited service provided that: (a) The member contributes to the fund an actuarially determined amount so that the crediting of 64 the purchased service does not result in any cost to the fund plus payment of costs for all professional services rendered to the board in connection with the purchase of years of credited service. A member who does not purchase years of credited service shall be responsible for the payment of costs for all professional services rendered to the board in connection with the purchase of years of credited service. (b) Multiple requests to purchase credited service pursuant to this section may be made at any time prior to retirement. (c) Payment by the member of the required amount can be made by either lump sum payment or equal biweekly installments. Payment by lump sum shall be made within six months of the request for credit. Payment by payroll deductions shall be in equal biweekly installments for a period which shall not exceed the number of years being purchased. A member making installment payments shall be charged interest based on the actuarially assumed rate of return at the time the purchase is made and shall complete all required payments prior to payment of any benefit under this section. (d) The maximum credit under this section when combined with credited service purchased pursuant to section (1), buyback of prior fire service for service other than with the City of Clearwater shall be five years. (e) Credited service purchased pursuant to this section shall count for all pension purposes, except vesting and eligibility for disability benefits off-duty. Cover Memo City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 File Number: ID#24-1624 Agenda Date: 1/16/2025 Status: Consent AgendaVersion: 1 File Type: Action ItemIn Control: Information Technology Agenda Number: 6.11 SUBJECT/RECOMMENDATION: Authorize an agreement with DEX Imaging LLC dba TotalPrint USA (TotalPrint USA), of Tampa, FL for citywide copier and printer services in an annual not to exceed amount of $200,000.00, for the initial term January 1, 2025 through December 31, 2025, with three, one-year renewal options pursuant to RFP 56-24, and authorize the appropriate officials to execute same. (consent) SUMMARY: On August 5, 2024, the City issued Request for Proposal (RFP) 56-24 for Citywide Printer and Copier Services. Four responsive proposals were received by the September 4, 2024, deadline. A team of city staff carefully evaluated each submission based on the RFP criteria and overall responsiveness to the requirements. Following this evaluation, the team shortlisted the top two companies and recommended awarding the contract to TotalPrint USA, the highest-ranked company. TotalPrint USA will provide hardware, printing supplies, and support services for the City’s 75 copiers, as well as support services for an additional 89 printers. The initial contract term is one year, from January 1, 2025 through December 31, 2025, with three optional one-year renewals, allowing for a total potential service term of four years. TotalPrint USA will replace SunPrint, Inc. as the City’s printer and copier service provider. The City plans to seek authorization from the City Manager to exercise a buyout clause with SunPrint to purchase all existing copiers and printers for $64,500.00. This purchase is expected to eliminate hardware leasing costs and save the City an estimated $40,000.00 to $80,000.00, depending on the devices' collective lifecycle. If the contract is renewed for the full four-year term, the total maximum cost is projected to be $800,000.00. APPROPRIATION CODE AND AMOUNT: Monthly invoices are processed by the IT and charged back to departments based upon specific print/copy volumes. Chargebacks are processed in departmental operating budgets to line item 544100 (rental equipment/services). STRATEGIC PRIORITY: This purchase will support all the objectives of a High-Performance Government, as well as Superior Public Service. Page 1 City of Clearwater Printed on 1/14/2025 Procurement Division 100 S Myrtle Ave Clearwater FL 33756-5520 PO Box 4748, 33758-4748 727-562-4630 Tel v 07.2021 REQUEST FOR PROPOSALS #56-24 Citywide Printer and Copier Services August 5, 2024 NOTICE IS HEREBY GIVEN that sealed proposals will be received by the City of Clearwater (City) until 10:00 AM, Local Time, September 4, 2024, to provide citywide printer and copier services, supplies, and equipment. Brief Description: The City of Clearwater (City) is seeking to engage a Copier services company to provide citywide HP leased equipment, along with ink, toner, and maintenance for the operational requirements managed by the Information Technology Department. Proposals must be in accordance with the provisions, specifications and instructions set forth herein and will be received by the Procurement Division until the above noted time, when they will be publicly acknowledged and accepted. Proposal packets, any attachments and addenda are available for download at: https://www.myclearwater.com/business/rfp Please read the entire solicitation package and submit the bid in accordance with the instructions. This document (less this invitation and the instructions) and any required response documents, attachments, and submissions will constitute the bid. General, Process, or Technical Questions concerning this solicitation should be directed, IN WRITING, to the Procurement contact below: Leslie Greve Procurement Analyst Leslie.Greve@myclearwater.com This Request for Proposals is issued by: Lori Vogel, CPPB Procurement Manager Lori.vogel@myclearwater.com INSTRUCTIONS Citywide Printer and Copier Services 2 RFP #56-24 i.1 VENDOR QUESTIONS: All questions regarding the contents of this solicitation, and solicitation process (including requests for ADA accommodations), shall be directed solely to the contact listed on Page 1. Questions should be submitted in writing via letter, fax or email. Questions received less than ten (10) calendar days prior to the due date and time may be answered at the discretion of the City. i.2 ADDENDA/CLARIFICATIONS: Any changes to the specifications will be in the form of an addendum. Addenda are posted on the City website no less than seven (7) days prior to the Due Date. Vendors are cautioned to check the Purchasing Website for addenda and clarifications prior to submitting their proposal. The City cannot be held responsible if a vendor fails to receive any addenda issued. The City shall not be responsible for any oral changes to these specifications made by any employees or officer of the City. Failure to acknowledge receipt of an addendum may result in disqualification of a proposal. i.3 VENDOR CONFERENCE / SITE VISIT: Yes No Mandatory Attendance: Yes No If so designated above, attendance is mandatory as a condition of submitting a proposal. The conference/site visit provides interested parties an opportunity to discuss the City's needs, inspect the site and ask questions. During any site visit you must fully acquaint yourself with the conditions as they exist and the character of the operations to be conducted under the resulting contract. i.4 DUE DATE & TIME FOR SUBMISSION AND OPENING: Date: September 4, 2024 Time: 10:00 AM (Local Time) The City will open all proposals properly and timely submitted and will record the names and other information specified by law and rule. All proposals become the property of the City and will not be returned except in the case of a late submission. Respondent names, as read at the bid opening, will be posted on the City website. Once a notice of intent to award is posted or 30 days from day of opening elapses, whichever occurs earlier, proposals are available for inspection by contacting the Procurement Division. i.5 PROPOSAL FIRM TIME: 120 Days from Opening Proposal shall remain firm and unaltered after opening for the number of days shown above. The City may accept the proposal, subject to successful contract negotiations, at any time during this time. i.6 PROPOSAL SECURITY: Yes $ 0.00 No If so designated above, a proposal security in the amount specified must be submitted with the proposal. The security may be submitted in any one of the following forms: an executed surety bond issued by a firm licensed and registered to transact such business with the State of Florida; cash; certified check, or cashier's check payable to the City of Clearwater (personal or company checks are not acceptable); certificate of deposit or any other form of deposit issued by a financial institution and acceptable to the City. Such proposal security shall be forfeited to the City of Clearwater should the proposer selected fail to execute a contract when requested. PERFORMANCE SECURITY: Yes $ 0.00 No If required herein, the Contractor, simultaneously with the execution of the Contract, will be required to furnish a performance security. The security may be submitted in one-year increments and in any one of the following forms: an executed surety bond issued by a firm licensed and registered to transact such business with the State of Florida; cash; certified check, cashier's check or money order payable to the City of Clearwater (personal and company checks are not acceptable); certificate of deposit or any other form of deposit issued by a financial institution and acceptable to the City. If the Contractor fails or refuses to fully comply with the terms and conditions of the contract, the City shall have the right to use all or such part of said security as may be necessary to reimburse the City for loss sustained by reason of such breach. The balance of said security, if INSTRUCTIONS Citywide Printer and Copier Services 3 RFP #56-24 any, will be returned to Contractor upon the expiration or termination of the contract. i.7 SUBMIT PROPOSALS TO: It is recommended that proposals are submitted electronically through our bids website at https://www.myclearwater.com/business/rfp Proposers may mail or hand-deliver proposals to the address below. E-mail or fax submissions will not be accepted. Use label at the end of this solicitation package City of Clearwater Attn: Procurement Division 100 S Myrtle Ave, 3rd Fl, Clearwater FL 33756-5520 or PO Box 4748, Clearwater FL 33758-4748 Proposals will be received at this address. Proposers may mail or hand-deliver proposals; e-mail or fax submissions will not be accepted. No responsibility will attach to the City of Clearwater, its employees or agents for premature opening of a proposal that is not properly addressed and identified. i.8 LATE PROPOSALS. The proposer assumes responsibility for having the proposal delivered on time at the place specified. All proposals received after the date and time specified shall not be considered and will be returned unopened to the proposer. The proposer assumes the risk of any delay in the mail or in handling of the mail by employees of the City of Clearwater, or any private courier, regardless whether sent by mail or by means of personal delivery. It shall not be sufficient to show that you mailed or commenced delivery before the due date and time. All times are Clearwater, Florida local times. The proposer agrees to accept the time stamp in the City’s Procurement Office as the official time. i.9 LOBBYING; LOBBYING NO-CONTACT PERIOD; QUESTIONS REGARDING SOLICITATION. From the time a competitive solicitation is posted until such time as the contract is awarded by the city or the solicitation is cancelled, all bidders, offerors, respondents, including their employees, representatives, and other individuals acting on their behalf, shall be prohibited from lobbying city officers, city employees, and evaluation committee members. Violation of this section may result in rejection/disqualification from award of the contract arising out of the competitive solicitation. All questions regarding the competitive solicitation must be directed to the procurement manager or designee, who will respond in writing and post such response to ensure that all respondents receive the same information during the No-Contact Period. The penalty for violating the No-Contact Period may include suspension or debarment i.10 COMMENCEMENT OF WORK. If proposer begins any billable work prior to the City’s final approval and execution of the contract, proposer does so at its own risk. i.11 RESPONSIBILITY TO READ AND UNDERSTAND. Failure to read, examine and understand the solicitation will not excuse any failure to comply with the requirements of the solicitation or any resulting contract, nor shall such failure be a basis for claiming additional compensation. If a vendor suspects an error, omission or discrepancy in this solicitation, the vendor must immediately and in any case not later than (seven (7) business days in advance of the due date notify the contact on page one (1). The City is not responsible for and will not pay any costs associated with the preparation and submission of the proposal. Proposers are cautioned to verify their proposals before submission, as amendments to or withdrawal of proposals submitted after time specified for opening of proposals may not be considered. The City will not be responsible for any proposer errors or omissions. INSTRUCTIONS Citywide Printer and Copier Services 4 RFP #56-24 i.12 FORM AND CONTENT OF PROPOSALS. Unless otherwise instructed or allowed, proposals shall be submitted on the forms provided. An original and the designated number of copies of each proposal are required. Proposals, including modifications, must be submitted in ink, typed, or printed form and signed by an authorized representative. Please line through and initial rather than erase changes. If the proposal is not properly signed or if any changes are not initialed, it may be considered non-responsive. In the event of a disparity between the unit price and the extended price, the unit price shall prevail unless obviously in error, as determined by the City. The City may require that an electronic copy of the proposal be submitted. The proposal must provide all information requested and must address all points. The City does not encourage exceptions. The City is not required to grant exceptions and depending on the exception, the City may reject the proposal. i.13 SPECIFICATIONS. Technical specifications define the minimum acceptable standard. When the specification calls for “Brand Name or Equal,” the brand name product is acceptable. Other products will be considered upon showing the other product meets stated specifications and is equivalent to the brand product in terms of quality, performance and desired characteristics. Minor differences that do not affect the suitability of the supply or service for the City’s needs may be accepted. Burden of proof that the product meets the minimum standards or is equal to the brand name product is on the proposer. The City reserves the right to reject proposals that the City deems unacceptable. i.14 MODIFICATION / WITHDRAWAL OF PROPOSAL. Written requests to modify or withdraw the proposal received by the City prior to the scheduled opening time will be accepted and will be corrected after opening. No oral requests will be allowed. Requests must be addressed and labeled in the same manner as the proposal and marked as a MODIFICATION or WITHDRAWAL of the proposal. Requests for withdrawal after the bid opening will only be granted upon proof of undue hardship and may result in the forfeiture of any proposal security. Any withdrawal after the bid opening shall be allowed solely at the City’s discretion. i.15 DEBARMENT DISCLOSURE. If the vendor submitting a proposal has been debarred, suspended, or otherwise lawfully precluded from participating in any public procurement activity, including being disapproved as a subcontractor with any federal, state, or local government, or if any such preclusion from participation from any public procurement activity is currently pending, the proposer shall include a letter with its proposal identifying the name and address of the governmental unit, the effective date of this suspension or debarment, the duration of the suspension or debarment, and the relevant circumstances relating to the suspension or debarment. If suspension or debarment is currently pending, a detailed description of all relevant circumstances including the details enumerated above must be provided. A proposal from a proposer who is currently debarred, suspended or otherwise lawfully prohibited from any public procurement activity may be rejected. i.16 RESERVATIONS. The City reserves the right to reject any or all proposals or any part thereof; to rebid the solicitation; to reject non-responsive or non-responsible proposals; to reject unbalanced proposals; to reject proposals where the terms, prices, and/or awards are conditioned upon another event; to reject individual proposals for failure to meet any requirement; to award by item, part or portion of an item, group of items, or total; to make multiple awards; to waive minor irregularities, defects, omissions, technicalities or form errors in any proposal. The City may seek clarification of the proposal from proposer at any time, and failure to respond is cause for rejection. Submission of a proposal confers on proposer no right to an award or to a subsequent contract. The City is responsible to make an award that is in the best interest of the City. All decisions on compliance, evaluation, terms and conditions shall be made solely at the City’s discretion and made to favor the City. No binding contract will exist between the proposer and the City until the City executes a written contract or purchase order. i.17 OFFICIAL SOLICITATION DOCUMENT. Changes to the solicitation document made by a proposer may not be acknowledged or accepted by the City. Award or execution of a contract does not constitute acceptance of a changed term, condition or specification unless specifically acknowledged and agreed to by the City. The copy maintained and published by the City shall be the official solicitation document. INSTRUCTIONS Citywide Printer and Copier Services 5 RFP #56-24 i.18 COPYING OF PROPOSALS. Proposer hereby grants the City permission to copy all parts of its proposal, including without limitation any documents and/or materials copyrighted by the proposer. The City’s right to copy shall be for internal use in evaluating the proposal. i.19 CONTRACTOR ETHICS. It is the intention of the City to promote courtesy, fairness, impartiality, integrity, service, professionalism, economy, and government by law in the Procurement process. The responsibility for implementing this policy rests with each individual who participates in the Procurement process, including Respondents and Contractors. To achieve this purpose, it is essential that Respondents and Contractors doing business with the City also observe the ethical standards prescribed herein. It shall be a breach of ethical standards to: a. Exert any effort to influence any City employee or agent to breach the standards of ethical conduct. b. Intentionally invoice any amount greater than provided in Contract or to invoice for Materials or Services not provided. c. Intentionally offer or provide sub-standard Materials or Services or to intentionally not comply with any term, condition, specification or other requirement of a City Contract. i.20 GIFTS. The City will accept no gifts, gratuities or advertising products from proposers or prospective proposers and affiliates. The City may request product samples from vendors for product evaluation. i.21 RIGHT TO PROTEST. Pursuant to Section 2.562(3), Clearwater Code of Ordinances, a bidder who submitted a response to a competitive solicitation and was not selected may appeal the decision through the bid protest procedures, a copy of which shall be available in the Procurement Division. A protesting bidder must include a fee of one percent of the amount of the bid or proposed contract to offset the City’s additional expenses related to the protest. This fee shall not exceed $5,000.00 nor be less than $50.00. Full refund will be provided should the protest be upheld. No partial refunds will be made. ADDRESS PROTESTS TO: City of Clearwater - Procurement Division 100 So Myrtle Ave, 3rd Fl Clearwater FL 33756-5520 or PO Box 4748 Clearwater FL 33758-4748 INSTRUCTIONS – EVALUATION Citywide Printer and Copier Services 6 RFP #56-24 i.22 EVALUATION PROCESS. Proposals will be reviewed by a screening committee comprised of City employees. The City staff may or may not initiate discussions with proposers for clarification purposes. Clarification is not an opportunity to change the proposal. Proposers shall not initiate discussions with any City employee or official. Respondent is hereby notified that Section 287.05701, Florida Statutes, requires that the City may not request documentation of or consider a vendor's social, political, or ideological interests when determining if the vendor is a responsible vendor. i.23 CRITERIA FOR EVALUATION AND AWARD. The City evaluates three (3) categories of information: responsiveness, responsibility, the technical proposal/price. All proposals must meet the following responsiveness and responsibility criteria. a) Responsiveness. The City will determine whether the proposal complies with the instructions for submitting proposals including completeness of proposal which encompasses the inclusion of all required attachments and submissions. The City must reject any proposals that are submitted late. Failure to meet other requirements may result in rejection. b) Responsibility. The City will determine whether the proposer is one with whom it can or should do business. Factors that the City may evaluate to determine "responsibility" include, but are not limited to: excessively high or low priced proposals, past performance, references (including those found outside the proposal), compliance with applicable laws, proposer's record of performance and integrity- e.g. has the proposer been delinquent or unfaithful to any contract with the City, whether the proposer is qualified legally to contract with the City, financial stability and the perceived ability to perform completely as specified. A proposer must at all times have financial resources sufficient, in the opinion of the City, to ensure performance of the contract and must provide proof upon request. City staff may also use Dun & Bradstreet and/or any generally available industry information. The City reserves the right to inspect and review proposer’s facilities, equipment and personnel and those of any identified subcontractors. The City will determine whether any failure to supply information, or the quality of the information, will result in rejection. c) Technical Proposal. The City will determine how well proposals meet its requirements in terms of the response to the specifications and how well the offer addresses the needs of the project. The City will rank offers using a point ranking system (unless otherwise specified) as an aid in conducting the evaluation. d) If less than three (3) responsive proposals are received, at the City’s sole discretion, the proposals may be evaluated using simple comparative analysis instead of any announced method of evaluation, subject to meeting administrative and responsibility requirements. For this RFP, the criteria that will be evaluated and their relative weights are: Evaluation Criteria Points Qualifications and Experience (Tab 2) 20 References (Tab 2) 15 Responsiveness of Service Calls (Tab 3) 30 Business Location and Response Time (Tab 4) 15 Pricing (Tab 5) 15 Additional Information (Tab 6) 5 i.24 SHORT-LISTING. The City at its sole discretion may create a short-list of the highest ranked proposals based on evaluation against the evaluation criteria. Short-listed proposers may be invited to give presentations and/or interviews. Upon conclusion of any presentations/interviews, the City will finalize the ranking of shortlisted firms. INSTRUCTIONS – EVALUATION Citywide Printer and Copier Services 7 RFP #56-24 i.25 PRESENTATIONS/INTERVIEWS Presentations and/or interviews may be requested at the City’s discretion. The location for these presentations and/or interviews will be determined by the City and may be held virtually. i.26 BEST & FINAL OFFERS. The City may request best & final offers if deemed necessary, and will determine the scope and subject of any best & final request. However, the proposer should not expect that the City will ask for best & finals and should submit their best offer based on the terms and conditions set forth in this solicitation. i.27 COST JUSTIFICATION. In the event only one response is received, the City may require that the proposer submit a cost proposal in sufficient detail for the City to perform a cost/price analysis to determine if the proposal price is fair and reasonable. i.28 CONTRACT NEGOTIATIONS AND ACCEPTANCE. Proposer must be prepared for the City to accept the proposal as submitted. If proposer fails to sign all documents necessary to successfully execute the final contract within a reasonable time as specified, or negotiations do not result in an acceptable agreement, the City may reject proposal or revoke the award, and may begin negotiations with another proposer. Final contract terms must be approved or signed by the appropriately authorized City official(s). No binding contract will exist between the proposer and the City until the City executes a written contract or purchase order. i.29 NOTICE OF INTENT TO AWARD. Notices of the City’s intent to award a Contract are posted to Purchasing’s website. It is the proposer’s responsibility to check the City of Clearwater’s website at https://www.myclearwater.com/business/rfp to view relevant RFP information and notices. i.30 RFP TIMELINE. Dates are tentative and subject to change. Release RFP: August 5, 2024 Advertise Tampa Bay Times: August 7, 2024 Responses due: September 4, 2024 Review proposals: September 4, 2024-September 18, 2024 Presentations (if requested): Week of September 23, 2024 Award recommendation: Week of September 23, 2024 Council authorization: October 2024 Contract begins: October 2024 STANDARD TERMS AND CONDITIONS Citywide Printer and Copier Services 8 RFP #56-24 S.1 DEFINITIONS. Uses of the following terms are interchangeable as referenced: “vendor, contractor, consultant, supplier, proposer, company, persons”, “purchase order, PO, contract, agreement”, “City, Clearwater”, “bid, proposal, response, quote”. S.2 INDEPENDENT CONTRACTOR. It is expressly understood that the relationship of Contractor to the City will be that of an independent contractor. Contractor and all persons employed by Contractor, either directly or indirectly, are Contractor’s employees, not City employees. Accordingly, Contractor and Contractor’s employees are not entitled to any benefits provided to City employees including, but not limited to, health benefits, enrollment in a retirement system, paid time off or other rights afforded City employees. Contractor employees will not be regarded as City employees or agents for any purpose, including the payment of unemployment or workers’ compensation. If any Contractor employees or subcontractors assert a claim for wages or other employment benefits against the City, Contractor will defend, indemnify and hold harmless the City from all such claims. S.3 SUBCONTRACTING. Contractor may not subcontract work under this Agreement without the express written permission of the City. If Contractor has received authorization to subcontract work, it is agreed that all subcontractors performing work under the Agreement must comply with its provisions. Further, all agreements between Contractor and its subcontractors must provide that the terms and conditions of this Agreement be incorporated therein. S.4 ASSIGNMENT. This Agreement may not be assigned either in whole or in part without first receiving the City’s written consent. Any attempted assignment, either in whole or in part, without such consent will be null and void and in such event the City will have the right at its option to terminate the Agreement. No granting of consent to any assignment will relieve Contractor from any of its obligations and liabilities under the Agreement. S.5 SUCCESSORS AND ASSIGNS, BINDING EFFECT. This Agreement will be binding upon and inure to the benefit of the parties and their respective permitted successors and assigns. S.6 NO THIRD PARTY BENEFICIARIES. This Agreement is intended for the exclusive benefit of the parties. Nothing set forth in this Agreement is intended to create, or will create, any benefits, rights, or responsibilities in any third parties. S.7 NON- EXCLUSIVITY. The City, in its sole discretion, reserves the right to request the materials or services set forth herein from other sources when deemed necessary and appropriate. No exclusive rights are encompassed through this Agreement. S.8 AMENDMENTS. There will be no oral changes to this Agreement. This Agreement can only be modified in a writing signed by both parties. No charge for extra work or material will be allowed unless approved in writing, in advance, by the City and Contractor. S.9 TIME OF THE ESSENCE. Time is of the essence to the performance of the parties’ obligations under this Agreement. S.10 COMPLIANCE WITH APPLICABLE LAWS. a. General. Contractor must procure all permits and licenses, and pay all charges and fees necessary and incidental to the lawful conduct of business. Contractor must stay fully informed of existing and future federal, state, and local laws, ordinances, executive orders, and regulations that in any manner affect the fulfillment of this Agreement and must comply with the same at its own expense. Contractor bears full responsibility for training, safety, and providing necessary equipment for all Contractor personnel to achieve throughout the term of the Agreement. Upon request, Contractor will demonstrate to the City's satisfaction any programs, procedures, and other activities used to ensure compliance. b. Drug-Free Workplace. Contractor is hereby advised that the City has adopted a policy establishing a drug-free workplace for itself and those doing business with the City to ensure the safety and health of all persons working on City contracts and projects. Contractor will require a drug-free workplace for all Contractor personnel working under this Agreement. Specifically, all Contractor personnel who are working under this Agreement must be notified STANDARD TERMS AND CONDITIONS Citywide Printer and Copier Services 9 RFP #56-24 in writing by Contractor that they are prohibited from the manufacture, distribution, dispensation, possession, or unlawful use of a controlled substance in the workplace. Contractor agrees to prohibit the use of intoxicating substances by all Contractor personnel and will ensure that Contractor personnel do not use or possess illegal drugs while in the course of performing their duties. c. Federal and State Immigration Laws. Contractor agrees to comply with the Immigration Reform and Control Act of 1986 (IRCA) in performance under this Agreement and to permit the City and its agents to inspect applicable personnel records to verify such compliance as permitted by law. Contractor will ensure and keep appropriate records to demonstrate that all Contractor personnel have a legal right to live and work in the United States. (i) As applicable to Contractor, under this provision, Contractor hereby warrants to the City that Contractor and each of its subcontractors will comply with, and are contractually obligated to comply with, all federal immigration laws and regulations that relate to their employees (hereinafter “Contractor Immigration Warranty”). (ii) A breach of the Contractor Immigration Warranty will constitute as a material breach of this Agreement and will subject Contractor to penalties up to and including termination of this Agreement at the sole discretion of the City. (iii) The City retains the legal right to inspect the papers of all Contractor personnel who provide services under this Agreement to ensure that Contractor or its subcontractors are complying with the Contractor Immigration Warranty. Contractor agrees to assist the City in regard to any such inspections. (iv) The City may, at its sole discretion, conduct random verification of the employment records of Contractor and any subcontractor to ensure compliance with the Contractor Immigration Warranty. Contractor agrees to assist the City in regard to any random verification performed. (v) Neither Contractor nor any subcontractor will be deemed to have materially breached the Contractor Immigration Warranty if Contractor or subcontractor establishes that it has complied with the employment verification provisions prescribed by Sections 274A and 274B of the Federal Immigration and Nationality Act. d. Nondiscrimination. Contractor represents and warrants that it does not discriminate against any employee or applicant for employment or person to whom it provides services because of race, color, religion, sex, national origin, or disability, and represents and warrants that it complies with all applicable federal, state, and local laws and executive orders regarding employment. Contractor and Contractor’s personnel will comply with applicable provisions of Title VII of the U.S. Civil Rights Act of 1964, as amended, Section 504 of the Federal Rehabilitation Act, the Americans with Disabilities Act (42 U.S.C. § 12101 et seq.), and applicable rules in performance under this Agreement. S.11 SALES/USE TAX, OTHER TAXES. Contractor is responsible for the payment of all taxes including federal, state, and local taxes related to or arising out of Contractor’s services under this Agreement, including by way of illustration but not limitation, federal and state income tax, Social Security tax, unemployment insurance taxes, and any other taxes or business license fees as required. If any taxing authority should deem Contractor or Contractor employees an employee of the City or should otherwise claim the City is liable for the payment of taxes that are Contractor’s responsibility under this Agreement, Contractor will indemnify the City for any tax liability, interest, and penalties imposed upon the City. The City is exempt from paying state and local sales/use taxes and certain federal excise taxes and will furnish an exemption certificate upon request. S.12 AMOUNTS DUE THE CITY. Contractor must be current and remain current in all obligations due to the City during the performance of services under the Agreement. Payments to Contractor may be offset by any delinquent amounts due the City or fees and charges owed to the City. STANDARD TERMS AND CONDITIONS Citywide Printer and Copier Services 10 RFP #56-24 S.13 PUBLIC RECORDS. In addition to all other contract requirements as provided by law, the Contractor executing this Agreement agrees to comply with public records law. IF THE CONTRACTOR HAS QUESTIONS REGARDING THE APPLICATION OF CHAPTER 119, FLORIDA STATUTES, TO THE CONTRACTOR’S DUTY TO PROVIDE PUBLIC RECORDS RELATING TO THIS CONTRACT, CONTACT THE CUSTODIAN OF PUBLIC RECORDS, Rosemarie Call, Phone: 727-444-7151 or Email: Rosemarie.Call@myclearwater.com, 600 Cleveland Street, Suite 600, Clearwater, FL 33755. The Contractor agrees to comply with the following: a) Keep and maintain public records required by the City of Clearwater (hereinafter “public agency” in this section) to perform the service being provided by the contractor hereunder. b) Upon request from the public agency’s custodian of public records, provide the public agency with a copy of the requested records or allow the records to be inspected or copied within a reasonable time at a cost that does not exceed the cost provided for in Chapter 119, Florida Statutes, as may be amended from time to time, or as otherwise provided by law. c) Ensure that the public records that are exempt or confidential and exempt from public records disclosure requirements are not disclosed except as authorized by law for the duration of the contract term and following completion of the contract if the contractor does not transfer the records to the public agency. d) Upon completion of the contract, transfer, at no cost, to the public agency all public records in possession of the contractor or keep and maintain public records required by the public agency to perform the service. If the contractor transfers all public records to the public agency upon completion of the contract, the contractor shall destroy any duplicate public records that are exempt or confidential and exempt from public records disclosure requirements. If the contractor keeps and maintains public records upon completion of the contract, the contractor shall meet all applicable requirements for retaining public records. All records stored electronically must be provided to the public agency, upon request from the public agency’s custodian of public records, in a format that is compatible with the information technology systems of the public agency. e) A request to inspect or copy public records relating to a public agency’s contract for services must be made directly to the public agency. If the public agency does not possess the requested records, the public agency shall immediately notify the contractor of the request and the contractor must provide the records to the public agency or allow the records to be inspected or copied within a reasonable time. f) The contractor hereby acknowledges and agrees that if the contractor does not comply with the public agency’s request for records, the public agency shall enforce the contract provisions in accordance with the contract. g) A contractor who fails to provide the public records to the public agency within a reasonable time may be subject to penalties under Section 119.10, Florida Statutes. h) If a civil action is filed against a contractor to compel production of public records relating to a public agency’s contract for services, the court shall assess and award against the contractor the reasonable costs of enforcement, including reasonable attorney fees, if: 1. The court determines that the contractor unlawfully refused to comply with the public records request within a reasonable time; and STANDARD TERMS AND CONDITIONS Citywide Printer and Copier Services 11 RFP #56-24 2. At least eight (8) business days before filing the action, the plaintiff provided written notice of the public records request, including a statement that the contractor has not complied with the request, to the public agency and to the contractor. i) A notice complies with subparagraph (h)2. if it is sent to the public agency’s custodian of public records and to the contractor at the contractor’s address listed on its contract with the public agency or to the contractor’s registered agent. Such notices must be sent by common carrier delivery service or by registered, Global Express Guaranteed, or certified mail, with postage or shipping paid by the sender and with evidence of delivery, which may be in an electronic format. A Contractor who complies with a public records request within eight (8) business days after the notice is sent is not liable for the reasonable costs of enforcement. S.14 AUDITS AND RECORDS. Contractor must preserve the records related to this Agreement for five (5) years after completion of the Agreement. The City or its authorized agent reserves the right to inspect any records related to the performance of work specified herein. In addition, the City may inspect any and all payroll, billing or other relevant records kept by Contractor in relation to the Agreement. Contractor will permit such inspections and audits during normal business hours and upon reasonable notice by the City. The audit of records may occur at Contractor’s place of business or at City offices, as determined by the City. S.15 BACKGROUND CHECK. The City may conduct criminal, driver history, and all other requested background checks of Contractor personnel who would perform services under the Agreement or who will have access to the City’s information, data, or facilities in accordance with the City’s current background check policies. Any officer, employee, or agent that fails the background check must be replaced immediately for any reasonable cause not prohibited by law. S.16 SECURITY CLEARANCE AND REMOVAL OF CONTRACTOR PERSONNEL. The City will have final authority, based on security reasons: (i) to determine when security clearance of Contractor personnel is required; (ii) to determine the nature of the security clearance, up to and including fingerprinting Contractor personnel; and (iii) to determine whether or not any individual or entity may provide services under this Agreement. If the City objects to any Contractor personnel for any reasonable cause not prohibited by law, then Contractor will, upon notice from the City, remove any such individual from performance of services under this Agreement. S.17 DEFAULT. a. A party will be in default if that party: (i) is or becomes insolvent or is a party to any voluntary bankruptcy or receivership proceeding, makes an assignment for a creditor, or there is any similar action that affects Contractor’s capability to perform under the Agreement; (ii) is the subject of a petition for involuntary bankruptcy not removed within sixty (60) calendar days; (iii) conducts business in an unethical manner or in an illegal manner; or (iv) fails to carry out any term, promise, or condition of the Agreement. b. Contractor will be in default of this Agreement if Contractor is debarred or suspended in accordance with the Clearwater Code of Ordinances Section 2.565 or if Contractor is debarred or suspended by another governmental entity. c. Notice and Opportunity to Cure. In the event a party is in default then the other party may, at its option and at any time, provide written notice to the defaulting party of the default. The defaulting party will have thirty (30) days from receipt of the notice to cure the default; the thirty (30) day cure period may be extended by mutual agreement of the parties, but no cure period may exceed ninety (90) days. A default notice will be deemed to be sufficient if it is reasonably calculated to provide notice of the nature and extent of such default. Failure of the non- defaulting party to provide notice of the default does not waive any rights under the Agreement. d. Anticipatory Repudiation. Whenever the City in good faith has reason to question Contractor’s intent or ability to perform, the City may demand that Contractor give a written STANDARD TERMS AND CONDITIONS Citywide Printer and Copier Services 12 RFP #56-24 assurance of its intent and ability to perform. In the event that the demand is made and no written assurance is given within five (5) calendar days, the City may treat this failure as an anticipatory repudiation of the Agreement. S.18 REMEDIES. The remedies set forth in this Agreement are not exclusive. Election of one remedy will not preclude the use of other remedies. In the event of default: a. The non-defaulting party may terminate the Agreement, and the termination will be effective immediately or at such other date as specified by the terminating party. b. The City may purchase the services required under the Agreement from the open market, complete required work itself, or have it completed at the expense of Contractor. If the cost of obtaining substitute services exceeds the contract price, the City may recover the excess cost by: (i) requiring immediate reimbursement to the City; (ii) deduction from an unpaid balance due to Contractor; (iii) collection against the proposal and/or performance security, if any; (iv) collection against liquidated damages (if applicable); or (v) a combination of the aforementioned remedies or other remedies as provided by law. Costs includes any and all, fees, and expenses incurred in obtaining substitute services and expended in obtaining reimbursement, including, but not limited to, administrative expenses, attorneys’ fees, and costs. c. The non-defaulting party will have all other rights granted under this Agreement and all rights at law or in equity that may be available to it. d. Neither party will be liable for incidental, special, or consequential damages. S.19 CONTINUATION DURING DISPUTES. Contractor agrees that during any dispute between the parties, Contractor will continue to perform its obligations until the dispute is settled, instructed to cease performance by the City, enjoined or prohibited by judicial action, or otherwise required or obligated to cease performance by other provisions in this Agreement. S.20 TERMINATION FOR CONVENIENCE. The City reserves the right to terminate this Agreement at its convenience, in part or in whole, upon thirty (30) calendar days’ written notice. S.21 TERMINATION FOR CONFLICT OF INTEREST. The City may cancel this Agreement after its execution, without penalty or further obligation, if any person significantly involved in initiating, securing, drafting, or creating the Agreement for the City becomes an employee or agent of Contractor. S.22 TERMINATION FOR NON-APPROPRIATION AND MODIFICATION FOR BUDGETARY CONSTRAINT. The City is a governmental agency which relies upon the appropriation of funds by its governing body to satisfy its obligations. If the City reasonably determines, in its sole discretion, that it does not have funds to meet its obligations under this Agreement, the City will have the right to terminate the Agreement without penalty on the last day of the fiscal period for which funds were legally available. In the event of such termination, the City agrees to provide written notice of its intent to terminate thirty (30) calendar days prior to the stated termination date. S.23 PAYMENT TO CONTRACTOR UPON TERMINATION. Upon termination of this Agreement, Contractor will be entitled only to payment for those services performed up to the date of termination, and any authorized expenses already incurred up to such date of termination. The City will make final payment within thirty (30) calendar days after the City has both completed its appraisal of the materials and services provided and received Contractor’s properly prepared final invoice. S.24 NON-WAIVER OF RIGHTS. There will be no waiver of any provision of this Agreement unless approved in writing and signed by the waiving party. Failure or delay to exercise any rights or remedies provided herein or by law or in equity, or the acceptance of, or payment for, any services hereunder, will not release the other party of any of the warranties or other obligations of the Agreement and will not be deemed a waiver of any such rights or remedies. S.25 INDEMNIFICATION/LIABILITY. STANDARD TERMS AND CONDITIONS Citywide Printer and Copier Services 13 RFP #56-24 a. To the fullest extent permitted by law, Contractor agrees to defend, indemnify, and hold the City, its officers, agents, and employees, harmless from and against any and all liabilities, demands, claims, suits, losses, damages, causes of action, fines or judgments, including costs, attorneys’, witnesses’, and expert witnesses’ fees, and expenses incident thereto, relating to, arising out of, or resulting from: (i) the services provided by Contractor personnel under this Agreement; (ii) any negligent acts, errors, mistakes or omissions by Contractor or Contractor personnel; and (iii) Contractor or Contractor personnel’s failure to comply with or fulfill the obligations established by this Agreement. If applicable, this paragraph shall be construed in harmony with F. S. § 725.06. b. Contractor will update the City during the course of the litigation to timely notify the City of any issues that may involve the independent negligence of the City that is not covered by this indemnification. c. The City assumes no liability for actions of Contractor and will not indemnify or hold Contractor or any third party harmless for claims based on this Agreement or use of Contractor-provided supplies or services. d. Nothing contained herein in intended to serve as a waiver by the City of its sovereign immunity, to extend the liability of the City beyond the limits set forth in Section 768.28, Florida Statutes, or be construed as consent by the City to be sued by third parties. S.26 WARRANTY. Contractor warrants that the services and materials will conform to the requirements of the Agreement. Additionally, Contractor warrants that all services will be performed in a good, workman-like, and professional manner. The City’s acceptance of service or materials provided by Contractor will not relieve Contractor from its obligations under this warranty. If any materials or services are of a substandard or unsatisfactory manner as determined by the City, Contractor, at no additional charge to the City, will provide materials or redo such services until in accordance with this Agreement and to the City’s reasonable satisfaction. Unless otherwise agreed, Contractor warrants that materials will be new, unused, of most current manufacture and not discontinued, will be free of defects in materials and workmanship, will be provided in accordance with manufacturer's standard warranty for at least one (1) year unless otherwise specified, and will perform in accordance with manufacturer's published specifications. If applicable, this paragraph shall be construed in harmony with F. S. § 725.06. S.27 CITY’S RIGHT TO RECOVER AGAINST THIRD PARTIES. Contractor will do nothing to prejudice the City’s right to recover against third parties for any loss, destruction, or damage to City property, and will at the City’s request and expense, furnish to the City reasonable assistance and cooperation, including assistance in the prosecution or defense of suit and the execution of instruments of assignment in favor of the City in obtaining recovery. S.28 NO GUARANTEE OF WORK. Contractor acknowledges and agrees that it is not entitled to deliver any specific amount of materials or services or any materials or services at all under this Agreement and acknowledges and agrees that the materials or services will be requested by the City on an as needed basis at the sole discretion of the City. Any document referencing quantities or performance frequencies represent the City's best estimate of current requirements, but will not bind the City to purchase, accept, or pay for materials or services which exceed its actual needs. S.29 OWNERSHIP. All deliverables, services, and information provided by Contractor or the City pursuant to this Agreement (whether electronically or manually generated) including without limitation, reports, test plans, and survey results, graphics, and technical tables, originally prepared in the performance of this Agreement, are the property of the City and will not be used or released by Contractor or any other person except with prior written permission by the City. S.30 USE OF NAME. Contractor will not use the name of the City of Clearwater in any advertising or publicity without obtaining the prior written consent of the City. S.31 FOB DESTINATION FREIGHT PREPAID AND ALLOWED. All deliveries will be FOB destination freight prepaid and allowed unless otherwise agreed. STANDARD TERMS AND CONDITIONS Citywide Printer and Copier Services 14 RFP #56-24 S.32 RISK OF LOSS. Contractor agrees to bear all risks of loss, injury, or destruction of goods or equipment incidental to providing these services and such loss, injury, or destruction will not release Contractor from any obligation hereunder. S.33 SAFEGUARDING CITY PROPERTY. Contractor will be responsible for any damage to City real property or damage or loss of City personal property when such property is the responsibility of or in the custody of Contractor or its employees. S.34 WARRANTY OF RIGHTS. Contractor warrants it has title to, or the right to allow the City to use, the materials and services being provided and that the City may use same without suit, trouble, or hindrance from Contractor or third parties. S.35 PROPRIETARY RIGHTS INDEMNIFICATION. Without limiting the foregoing, Contractor will without limitation, at its expense defend the City against all claims asserted by any person that anything provided by Contractor infringes a patent, copyright, trade secret, or other intellectual property right and must, without limitation, pay the costs, damages and attorneys' fees awarded against the City in any such action, or pay any settlement of such action or claim. Each party agrees to notify the other promptly of any matters to which this provision may apply and to cooperate with each other in connection with such defense or settlement. If a preliminary or final judgment is obtained against the City’s use or operation of the items provided by Contractor hereunder or any part thereof by reason of any alleged infringement, Contractor will, at its expense and without limitation, either: (a) modify the item so that it becomes non-infringing; (b) procure for the City the right to continue to use the item; (c) substitute for the infringing item other item(s) having at least equivalent capability; or (d) refund to the City an amount equal to the price paid, less reasonable usage, from the time of installation acceptance through cessation of use, which amount will be calculated on a useful life not less than five (5) years, plus any additional costs the City may incur to acquire substitute supplies or services. Nothing contained herein in intended to serve as a waiver by the City of its sovereign immunity, to extend the liability of the City beyond the limits set forth in Section 768.28, Florida Statutes, or be construed as consent by the City to be sued by third parties. S.36 CONTRACT ADMINISTRATION. This Agreement will be administered by the Purchasing Administrator and/or an authorized representative from the using department. All questions regarding this Agreement will be referred to the administrator for resolution. Supplements may be written to this Agreement for the addition or deletion of services. Payment will be negotiated and determined by the contract administrator(s). S.37 FORCE MAJEURE. Failure by either party to perform its duties and obligations will be excused by unforeseeable circumstances beyond its reasonable control, including acts of nature, acts of the public enemy, riots, fire, explosion, legislation, and governmental regulation. The party whose performance is so affected will within five (5) calendar days of the unforeseeable circumstance notify the other party of all pertinent facts and identify the force majeure event. The party whose performance is so affected must also take all reasonable steps, promptly and diligently, to prevent such causes if it is feasible to do so, or to minimize or eliminate the effect thereof. The delivery or performance date will be extended for a period equal to the time lost by reason of delay, plus such additional time as may be reasonably necessary to overcome the effect of the delay, provided however, under no circumstances will delays caused by a force majeure extend beyond one hundred-twenty (120) calendar days from the scheduled delivery or completion date of a task unless agreed upon by the parties. S.38 COOPERATIVE USE OF CONTRACT. This Agreement may be extended for use by other municipalities, counties, school districts, and government agencies with the approval of Contractor. Any such usage by other entities must be in accordance with the statutes, codes, ordinances, charter and/or procurement rules and regulations of the respective government agency. Orders placed by other agencies and payment thereof will be the sole responsibility of that agency. The City is not responsible for any disputes arising out of transactions made by others. STANDARD TERMS AND CONDITIONS Citywide Printer and Copier Services 15 RFP #56-24 S.39 FUEL CHARGES AND PRICE INCREASES. No fuel surcharges will be accepted. No price increases will be accepted without proper request by Contractor and response by the City’s Procurement Division. S.40 NOTICES. All notices to be given pursuant to this Agreement must be delivered to the parties at their respective addresses. Notices may be (i) personally delivered; (ii) sent via certified or registered mail, postage prepaid; (iii) sent via electronic mail; (iv) sent via overnight courier; or (v) sent via facsimile. If provided by personal delivery, receipt will be deemed effective upon delivery. If sent via certified or registered mail, receipt will be deemed effective three (3) calendar days after being deposited in the United States mail. If sent via electronic mail, overnight courier, or facsimile, receipt will be deemed effective two (2) calendar days after the sending thereof. S.41 GOVERNING LAW, VENUE. This Agreement is governed by the laws of the State of Florida. The exclusive venue selected for any proceeding or suit in law or equity arising from or incident to this Agreement will be Pinellas County, Florida. S.42 INTEGRATION CLAUSE. This Agreement, including all attachments and exhibits hereto, supersede all prior oral or written agreements, if any, between the parties and constitutes the entire agreement between the parties with respect to the work to be performed. S.43 PROVISIONS REQUIRED BY LAW. Any provision required by law to be in this Agreement is a part of this Agreement as if fully stated in it. S.44 SEVERABILITY. If any provision of this Agreement is declared void or unenforceable, such provision will be severed from this Agreement, which will otherwise remain in full force and effect. The parties will negotiate diligently in good faith for such amendment(s) of this Agreement as may be necessary to achieve the original intent of this Agreement, notwithstanding such invalidity or unenforceability. S.45 SURVIVING PROVISIONS. Notwithstanding any completion, termination, or other expiration of this Agreement, all provisions which, by the terms of reasonable interpretation thereof, set forth rights and obligations that extend beyond completion, termination, or other expiration of this Agreement, will survive and remain in full force and effect. Except as specifically provided in this Agreement, completion, termination, or other expiration of this Agreement will not release any party from any liability or obligation arising prior to the date of termination. DETAILED SPECIFICATIONS Citywide Printer and Copier Services 16 RFP #56-24 1. INTRODUCTION. The City of Clearwater (City) is a coastal community on Florida's West Coast and the third-largest city in the Tampa Bay area with a population of approximately 118,904 residents. Clearwater Beach, a renowned international destination in Pinellas County, attracts millions of tourists annually and most recently received the prestigious TripAdvisor Traveler’s Choice Award for 2024. It consistently ranks among the top vacation spots in both national and international publications, offering year-round attractions such as pristine "sugar sand" beaches, diverse dining options, and venues like the Philadelphia Phillies Spring Training and Clearwater Threshers Minor League Baseball. The acclaimed Clearwater Marine Aquarium, nationally recognized for its innovative work in marine rescue, rehabilitation, and release, remains a major draw for visitors. The City of Clearwater is committed to advancing sustainability through eco-friendly initiatives that enhance our economy, safeguard our environment, and fortify our community. 2. BACKGROUND. The City of Clearwater has more than fifty locations, each with separate addresses, using printers and/or copiers. For over a decade the city has relied on third-party printing and copying services from three different Vendors. Renewing the ongoing contract for these services ensures the continued provision of copying, printing, and scanning services to support operations within the City of Clearwater. 3. PROJECT GOAL. The City of Clearwater (City) is seeking to engage a copier services company to supply HP leased equipment citywide, including ink, toner, and maintenance, to meet the operational requirements managed by the Information Technology Department. 4. SCOPE OF WORK. The awarded Vendor shall maintain existing equipment and provide leased HP copy, printing, and scanning equipment as required by the Information Technology Department. Services shall include provision of equipment, ink, toner and regular maintenance, as well as call- out services. For a list of existing equipment throughout the City and locations, reference Exhibit A-Equipment and Volume List and Exhibit B-Device Locations. The City reserves the right to add/delete equipment as deemed necessary. 5. EQUIPMENT, PARTS AND FACILITY LOCATION. To further our sustainability initiatives, the City prefers ENERGYSTAR-certified equipment featuring energy-saving, standby, or sleep modes. All parts shall comply with original equipment manufacturer (OEM) standards and be provided by the awarded Vendor at no cost to the City. Any non-functional equipment shall be replaced by the awarded Vendor. Furthermore, Vendors shall specify the locations of their operating and warehouse facilities under RESPONSE ELEMENTS, TAB 4-Business Location and Response Time. 6. SERVICE CALLS AND MAINTENANCE. Regular servicing and maintenance are essential to keep equipment in optimal operating condition and shall adhere to all manufacturers’ guidelines. City of Clearwater personnel shall not perform any servicing or maintenance. 7. PRICING. Pricing shall include equipment offerings, models, and functional options. Exhibit A- Equipment and Volume List can be used as a guide for pricing purposes. At a minimum, pricing shall include the following under RESPONSE ELEMENTS, TAB 5- Pricing, page 20 of the solicitation: • The monthly lease cost of items. • The monthly per click charge for printers. 8. ADDITIONAL INFORMATION. Vendors shall include with response their specific terms and criteria for equipment replacement, the terms for end of service separation to include buy out options and terms for equipment removal as referenced under RESPONSE ELEMENTS, TAB 6-Additional Information, pages 20-21 of the solicitation. DETAILED SPECIFICATIONS Citywide Printer and Copier Services 17 RFP #56-24 9. MINIMUM QUALIFICATIONS. Vendors responding to this RFP shall provide a minimum of three (3) references within the past five (5) years, preferably from other government agencies in the State of Florida, for which similar services have been provided. 10. INSURANCE REQUIREMENTS. To be reviewed by Risk Manager. The Vendor shall, at its own cost and expense, acquire and maintain (and cause any subcontractors, representatives or agents to acquire and maintain) during the term with the City, sufficient insurance to adequately protect the respective interest of the parties. Coverage shall be obtained with a carrier having an AM Best Rating of A-VII or better. In addition, the City has the right to review the Contractor’s deductible or self-insured retention and to require that it be reduced or eliminated. Specifically the Vendor must carry the following minimum types and amounts of insurance on an occurrence basis or in the case of coverage that cannot be obtained on an occurrence basis, then coverage can be obtained on a claims-made basis with a minimum three (3) year tail following the termination or expiration of this Agreement: a. Commercial General Liability Insurance coverage, including but not limited to, premises operations, products/completed operations, products liability, contractual liability, advertising injury, personal injury, death, and property damage in the minimum amount of $1,000,000 (one million dollars) per occurrence and $2,000,000 (two million dollars) general aggregate. b. Commercial Automobile Liability Insurance coverage for any owned, non-owned, hired or borrowed automobile is required in the minimum amount of $1,000,000 (one million dollars) combined single limit. c. Unless waived by the State of Florida and proof of waiver is provided to the City, statutory Workers’ Compensation Insurance coverage in accordance with the laws of the State of Florida, and Employer’s Liability Insurance in the minimum amount of $1,000,000 (one million dollars) each employee each accident, $1,000,000 (one million dollars) each employee by disease, and $1,000,000 (one million dollars) disease policy limit. Coverage should include Voluntary Compensation, Jones Act, and U.S. Longshoremen’s and Harbor Worker’s Act coverage where applicable. Coverage must be applicable to employees, contractors, subcontractors, and volunteers, if any. WAIVER OF SUBROGATION – With regard to any policy of insurance that would pay third party losses, Firm hereby grants City a waiver of any right to subrogation which any insurer of Firm may acquire against the City by virtue of the payment of any loss under such insurance. Firm agrees to obtain any endorsement that may be necessary to affect such waiver, but this provision shall apply to such policies regardless. The above insurance limits may be achieved by a combination of primary and umbrella/excess liability policies. Other Insurance Provisions. a. Prior to the execution of this Agreement, and then annually upon the anniversary date(s) of the insurance policy’s renewal date(s) for as long as this Agreement remains in effect, the Vendor will furnish the City with a Certificate of Insurance(s) (using appropriate ACORD certificate, SIGNED by the Issuer, and with applicable endorsements) evidencing all of the coverage set forth above and naming the City as an “Additional Insured” on the Commercial General Liability Insurance and the Commercial Automobile Liability Insurance. In addition, when requested in writing from the City, Vendor will provide the City with certified copies of all applicable policies. The address where such certificates and certified policies shall be sent or delivered is as follows: DETAILED SPECIFICATIONS Citywide Printer and Copier Services 18 RFP #56-24 City of Clearwater Attn: Procurement Division, RFP #56-24 P.O. Box 4748 Clearwater, FL 33758-4748 b. Vendor shall provide thirty (30) days written notice of any cancellation, non-renewal, termination, material change or reduction in coverage. c. Vendor’s insurance as outlined above shall be primary and non-contributory coverage for Vendor’s negligence. d. Vendor reserves the right to appoint legal counsel to provide for the Vendor’s defense, for any and all claims that may arise related to Agreement, work performed under this Agreement, or to Vendor’s design, equipment, or service. Vendor agrees that the City shall not be liable to reimburse Vendor for any legal fees or costs as a result of Vendor providing its defense as contemplated herein. The stipulated limits of coverage above shall not be construed as a limitation of any potential liability to the City, and City’s failure to request evidence of this insurance shall not be construed as a waiver of Vendor’s (or any contractors’, subcontractors’, representatives’ or agents’) obligation to provide the insurance coverage specified. MILESTONES Citywide Printer and Copier Services 19 RFP #56-24 1. ANTICIPATED BEGINNING AND END DATE OF INITIAL TERM. October 2024 through September 2025 If the commencement of performance is delayed because the City does not execute the contract on the start date, the City may adjust the start date, end date and milestones to reflect the delayed execution. 2. EXTENSION. The City reserves the right to extend the term of this contract, provided however, that the City shall give written notice of its intentions to extend this contract no later than thirty (30) days prior to the expiration date of the contract. 3. RENEWAL. At the end of the initial term of this contract, the City may initiate renewal(s) as provided herein. The decision to renew a contract rests solely with the City. The City will give written notice of its intention to renew the contract no later than thirty (30) days prior to the expiration. Three (3), one (1) year renewal is possible at the City’s option. 4. PRICES. All pricing shall be firm for the initial term of one (1) year except where otherwise provided by the specifications, and include all transportation, insurance and warranty costs. The City shall not be invoiced at prices higher than those stated in any contract resulting from this proposal. a. The Contractor certifies that the prices offered are no higher than the lowest price the Contractor charges other buyers for similar quantities under similar conditions. The Contractor further agrees that any reductions in the price of the goods or services covered by this proposal and occurring after award will apply to the undelivered balance. The Contractor shall promptly notify the City of such price reductions. b. During the sixty (60) day period prior to the renewal anniversary of the contract effective date, the Contractor may submit a written request that the City increase the prices in an amount for no more than the twelve month change in the Consumer Price Index for All Urban Consumers (CPI-U), US City Average, All Items, Not Seasonally Adjusted as published by the U.S. Department of Labor, Bureau of Labor Statistics (http://www.bls.gov/cpi/home.htm). The City shall review the request for adjustment and respond in writing; such response and approval shall not be unreasonably withheld. c. At the end of the initial term, pricing may be adjusted for amounts other than inflation based on mutual agreement of the parties after review of appropriate documentation. Renewal prices shall be firm for the one (1) year renewal term. d. No fuel surcharges will be accepted. RESPONSE ELEMENTS Citywide Printer and Copier Services 20 RFP #56-24 1. PROPOSAL SUBMISSION. It is recommended that responses are submitted electronically through our bids website at https://www.myclearwater.com/business/rfp. For responses mailed and/or hand-delivered, firm must submit one (1) signed original (identified as ORIGINAL) response, five (5) copies of the response and one (1) copy in an electronic format, on a disc or thumb drive, in a sealed container using the label provided at the end of this solicitation. NOTE: If submitting proposals electronically, copies are not required. 2. PROPOSAL FORMAT (the following should be included and referenced with index tabs) NOTE: Every proposal received by the City will be considered a public record pursuant to Chapter 119, Florida Statutes. Any response marked confidential may be deemed non- responsive to this RFP. Table of Contents: Identify contents by tab and page number TAB 1 - Letter of Transmittal. A brief letter of transmittal should be submitted that includes the following information: a. The proposer’s understanding of the work to be performed. b. A positive commitment to perform the service within the time period specified. c. The names of key persons, representatives, project managers who will be the main contacts for the City regarding this project. TAB 2 – Qualifications and Experience. The following information should be included: a. A statement of qualifications, abilities, experience and expertise in providing the requested services. b. A description of what qualifies your company, financial and otherwise, to provide the City with these services for the required period of time, provide the number of current employees, the company’s years of experience, provide necessary resources and show a history of demonstrated competence. c. An assessment of the proposer’s abilities to meet and satisfy the needs of the City, taking into consideration the requested services, additional services and/or expertise offered that exceed the requirements, or the vendor’s inability to meet some of the requirements of the specifications. d. References- A minimum of three (3) references, preferably from other government agencies within the State of Florida, for which similar services have been provided within the past five (5) years are required. Include the name of the entity, contact person’s name and title, phone numbers, e-mail addresses, mailing addresses, type of services and dates services were provided. TAB 3-Responsiveness of Service Calls. Clearly define the program offered and your method to include the following elements: a. Service level commitment. b. Response time for call-out services should include the option for same-day services. c. Points of escalation for resolving servicing issues. d. Terms for annual review of service offerings. TAB 4-Business Location and Response Time. a. Current list of operating locations with addresses. b. Locations of warehouses stocked with inventory for service calls. c. Response time for maintenance and necessary repairs. d. Timeframe for the delivery of new and/or replacement equipment. TAB 5 - Pricing. The cost portion of the proposal should encompass all expenses associated with fulfilling the contract requirements for the Information Technology Department (i.e., equipment, ink, toner, regular maintenance, call-out services, etc.). At a minimum , include the following: a. The monthly lease cost for items listed in Exhibit A_Equipment and Volume List. b. The monthly per-click charge for printers. RESPONSE ELEMENTS Citywide Printer and Copier Services 21 RFP #56-24 TAB 6-Additional Information. Vendors should clearly provide the following terms and conditions: a. Provide specific terms and criteria for equipment replacement. b. Terms for end of service separation to include buy out options. c. Terms for equipment removal. d. Include if type of equipment is ENERGYSTAR certified. TAB 7 - Other Forms. The following forms should be completed and signed: a. Exceptions/Additional Materials/Addenda form b. Vendor Information form c. Vendor Certification of Proposal form d. Scrutinized Companies form(s) as required e. E-Verify Eligibility form f. Copies of licenses and/or certifications if requested g. W-9 Form. Include a current W-9 form (http://www.irs.gov/pub/irs-pdf/fw9.pdf) EXCEPTIONS / ADDITIONAL MATERIAL / ADDENDA Citywide Printer and Copier Services 22 RFP #56-24 Proposers shall indicate any and all exceptions taken to the provisions or specifications in this solicitation document. Exceptions that surface elsewhere and that do not also appear under this section shall be considered invalid and void and of no contractual significance. Exceptions (mark one): **Special Note – Any material exceptions taken to the City’s Terms and Conditions may render a Proposal non-responsive. No exceptions Exceptions taken (describe--attach additional pages if needed) Additional Materials submitted (mark one): No additional materials have been included with this proposal Additional Materials attached (describe--attach additional pages if needed) Acknowledgement of addenda issued for this solicitation: Prior to submitting a response to this solicitation, it is the vendor’s responsibility to confirm if any addenda have been issued. Addenda Number Initial to acknowledge receipt Vendor Name Date: VENDOR INFORMATION Citywide Printer and Copier Services 23 RFP #56-24 Company Legal/Corporate Name: Doing Business As (if different than above): Address: City: State: Zip: - Phone: Fax: E-Mail Address: Website: DUNS # Remit to Address (if different than above): Order from Address (if different from above): Address: Address: City: State: Zip: City: State: Zip: Contact for Questions about this proposal: Name: Fax: Phone: E-Mail Address: Day-to-Day Project Contact (if awarded): Name: Fax: Phone: E-Mail Address: Certified Small Business Certifying Agency: Certified Minority, Woman or Disadvantaged Business Enterprise Certifying Agency: Provide supporting documentation for your certification, if applicable. VENDOR CERTIFICATION OF PROPOSAL Citywide Printer and Copier Services 24 RFP #56-24 By signing and submitting this Bid/Proposal/Qualification/Response, the Vendor certifies that: a) It is under no legal prohibition on contracting with the City of Clearwater. b) It has read, understands, and is in compliance with the specifications, terms and conditions stated herein, as well as its attachments, and any referenced documents. c) It has no known, undisclosed conflicts of interest. d) The prices offered were independently developed without consultation or collusion with any of the other vendors or potential vendors or any other anti-competitive practices. e) No offer of gifts, payments or other consideration were made to any City employee, officer, elected official, or consultant who has or may have had a role in the procurement process for the commodities or services covered by this contract. The Vendor has not influenced or attempted to influence any City employee, officer, elected official, or consultant in connection with the award of this contract. f) It understands the City may copy all parts of this response, including without limitation any documents or materials copyrighted by the Vendor, for internal use in evaluating respondent’s offer, or in response to a public records request under Florida’s public records law (F.S. Chapter 119) or other applicable law, subpoena, or other judicial process; provided that the City agrees not to change or delete any copyright or proprietary notices. g) It hereby warrants to the City that the Vendor and its subcontractors will comply with, and are contractually obligated to comply with, all federal, state, and local laws, rules, regulations, and executive orders. h) It certifies that Vendor is not presently debarred, suspended, proposed for debarment, declared ineligible, voluntarily excluded, or disqualified from participation in this matter from any federal, state, or local agency. i) It will provide the commodities or services specified in compliance with all federal, state, and local laws, rules, regulations, and executive orders if awarded by the City. j) It is current in all obligations due to the City. k) It will accept all terms and conditions as set forth in this solicitation if awarded by the City. l) The signatory is an officer or duly authorized representative of the Vendor with full power and authority to submit binding offers and enter into contracts for the commodities or services as specified herein. ACCEPTED AND AGREED TO: Company Name: Signature: Printed Name: Title: Date: SCRUTINIZED COMPANIES FORMS Citywide Printer and Copier Services 25 RFP #56-24 SCRUTINIZED COMPANIES AND BUSINESS OPERATIONS WITH CUBA AND SYRIA CERTIFICATION FORM IF YOUR BID/PROPOSAL IS $1,000,000 OR MORE, THIS FORM MUST BE COMPLETED AND SUBMITTED WITH THE BID/PROPOSAL. FAILURE TO SUBMIT THIS FORM AS REQUIRED MAY DEEM YOUR SUBMITTAL NONRESPONSIVE. The affiant, by virtue of the signature below, certifies that: 1. The vendor, company, individual, principal, subsidiary, affiliate, or owner is aware of the requirements of section 287.135, Florida Statutes, regarding companies on the Scrutinized Companies with Activities in Sudan List, the Scrutinized Companies with Activities in the Iran Petroleum Energy Sector List, or engaging in business operations in Cuba and Syria; and 2. The vendor, company, individual, principal, subsidiary, affiliate, or owner is eligible to participate in this solicitation and is not listed on either the Scrutinized Companies with Activities in Sudan List, the Scrutinized Companies with Activities in the Iran Petroleum Sector List, or engaged in business operations in Cuba and Syria; and 3. Business Operations means, for purposes specifically related to Cuba or Syria, engaging in commerce in any form in Cuba or Syria, including, but not limited to, acquiring, developing, maintaining, owning, selling, possessing, leasing or operating equipment, facilities, personnel, products, services, personal property, real property, military equipment, or any other apparatus of business or commerce; and 4. If awarded the Contract (or Agreement), the vendor, company, individual, principal, subsidiary, affiliate, or owner will immediately notify the City of Clearwater in writing, no later than five (5) calendar days after any of its principals are placed on the Scrutinized Companies with Activities in Sudan List, the Scrutinized Companies with Activities in the Iran Petroleum Sector List, or engaged in business operations in Cuba and Syria. __________________________________________ Authorized Signature __________________________________________ Printed Name __________________________________________ Title __________________________________________ Name of Entity/Corporation STATE OF _____________________ COUNTY OF ___________________ The foregoing instrument was acknowledged before me by means of ☐ physical presence or ☐ online notarization on, this _____ day of _________________, 20____, by _____________________________ (name of person whose signature is being notarized) as the ________________________ (title) of ______________________________________(name of corporation/entity), personally known ______, or produced _________________________ (type of identification) as identification, and who did/did not take an oath. __________________________________________ Notary Public __________________________________________ Printed Name My Commission Expires: __________________ NOTARY SEAL ABOVE SCRUTINIZED COMPANIES FORMS Citywide Printer and Copier Services 26 RFP #56-24 SCRUTINIZED COMPANIES THAT BOYCOTT ISRAEL LIST CERTIFICATION FORM THIS FORM MUST BE COMPLETED AND SUBMITTED WITH THE BID/PROPOSAL. FAILURE TO SUBMIT THIS FORM AS REQUIRED MAY DEEM YOUR SUBMITTAL NONRESPONSIVE. The affiant, by virtue of the signature below, certifies that: 1. The vendor, company, individual, principal, subsidiary, affiliate, or owner is aware of the requirements of section 287.135, Florida Statutes, regarding companies on the Scrutinized Companies that Boycott Israel List, or engaged in a boycott of Israel; and 2. The vendor, company, individual, principal, subsidiary, affiliate, or owner is eligible to participate in this solicitation and is not listed on the Scrutinized Companies that Boycott Israel List, or engaged in a boycott of Israel; and 3. “Boycott Israel” or “boycott of Israel” means refusing to deal, terminating business activities, or taking other actions to limit commercial relations with Israel, or persons or entities doing business in Israel or in Israeli-controlled territories, in a discriminatory manner. A statement by a company that it is participating in a boycott of Israel, or that it has initiated a boycott in response to a request for a boycott of Israel or in compliance with, or in furtherance of, calls for a boycott of Israel, may be considered as evidence that a company is participating in a boycott of Israel; and 4. If awarded the Contract (or Agreement), the vendor, company, individual, principal, subsidiary, affiliate, or owner will immediately notify the City of Clearwater in writing, no later than five (5) calendar days after any of its principals are placed on the Scrutinized Companies that Boycott Israel List, or engaged in a boycott of Israel. ______________________________________ Authorized Signature ______________________________________ Printed Name ______________________________________ Title ______________________________________ Name of Entity/Corporation STATE OF _____________________ COUNTY OF ___________________ The foregoing instrument was acknowledged before me by means of ☐ physical presence or ☐ online notarization on, this _____ day of _________________, 20____, by _____________________________ (name of person whose signature is being notarized) as the ________________________ (title) of ______________________________________(name of corporation/entity), personally known ______, or produced _________________________ (type of identification) as identification, and who did/did not take an oath. __________________________________________ Notary Public __________________________________________ Printed Name My Commission Expires: __________________ NOTARY SEAL ABOVE E-VERIFY ELIGIBILITY FORM Citywide Printer and Copier Services 27 RFP #56-24 VERIFICATION OF EMPLOYMENT ELIGIBILITY FORM PER FLORIDA STATUTE 448.095, CONTRACTORS AND SUBCONTRACTORS MUST REGISTER WITH AND USE THE E-VERIFY SYSTEM TO VERIFY THE WORK AUTHORIZATION STATUS OF ALL NEWLY HIRED EMPLOYEES. THIS FORM MUST BE COMPLETED AND SUBMITTED WITH THE BID/PROPOSAL. FAILURE TO SUBMIT THIS FORM AS REQUIRED MAY DEEM YOUR SUBMITTAL NONRESPONSIVE. The affiant, by virtue of the signature below, certifies that: 1. The Contractor and its Subcontractors are aware of the requirements of Florida Statute 448.095. 2. The Contractor and its Subcontractors are registered with and using the E-Verify system to verify the work authorization status of newly hired employees. 3. The Contractor will not enter into a contract with any Subcontractor unless each party to the contract registers with and uses the E-Verify system. 4. The Subcontractor will provide the Contractor with an affidavit stating that the Subcontractor does not employ, contract with, or subcontract with unauthorized alien. 5. The Contractor must maintain a copy of such affidavit. 6. The City may terminate this Contract on the good faith belief that the Contractor or its Subcontractors knowingly violated Florida Statutes 448.09(1) or 448.095(2)(c). 7. If this Contract is terminated pursuant to Florida Statute 448.095(2)(c), the Contractor may not be awarded a public contract for at least 1 year after the date on which this Contract was terminated. 8. The Contractor is liable for any additional cost incurred by the City as a result of the termination of this Contract. __________________________________________ Authorized Signature __________________________________________ Printed Name __________________________________________ Title __________________________________________ Name of Entity/Corporation STATE OF _____________________ COUNTY OF ___________________ The foregoing instrument was acknowledged before me by means of ☐ physical presence or ☐ online notarization on, this _____ day of _________________, 20____, by _______________________________ (name of person whose signature is being notarized) as the ________________________ (title) of ______________________________________(name of corporation/entity), personally known ______, or produced _________________________ (type of identification) as identification, and who did/did not take an oath. ____________________________________ Notary Public ____________________________________ Printed Name My Commission Expires: __________________ NOTARY SEAL ABOVE MAILING LABEL CUT ALONG THE LINE AND AFFIX TO THE FRONT OF YOUR BID CONTAINER Citywide Printer and Copier Services 28 RFP #56-24 --------------------------------------------------------------------------------- For US Mail ------------------------------------------------------------------------------ SEALED PROPOSAL Submitted by: Company Name: Address: City, State, Zip: RFP #56-24, Citywide Printer and Copier Services Due Date: September 5, 2024, at 10:00 A.M. City of Clearwater Attn: Procurement Division PO Box 4748 Clearwater FL 33758-4748 --------------------------------------------------------------------------------- For US Mail ------------------------------------------------------------------------------ ---------------------------------------------- For Hand Deliveries, FEDEX, UPS or Other Courier Services ------------------------------------------------ SEALED PROPOSAL Submitted by: Company Name: Address: City, State, Zip: RFP #56-24, Citywide Printer and Copier Services Due Date: September 5, 2024, at 10:00 A.M. City of Clearwater Attn: Procurement Division 100 S Myrtle Ave 3rd Fl Clearwater FL 33756-5520 ---------------------------------------------- For Hand Deliveries, FEDEX, UPS or Other Courier Services ------------------------------------------------ 1) Advanced Business Solutions FL LLC 2) DEX Imaging, LLC dba Total Print USA LLC 280 Business Park Circle, STE# 415 5109 W Lemon Street St. Augustine, FL 32095 Tampa, FL 33609 (904) 438-2701 (855) 915-1300 3) HP, Inc.4)Print Doctor, Inc. 1501 Page Mill Road 10775 SW 188th Street, STE#1 Palo Alto, CA 94304 Miami, FL 33157 (650) 857-1501 (305) 278-4141 ADVERTISED: TAMPA BAY TIMES 8/7/2024 POSTED:myclearwater.com 8/5/24-9/4/24 Due/Opening:September 4 , 2024; 10:00 a.m. REQUEST FOR PROPOSAL No. 56-24 Citywide Printer and Copier Services Solicitation Response Listing FOR THE CITY OF CLEARWATER TotalPrint USA | 5100 West Cypress Street Tampa, Florida 33609 | Phone 855-915-1300 info@totalprintusa.com | www.totalprintusa.com A Unique Partnership Opportunity for 2 Table of Contents: Identify contents by tab and page number Tab 1 – pg 3 Tab 2 – pg 5 Tab 3 – pg 8 Tab 4 – pg 15 Tab 5 – pg 15 Tab 6 – pg 15 Tab 7 – pg 16 3 TAB 1 TotalPrint USA 5100 W Cypress St Tampa, FL 33607 Dan.Gayton@TotalPrintUSA.com 727-741-5157 8/29/24 Lori Vogel, CPPB Procurement Manager City of Clearwater 100 S Myrtle Ave Clearwater, FL 33756 Dear Lori, We are pleased to submit our proposal for Citywide Printer and Copier Services as requested by the City of Clearwater. We have thoroughly reviewed the scope of work and have a comprehensive understanding of the tasks involved. Specifically, we understand that the project requires HP equipment, municipality experience, and a service plan that provides SLA’s that meet and exceed expectations. We are committed to delivering these services within the specified starting in October of 2024 ensuring that all milestones and deadlines are met with the highest level of quality and professionalism. Our team is fully prepared to allocate the necessary resources to achieve the project's objectives efficiently and effectively. For this project, the key contacts from our team will be: - Daniel Gayton, Account manager – My primary role is overseeing enterprise municipalities in Tampa Bay region. My experience aligns with City of Clearwater’s goals. - Bruce Rushton, Project Manager - Lead individual responsible for technical implementation, change orders, escalation, and ongoing project development - Steve Lastic, Sr. Engineer - Quality Assurance Specialist ensuring project meets all requirements. Also lead network specialist - Brian Harris, Director of TPUSA – Oversees all managed print services for TPUSA and has experience at City of Clearwater. Should you require any further information or wish to discuss our proposal in more detail, please do not hesitate to contact us. We look forward to the opportunity to collaborate on this important project. Thank you for your consideration. Sincerely, 4 Daniel Gayton Enterprise Managed Print Executive Dan.Gayton@totalprintusa.com 727-741-5157 TotalPrint USA 5 TAB 2 – Qualifications and Experience. The following information should be included: a. A statement of qualifications, abilities, experience and expertise in providing the requested services. b. A description of what qualifies your company, financial and otherwise, to provide the City with these services for the required period of time, provide the number of current employees, the company’s years of experience, provide necessary resources and show a history of demonstrated competence. c. An assessment of the proposer’s abilities to meet and satisfy the needs of the City, taking into consideration the requested services, additional services and/or expertise offered that exceed the requirements, or the vendor’s inability to meet some of the requirements of the specifications. Qualifications and Experience a. Statement of Qualifications, Abilities, Experience, and Expertise We feel very confident that our response will address every aspect of the RFP. The solution we are sharing includes a like for like machine replacement, an optimized fleet replacement with the requested manufacturer and our lead HP. We welcome the opportunity to uncover more details about City of Clearwater’s print environment and provide alternative solutions as needed. We are positive that our solution will result in significant improvements to existing processes, as well as provide opportunities to improve service coverage. It is our sincere hope to engage, as part of this partnership, in an ongoing dialogue that encompasses not only what is included in the RFP but also the challenges the come with new and exciting innovations. Again, we are grateful and excited for the opportunity to present our response, which we believe will deliver the maximum value available in our industry. b. Company Qualifications Company Overview: DEX Imaging was formed on February 14, 2002, but we come from a 45-year heritage of selling and servicing office equipment. TotalPrint USA was formed in 2015 to focus on true managed print services. While TPUSA is a bit newer to the market share than some of our competitors, our expertise is not. In 1977, Dan Doyle Sr. founded Danka Business Systems, a single storefront office imaging dealership in Tampa, Florida. Over a 21-year span as Danka’s Founder and CEO, Dan Doyle Sr. grew the business from a start-up into the world's largest office equipment and service organization with 750+ offices in 35 countries and annual revenues exceeding $3.5 billion. Today, with over 1600+ employees spread across the United States, we specialize in providing innovative technology that integrates into how you do business. From IT to Facilities Management and specialized print management software, we put together all of these elements to create a complete document management solution that keeps costs low and day-to-day operations flowing smoothly. About Us The uniqueness of TPUSA is in our structure as a fully contained Managed Print organization, acting as your technology provider/developer, manufacturer and service entity to handle all aspects of your 6 imaging environment. TPUSA’s experience in all elements of the required solution, gained while serving similar size & scope environments, uniquely positions us to be the preeminent imaging partner required to operate in this rapidly evolving business climate. Through proper analysis and planning, we improve productivity as it relates to documents, often at a reduced expense. Our approach remains focused on desired outcomes rather than adherence to long-established practices. Company Values & Culture TPUSA is a value-driven company that is committed to providing excellent customer service and innovative solutions. DEX Imaging is a certified B Corporation, which means we meet rigorous standards of social and environmental performance, accountability, and transparency. Our core values are customer focus, excellence, integrity, teamwork, and innovation. These values are reflected in the business practices, which include offering a wide range of products and services, investing in research and development, having a strong commitment to customer satisfaction, and donating 1/3 of all profits to local charities and organizations. Total Staff Number of Full Time Employees: DEX Imaging has 1,638 full time employees around the United States. Number of Full Time Employees in Pinellas County: DEX Imaging has 55 employees in Pinellas County. Number of Part Time Employees: DEX Imaging has 25 part time employees around the United States. Number of Contractors: DEX Imaging has 128 contractors around the United States. Geographic Specific Information TPUSA is headquartered in Tampa, FL and currently has more than 40 locations nationwide including St. Petersburg/Clearwater. Financial Stability: Growth and Expansion DEX Imaging/TPUSA expanded its service model, partnering with key OEM brands. Starting at $8 million in revenue in 2002, DEX reached $245 million by 2018. Geographic expansion to North Carolina, Texas, and Tennessee, along with organic growth and acquisitions, fueled this growth. Strategic Acquisitions From 2019 to 2023 DEX Imaging has acquired 14 companies, expanding its branch footprint to include the Mountain region. Notable acquisitions included Office Systems of Texas, KMBS locations, CopyNet, BMC in Knoxville, and others. Demonstrating our commitment to expanding our service footprint throughout the United States, DEX has prioritized strategic acquisitions nationwide. Past Mergers DEX Imaging was acquired in 2019 by Staples, Inc. However, in April 2024, Doyle family purchased DEX Imaging from Staples. So, currently DEX Imaging is an independent company again, not owned by a parent company. 7 Company Strengths TPUSA’s strengths as a company include an extensive national footprint that allows us to effectively serve a diverse customer base across the United States, advanced technology that keeps us at the forefront of industry innovation, and a team of highly experienced professionals who bring a wealth of expertise. Additionally, our competitive pricing ensures customers receive excellent value, and our commitment to exceptional customer service fosters high levels of satisfaction and loyalty. These strengths have driven our growth, making TPUSA the nation’s largest independent office equipment dealer. c. Assessment of Abilities Ability to Meet Needs: TPUSA is fully equipped to meet the City’s needs, as outlined in the request for services. Our team’s deep expertise, combined with our commitment to innovation, allows us to exceed expectations in areas such as service SLA’s, implementation/installation, and ongoing support. We are prepared to go beyond the baseline requirements by offering additional services such as help desk support, 9+ on-call local technicians, and a dedicated account manager that ensure long-term success for the City. The City of Clearwater is positioned perfectly to receive the best service an organization could ask for. Exceeding Requirements: In addition to meeting the specified requirements, we can also provide additional support for large format devices, additional accounting software, productions devices, and print shop . Furthermore, when you work with TPUSA, you have a Sr. Engineer embedded on our team to walk through any tricky print situations. These services will enhance the overall value of our proposal and provide the City with a superior service experience. --- d. References- A minimum of three (3) references, preferably from other government agencies within the State of Florida, for which similar services have been provided within the past five (5) years are required. Include the name of the entity, contact person’s name and title, phone numbers, e-mail addresses, mailing addresses, type of services and dates services were provided. References 1. Hillsborough County Board of County Commissioners Contact Person: Axel Clauberg, CIO Phone Number: (813) 895-0020 Email Address: ClaubergA@hcfl.gov Mailing Address: 601 E. Kennedy Blvd., Tampa, FL 33602 Type of Services Provided: Managed Print services, accounting software implemenations, Hyland Onbase integration, print shop services, and scanning services. Dates of Service: November 2021 - December 2028 2. City of Largo Contact Person: Justin Meetoo, IT Customer Service Manager 8 Phone Number: (352) 283-1654 Email Address: jmeetoo@Largo.com Mailing Address: 201 Highland Ave Largo FL 33770 Type of Services Provided: Managed Print services, large format services, scanning services, and print shop services. Dates of Service: June 2019 - August 2026 3. Hillsborough County Property Appraiser Contact Person: Frank Guida Phone Number: (813) 526-0513 Email Address: GuidaF@HCPAFL.org Type of Services Provided: HP Managed Print Services, large format printing, and Printerlogic accounting software. Dates of Service: Jan 2022 - Jan 2027 Other Notable Clearwater accounts: Frenchy’s Restaurants, Lincare National --- These references provide a snapshot of our experience and ability to deliver high-quality services to government entities within the State of Florida. We encourage you to contact them to learn more about our work and our commitment to excellence. 9 TAB 3 - Responsiveness of Service Calls. Clearly define the program offered and your method to include the following elements: a. Service level commitment. b. Response time for call-out services should include the option for same-day services. c. Points of escalation for resolving servicing issues. SERVICE Service Guarantees Because service is a driving force behind our organization, we only sell “Best in Class” imaging products and content management solutions. Our warehouses are fully stocked with current- model parts & supplies. We have outstanding relationships with our manufacturers who ensure additional support (if necessary). We offer a Lifetime Performance Guarantee on all products and services. As long as your equipment is maintained and serviced under a TPUSA Agreement, we guarantee it. At TPUSA, we like to get it right the first time. The minute we receive a service call from a client, we immediately assign one of our trained engineers to handle their job. We are able to exceed our clients' expectations because of our localized, automated, inventory replenishment system. Once we receive a service call, it is reviewed and screened by our dispatch team and assigned to the proper technician. The technician will respond to the service request within 4 hours to give an ETA. Technicians are then dispatched to arrive within the contracted SLA to assess the service issue. The point of contact will be updated with the repair details and a follow-up appointment time will be scheduled if required. Every DEX branch has a fully stocked service warehouse with parts and supplies available to facilitate its local client base. Unlike many of our competitors who only have regional service warehouses, DEX is able to guarantee service within four hours of the initial service call and we have exceeded that in City of Clearwaters market operating at an unheard of 2.8-hour average response time. From our sales staff to our IT engineers and technicians, all TPUSA employees have a comprehensive knowledge of “how things work” so that we are accurately consulting and servicing our clients to the very best of our ability. All TPUSA Systems Engineers and Field Technicians are Manufacturer-Trained, not only on the specific makes and models that we are licensed to sell, but also on product lines we do not sell, so that we are able to provide a Total Service Solution as one vendor to our clients who have existing equipment from previous vendors. TPUSA’s service department has a 99.98% approval rating, due in large part to the exclusive “Customer Care Program” we have implemented. Though each DEX branch has autonomy with regard to dispatching its service staff and maintaining its inventory replenishment system, the company as a whole has stringent standards that all sales representatives and service engineers must meet before they can be a part of the DEX Customer Service Team. Dependable service is paramount to any business’ success, and we take that matter very seriously. 10 If our engineers are unable to fix any service problem on the first service call, we still have a solution for them that will beat anybody else in the business. It's called our Loaner Protection Program, and what that means is that TPUSA will provide the client with a loaner equipment of equal or greater value to the equipment they have under contract, installed at their facility, free of charge, until their original equipment has been fixed. Additional service solutions, such as providing hot swap machines or after-hours service, can also be arranged. TPUSA will provide device replacements and hot swaps for mission critical areas that require the highest level of uptime. These devices will be replaced on the fly resulting in an overall uptime of 99.9%. SLA Description TPUSA prioritizes minimizing downtime and exceeding client expectations. Our streamlined service process ensures a prompt response and efficient resolution to your needs. Rapid Response: Once we receive a service call, it is reviewed and screened by our dispatch team and assigned to the proper technician. The technician will respond to the service request within 1 hour to give an ETA. Guaranteed Service Within 4 Hours: We guarantee on-site service within 4 hours of your initial call. Not only do we meet this standard, but we consistently surpass it, boasting an industry-leading average response time of 2.8 hours across all markets. This means we get your equipment back up and running even faster, minimizing your downtime. Efficient Resolution: Our dedicated support team is committed to resolving your service issue as quickly as possible. We work diligently to address the problem within the 4-hour SLA timeframe. We understand the importance of minimizing downtime, and our goal is to restore your operational functionality swiftly and efficiently. Service Resolution Time At TPUSA we prioritize prompt and efficient resolution of any issues encountered by our clients. Our commitment entails ensuring that from the moment end users reach out to us, we work diligently to address and resolve the issue within our four hour SLA. We recognize the importance of minimizing downtime and swiftly restoring operational functionality. Thus, our dedicated team of support professionals endeavors to exceed these service level commitments and provide seamless assistance to our valued customers. Fleet Uptime Guarantee TPUSA maintains an average fleet uptime percentage of 99.2%. This is determined by evaluating factors such as the quantity of service calls, average response time, and average repair time, which are then compared against the total number of devices in the fleet, work hours, and the reporting period to calculate uptime hours. Uptime is assessed on a quarterly basis during our Executive Business Reviews, conducted by the account manager and support team. 11 Supply Chain At TPUSA, we prioritize maintaining a resilient supply chain to ensure uninterrupted service delivery to our clients. We proactively identify and assess risks, diversify our supplier base, and cultivate strong supplier relationships for collaborative contingency planning. Our inventory optimization strategies and investment in supply chain visibility technologies enable us to detect and mitigate disruptions swiftly. Through proactive scenario planning and continuous monitoring, we remain agile in adapting to evolving risks. This steadfast commitment to resilience ensures that we uphold our promise of delivering reliable service, even in challenging circumstances. Service Request Procedure There are two methods available to our customers to view their service request status. Our E-Info portal allows the user to place and view service calls and also contains information regarding the progress and completion of each call. The customer can also enroll in an email update service that sends updates to the designated email as the status changes for each service call. Performance Guarantee Our “Performance Guarantee” provides exceptional service for the life of your device. If our engineers are unable to fix your service problem on the initial service call, our solution will exceed our competitor’s options through our Loaner Protection Program. The Loaner Protection Program will provide our clients with loaner equipment that is of equal or greater value to the equipment already on contract; we will install this equipment at your facility, completely free of charge, until the original equipment is repaired. If a unit is not performing up to manufacturer specifications/expectations and we are unable to repair the unit, it will be replaced at no charge. 12 Scheduled Maintenance At TPUSA, we present an array of maintenance solutions designed to effectively oversee and cater to your fleet's operational needs. TPUSA has established partnerships with an array of distinguished software vendors, aimed at providing our clientele with a robust service alert system. We are keen to gain a deeper understanding of CoC’s existing maintenance schedule, as well as any challenges encountered and desired enhancements. Through collaborative efforts with CoC, our intention is to formulate a tailor-made maintenance regimen that precisely aligns with your requirements. TPUSA offers a comprehensive approach to provide and support maintenance management to its clients. This approach involves managing an asset from the time it is acquired through to its disposal or replacement. Preventive maintenance shall be performed as needed to ensure optimal operation of equipment. Our Services Our services at TPUSA differentiate from our competitors through our innovative and flexible solutions, coupled with industry-leading service guarantees. We offer a range of workflow solutions tailored to efficiently manage print fleets, with programs including traditional purchasing, leasing, and equipment rentals. Our Platinum program provides a customizable system, allowing for adjustments throughout the agreement term without the need for third-party approvals. This eliminates costly coterminous leases and ensures a simplified experience with one point of contact for service, supplies, and billing. Additionally, our robust service commitment sets us apart, with a 99.98% approval rating attributed to our System of Service. Furthermore, our Lifetime Performance Guarantee ensures continuous support for equipment under our maintenance agreements. With features like preconfigured devices, fleet management tools, and on-site end-user training, we deliver comprehensive solutions that prioritize client satisfaction and operational efficiency. Services interruptions have been exceedingly rare over the past few years, primarily due to the rigorous backup plans we have diligently put in place. Our proactive approach to risk management and contingency planning has allowed us to swiftly address any potential disruptions before they escalate, ensuring uninterrupted service delivery to our clients. We continuously monitor and evaluate our systems to identify and mitigate risks, safeguarding the reliability and continuity of our services. As a result, our clients can have confidence in the stability of our operations. KPI’s Upon the closure of each service call, TPUSA sends out an automatic survey to the end user to measure customer satisfaction. The survey contains questions used to assess the responsiveness, promptness, scheduling, communication, and cleanliness, which we have deemed essential in providing seamless and satisfactory service to our customers. The survey measures performance on a 10-point scale where any score that is seven or lower results in immediate follow up or escalation. Our surveys are customizable to assure that the data we are collecting is germane to the specific environment we are evaluating. Customer Satisfaction At TPUSA, we prioritize customer satisfaction and promptly address any dissatisfaction with our service level agreements (SLAs). We actively monitor feedback through surveys and direct communication, swiftly resolving issues with our dedicated customer support team. Additionally, we regularly review and 13 refine our SLAs to ensure alignment with customer expectations. Our goal is to provide exceptional service that exceeds expectations, maintaining high levels of customer satisfaction through continuous improvement and attentive customer support. Customer Complaints & Service Issues We prioritize prompt and effective resolution of customer complaints and service issues. Upon receiving a complaint or report of a service issue, our dedicated customer support team swiftly investigates the matter to understand the root cause and severity of the issue. We maintain open lines of communication with the customer throughout the process, providing regular updates on the status of their complaint or service request. Once the issue has been identified, we take decisive action to address it, whether it requires technical troubleshooting, replacement of equipment, or process improvements. Our goal is to resolve the issue to the customer's satisfaction as quickly as possible, minimizing any disruption to their operations. Furthermore, we view customer complaints and service issues as valuable feedback opportunities. We analyze trends and patterns in reported issues to identify areas for improvement in our products, services, and processes. By continuously learning from customer feedback and proactively addressing issues, we strive to enhance the overall customer experience and strengthen our relationships with our valued clients. Helpdesk TPUSA offers First Level Triage for all units via the Help Desk to ensure quick fixes for all end user related issues to achieve maximum device uptime. Replicated environments in the Help Desk imitate the client environment to quickly and easily solve workflow issues. If our Service Engineers cannot solve the issue remotely, we will escalate it to a service technician and have someone dispatched immediately. The TPUSA Helpdesk was created to enhance the overall satisfaction of our customers and is staffed by our experienced technicians and system engineers. Through state-of-the-art technology, service requests are quickly routed to the correct queue for fast, remote, phone support. To ensure the customer has their questions or issues resolved quickly, our Helpdesk has the ability to troubleshoot via telephone, remote support through their computer, and/or via the client’s camera on their cell phone using an App called “Remote Lens”. If the issue cannot be repaired remotely, the information gathered by the Helpdesk will assist in drastically reducing troubleshooting time on-site and allow the technician to resolve the issue quickly. As of March 2019, our Helpdesk answered an average of 5,000 calls per month with an 82-85% closure rate. That means 8 out of 10 calls will be resolved over the phone or remotely without having to send an actual technician to the client’s site. Escalation Path For Resolution The account executive, Dan Gayton, will serve as the primary point of contact, interfacing with the customer on a day-to-day basis. He will handle all daily communications with the customer and escalate relevant matters to the appropriate parties within TPUSA as needed. Additionally, the account executive will proactively work to identify and resolve potential issues before they arise. 14 TPUSA will designate a dedicated team to ensure that any and all issues that may arise during the course of this project are resolved promptly and effectively. Each of these personnel will be informed of the ongoing processes set in place by CoC to curtail and resolve issues before they arise. CoC’s dedicated resource team will be comprised of our implementation, service compliance, account management, and customer service teams. The members of this team will assist in providing CoC with a transparent path to escalation involving all appropriate parties. Upon contract inception, information regarding the dedicated personnel will be distributed to CoC along with the appropriate path of escalation. The path of escalation is outlined below: o Dan Gayton – Account Executive – First email o Bruce Rushton – Project Mgr/ Escalation Specialist – First email o Steve Lastic – Technical Engineer – Escalation if technical o Brian Harris – TPUSA Director o Paul Natale – COO o Dan Doyle Jr. – CEO & President d. Terms for annual review of service offerings. Terms for annual review of service offerings are negotiated. Since we are self-financed, we can be flexible in our offering. 15 TAB 4 - Business Location and Response Time. a. Current list of operating locations with addresses. b. Locations of warehouses stocked with inventory for service calls. c. Response time for maintenance and necessary repairs. d. Timeframe for the delivery of new and/or replacement equipment. Local Service and Delivery Center; 11205 Blue Heron Blvd., St. Petersburg, FL 33716 TPUSA Headquarter’s including 2 warehouses; 5100 West Cypress Street, Tampa, Florida 33607 4-hour response guaranteed SLA for CoC. 1-2 week window for new equipment delivery depending on availability. This can be expedited in an emergency scenario. TAB 5 - Pricing. The cost portion of the proposal should encompass all expenses associated with fulfilling the contract requirements for the Information Technology Department (i.e., equipment, ink, toner, regular maintenance, call-out services, etc.). At a minimum, include the following: a. The monthly lease cost for items listed in Exhibit A_Equipment and Volume List. b. The monthly per-click charge for printers. RESPONSE ELEMENTS Citywide Printer and Copier Services 21 RFP #56-24 - Please refer to addendum including product guide and excel spreadsheet TAB 6 - Additional Information. Vendors should clearly provide the following terms and conditions: a. Provide specific terms and criteria for equipment replacement. - Please see Performance Guarantee on pg 11. In most cases, we implement true managed print services. In this scenario, equipment is replaced if it stops working as intended, requires too much attention, or is deemed a lemon. We offer a very flexible replacement strategy. Equipment replacement can vary depending on contract negotiations. b. Terms for end of service separation to include buy out options. - Our true managed print allows us to be flexible in terms of buyout options. Since we are self financed and own the equipment we place, you can receive a buyout at any time based on FMV. c. Terms for equipment removal. - Equipment removal can be accomplished by TPUSA and is determined per device and/or pickup. That said, we can determine rates prior to contractual period. d. Include if type of equipment is ENERGYSTAR certified. All equipment is energy star certified. 16 TAB 7 - Attached. Other Forms. The following forms should be completed and signed: a. Exceptions/Additional Materials/Addenda form b. Vendor Information form Attached c. Vendor Certification of Proposal form d. Scrutinized Companies form(s) as required Attached e. E-Verify Eligibility form f. Copies of licenses and/or certifications if requested g. W-9 Form. Include a current W-9 form (http://www.irs.gov/pub/irs-pdf/fw9.pdf Response\Tab 7 Response.pdf HP E40040DN - Mono - 40PPM HP E50145 - Mono - 45PPM HP E60155 - Mono - 55PPM HP X55745 - Color - 45PPM < 500 Pages Per Month 500-2,500 Pages Per Month 2500+ Pages Per Month < 4,000 Pages Per Month Base 7$ Base 14$ Base 19$ Base 21$ Usage 0.012$ Usage 0.010$ Usage 0.010$ Usage 0.075 (C) / .01 (M) HP E42540f - Mono-40PPM HP E52645 - Mono - 45PPM HP E62655 - Mono - 55PPM HP X57945DN - Color - 45PPM < 500 Pages Per Month 500-2,500 Pages Per Month 2500+ Pages Per Month < 4,000 Pages Per Month Base 11$ Base 29$ Base 37$ Base 38$ Usage 0.012$ Usage 0.010$ Usage 0.010$ Usage 0.075 (C) / .01 (M) Printer/A4 Accessories Base $8 - $10 $2 - $5 $6 - $12 $9 - $11 $8 - $10 $10 Base $5 - $15 $10 - $15 HP E62665z - Mono - 65PPM HP X67755dn - Color - 55PPM HP X67755s - Color - 55PPM Base <10,000 Pages Per Month < 10,000 Pages Per Month < 10,000 Pages Per Month $10 - $15 Base 60$ Base 60$ Base 71$ $7 - $12 Usage 0.010$ Usage 0.075 (C) / .01 (M)Usage 0.075 (C) / .01 (M) Copier Models Base Mono Color HP E82650dn 50 PPM Mono MFP 84$ 0.009 N/A HP E82660dn 60 PPM Mono MFP 105$ 0.009 N/A HP E82670dn 70 PPM Mono MFP 129$ 0.009 N/A HP E87740dn 40 PPM Color MFP 102$ 0.009 0.055 HP E87750dn 50 PPM Color MFP 118$ 0.009 0.055 HP E87760dn 60 PPM Color MFP 143$ 0.009 0.055 HP E87770dn 70 PPM Color MFP 166$ 0.009 0.055 Base 2 Tray 9$ Base Hi Capacity 10$ Staple Stacker Finisher 21$ Booklet Finisher 4$ Inner Finisher 16$ Hi Capacity Input Side 16$ Badge Readers (for all HP)4$ 2/3 Hole Punch 8$ Fax 5$ Upgrade to Flow model 20$ Software Applications PrinterLogic PaperCut Device Removal Lease Return Device Disposal Fax Wireless Extra Tray Storage stand Stand Speed Upgrade (x677 only) Current City Location for Equipment Address Model Class Description Equipment Description Replacement Device Lease Price (All Inclusive)CPC Mono CPC Color CITY OF CLEARWATER GENERAL SERVICES1900 GRAND AVE Rental Mono Printer HP LJ 1320 PRINTER HP 40040 7$ 0.012 0.095 CITY OF CLEARWATER FIRE STATION 46546 MANDALAY AVE Rental Mono Printer HP LJ M401 PRINTER HP 40040 7$ 0.012 0.095 CITY OF CLEARWATER UTILITIES CUST SERVICE100 S MYRTLE AVE Rental Mono Printer HP LJ M402 PRINTER HP 40040 7$ 0.012 0.095 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Mono Printer HP LJ M402 PRINTER HP 40040 7$ 0.012 0.095 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Mono Printer HP LJ M402 PRINTER HP 40040 7$ 0.012 0.095 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Mono Printer HP LJ M402 PRINTER HP 40040 7$ 0.012 0.095 CITY OF CLEARWATER HUMAN RESOURCES100 S MYRTLE AVE Rental Mono Printer HP LJ M404 PRINTER HP 40040 7$ 0.012 0.095 CITY OF CLEARWATER FIRE STATION 481700 N BELCHER RD Rental Mono Printer HP LJ M404 PRINTER HP 40040 7$ 0.012 0.095 CITY OF CLEARWATER PUB UTIL RO2 PLANT21133 US HWY 19 N Rental Mono Printer HP LJ M404 PRINTER HP 40040 7$ 0.012 0.095 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Mono Printer HP LJ M404 PRINTER HP 40040 7$ 0.012 0.095 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Mono Printer HP LJ M404 PRINTER HP 40040 7$ 0.012 0.095 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Mono Printer HP LJ M404 PRINTER HP 40040 7$ 0.012 0.095 CITY OF CLEARWATER GAS SYSTEMS777 MAPLE ST Rental Mono Printer HP LJ M404 PRINTER HP 40040 7$ 0.012 0.095 CITY OF CLEARWATER S MYRTLE100 S MYRTLE AVE F1 Rental Mono MFP HP LJ E42540 HP 42540 11$ 0.012 0.095 CITY OF CLEARWATER FIRE STATION 451140 COURT ST, FIRE STATION 45Rental Mono MFP HP LJ E42540 HP 42540 11$ 0.012 0.095 CITY OF CLEARWATER PUBLIC UTILITIES1650 N ARCTURAS AVE Rental Mono MFP HP LJ M425 MFP HP 42540 11$ 0.012 0.095 CITY OF CLEARWATER POLICE SUBSTATION700 BAYWAY BLVD Rental Mono MFP HP LJ M425 MFP HP 42540 11$ 0.012 0.095 CITY OF CLEARWATER OFFICE OF AGING1501 N BELCHER RD Rental Mono MFP HP LJ M426 MFP HP 42540 11$ 0.012 0.095 CITY OF CLEARWATER MARSHALL STREET1605 HARBOR DR Rental Mono MFP HP LJ M426 MFP HP 42540 11$ 0.012 0.095 CITY OF CLEARWATER PUBLIC UTILITIES1650 N ARCTURAS AVE Rental Mono MFP HP LJ M426 MFP HP 42540 11$ 0.012 0.095 CITY OF CLEARWATER SOLID WASTE1701 N HERCULES AVE Rental Mono MFP HP LJ M426 MFP HP 42540 11$ 0.012 0.095 CITY OF CLEARWATER GENERAL SERVICES1900 GRAND AVE Rental Mono MFP HP LJ M426 MFP HP 42540 11$ 0.012 0.095 CITY OF CLEARWATER MARINA25 CAUSEWAY BLVD Rental Mono MFP HP LJ M426 MFP HP 42540 11$ 0.012 0.095 CITY OF CLEARWATER COUNTRYSIDE LIBRARY2642 SABAL SPRINGS DR Rental Mono MFP HP LJ M426 MFP HP 42540 11$ 0.012 0.095 CITY OF CLEARWATER MOCCASIN LAKE PARK2750 PARK TRAIL LN Rental Mono MFP HP LJ M426 MFP HP 42540 11$ 0.012 0.095 CITY OF CLEARWATER CPD DISTRICT 32851 MCMULLEN BOOTH RDRental Mono MFP HP LJ M426 MFP HP 42540 11$ 0.012 0.095 CITY OF CLEARWATER EAST PLANT3141 GULF TO BAY BLVD Rental Mono MFP HP LJ M426 MFP HP 42540 11$ 0.012 0.095 CITY OF CLEARWATER WASTEWATER FACILITY3290 SR580 Rental Mono MFP HP LJ M426 MFP HP 42540 11$ 0.012 0.095 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Mono MFP HP LJ M426 MFP HP 42540 11$ 0.012 0.095 CITY OF CLEARWATER GAS SYSTEMS777 MAPLE ST Rental Mono MFP HP LJ M426 MFP HP 42540 11$ 0.012 0.095 CITY OF CLEARWATER N SATURN AVE901 N SATURN AVE Rental Mono MFP HP LJ M426 MFP HP 42540 11$ 0.012 0.095 CITY OF CLEARWATER MAIN LIBRARY100 N OSCEOLA AVE Rental Mono MFP HP LJ M428 MFP HP 42540 11$ 0.012 0.095 CITY OF CLEARWATER S MARTIN LUTHER KING1426 S MARTIN LUTHER KING AVERental Mono MFP HP LJ M428 MFP HP 42540 11$ 0.012 0.095 CITY OF CLEARWATER BEACH RECREATION CTR69 BAY ESPLANADE Rental Mono MFP HP LJ M428 MFP HP 42540 11$ 0.012 0.095 CITY OF CLEARWATER CPD DISTRICT 32851 MCMULLEN BOOTH RDRental Color Printer HP CLJ E45028 SERIES PRINTERHP 45028 11$ 0.012 0.095 CITY OF CLEARWATER ATTORNEY600 CLEVELAND ST Rental Color Printer HP CLJ E45028 SERIES PRINTERHP 45028 11$ 0.012 0.095 CITY OF CLEARWATER CLERKS OFFICE600 CLEVELAND ST STE 600 Rental Color Printer HP CLJ E45028 SERIES PRINTERHP 45028 11$ 0.012 0.095 CITY OF CLEARWATER CLERKS OFFICE600 CLEVELAND ST STE 600 Rental Color Printer HP CLJ E45028 SERIES PRINTERHP 45028 11$ 0.012 0.095 CITY OF CLEARWATER CITY HALL600 CLEVELAND ST STE 600 Rental Color Printer HP CLJ E45028 SERIES PRINTERHP 45028 11$ 0.012 0.095 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Color Printer HP CLJ E45028 SERIES PRINTERHP 45028 11$ 0.012 0.095 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Color Printer HP CLJ E45028 SERIES PRINTERHP 45028 11$ 0.012 0.095 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Color Printer HP CLJ E45028 SERIES PRINTERHP 45028 11$ 0.012 0.095 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Color Printer HP CLJ E45028 SERIES PRINTERHP 45028 11$ 0.012 0.095 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Color Printer HP CLJ E45028 SERIES PRINTERHP 45028 11$ 0.012 0.095 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Color Printer HP CLJ E45028 SERIES PRINTERHP 45028 11$ 0.012 0.095 CITY OF CLEARWATER POLICE SUBSTATION700 BAYWAY BLVD Rental Color Printer HP CLJ E45028 SERIES PRINTERHP 45028 11$ 0.012 0.095 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Color Printer HP CLJ M451 PRINTER HP 45028 11$ 0.012 0.095 CITY OF CLEARWATER PARK AND RECREATION1160 N SEMINOLE ST Rental Color Printer HP CLJ M452 PRINTER HP 45028 11$ 0.012 0.095 CITY OF CLEARWATER MARINA 25 CAUSEWAY BLVD Rental Color Printer HP CLJ M452 PRINTER HP 45028 11$ 0.012 0.095 CITY OF CLEARWATER PARKS AND REC ARMORY706 N MISSOURI AVE Rental Color Printer HP CLJ M452 PRINTER HP 45028 11$ 0.012 0.095 CITY OF CLEARWATER N GREENWOOD LIBRARY905 N MLK JR AVE Rental Color Printer HP CLJ M452 PRINTER HP 45028 11$ 0.012 0.095 CITY OF CLEARWATER FIRE STATION 451140 COURT ST, FIRE STATION 45Rental Color Printer HP CLJ M454 PRINTER HP 45028 11$ 0.012 0.095 CITY OF CLEARWATER PALMETTO1657 PALMETTO ST Rental Color Printer HP CLJ M454 PRINTER HP 45028 11$ 0.012 0.095 CITY OF CLEARWATER SOLID WASTE1701 N HERCULES AVE Rental Color Printer HP CLJ M454 PRINTER HP 45028 11$ 0.012 0.095 CITY OF CLEARWATER COUNTRYSIDE LIBRARY2642 SABAL SPRINGS DR Rental Color Printer HP CLJ M454 PRINTER HP 45028 11$ 0.012 0.095 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Color Printer HP CLJ M454 PRINTER HP 45028 11$ 0.012 0.095 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Color Printer HP CLJ M454 PRINTER HP 45028 11$ 0.012 0.095 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Color Printer HP CLJ M454 PRINTER HP 45028 11$ 0.012 0.095 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Color Printer HP CLJ M454 PRINTER HP 45028 11$ 0.012 0.095 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Color Printer HP CLJ M454 PRINTER HP 45028 11$ 0.012 0.095 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Color Printer HP CLJ M454 PRINTER HP 45028 11$ 0.012 0.095 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Color Printer HP CLJ M454 PRINTER HP 45028 11$ 0.012 0.095 CITY OF CLEARWATER FIRE STATION 451140 COURT ST, FIRE STATION 45Rental Color MFP HP CLJ E47528 HP 47528 16$ 0.012 0.095 CITY OF CLEARWATER MARSHALL STREET1605 HARBOR DR Rental Color MFP HP CLJ E47528 HP 47528 16$ 0.012 0.095 CITY OF CLEARWATER CFR TRAINING FACILITY1716 N BELCHER RD Rental Color MFP HP CLJ PRO M479FDN MFP HP 47528 16$ 0.012 0.095 CITY OF CLEARWATER CPD DISTRICT 32851 MCMULLEN BOOTH RDRental Color MFP HP CLJ PRO M479FDN MFP HP 47528 16$ 0.012 0.095 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Color MFP HP CLJ PRO M479FDN MFP HP 47528 16$ 0.012 0.095 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Color MFP HP CLJ PRO M479FDN MFP HP 47528 16$ 0.012 0.095 CITY OF CLEARWATER FINANCE DEPARTMENT100 S MYRTLE AVE F3 Rental Mono Printer HP LJ E50145 HP 50145 14$ 0.01 CITY OF CLEARWATER GENERAL SERVICES1900 GRAND AVE Rental Mono Printer HP LJ E50145 HP 50145 14$ 0.01 CITY OF CLEARWATER GAS SYSTEMS777 MAPLE ST Rental Mono Printer HP LJ M506 PRINTER HP 50145 14$ 0.01 CITY OF CLEARWATER GAS SYSTEMS777 MAPLE ST 1ST FL - SALES DEPTRental Mono Printer HP LJ M506 PRINTER HP 50145 14$ 0.01 CITY OF CLEARWATER FINANCE DEPARTMENT100 S MYRTLE AVE F3 Rental Mono Printer HP LJ M507 SERIES PRINTERSHP 50145 14$ 0.01 CITY OF CLEARWATER SOLID WASTE1701 N HERCULES AVE Customer Mono Printer HP LJ P3005 PRINTER HP 50145 14$ 0.01 CITY OF CLEARWATER FINANCE DEPARTMENT100 S MYRTLE AVE F3 Rental Mono Printer HP LJ P3015 PRINTER HP 50145 14$ 0.01 CITY OF CLEARWATER SOLID WASTE1701 N HERCULES AVE Rental Mono Printer HP LJ P4015 PRINTER HP 50145 14$ 0.01 CITY OF CLEARWATER S MYRTLE100 S MYRTLE Rental Mono MFP HP LJ E52645dn HP 52645 29$ 0.01 CITY OF CLEARWATER MCMULLEN TENNIS1000 EDENVILLE Rental Mono MFP HP LJ M521 MFP HP 52645 29$ 0.01 CITY OF CLEARWATER FIRE STATION 451140 COURT ST, FIRE STATION 45Rental Mono MFP HP LJ M521 MFP HP 52645 29$ 0.01 CITY OF CLEARWATER MARSHALL STREET1605 HARBOR DR Rental Mono MFP HP LJ M521 MFP HP 52645 29$ 0.01 CITY OF CLEARWATER LIBRARY2465 DREW ST Rental Mono MFP HP LJ M521 MFP HP 52645 29$ 0.01 CITY OF CLEARWATER MARINA25 CAUSEWAY BLVD Rental Mono MFP HP LJ M521 MFP HP 52645 29$ 0.01 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Mono MFP HP LJ M521 MFP HP 52645 29$ 0.01 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Mono MFP HP LJ M521 MFP HP 52645 29$ 0.01 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Mono MFP HP LJ M521 MFP HP 52645 29$ 0.01 CITY OF CLEARWATER S MYRTLE100 S MYRTLE Rental Mono MFP HP LJ M527 MFP HP 52645 29$ 0.01 CITY OF CLEARWATER PUBLIC WORKS28 N GARDEN AVE Rental Mono MFP HP LJ M527 MFP HP 52645 29$ 0.01 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Mono MFP HP LJ M527 MFP HP 52645 29$ 0.01 CITY OF CLEARWATER GAS SYSTEMS777 MAPLE ST Rental Mono MFP HP LJ M527 MFP HP 52645 29$ 0.01 CITY OF CLEARWATER GAS SYSTEMS777 MAPLE ST Rental Mono MFP HP LJ M527 MFP HP 52645 29$ 0.01 CITY OF CLEARWATER N GREENWOOD REC900 N MLK JR AVE Rental Mono MFP HP LJ M527 MFP HP 52645 29$ 0.01 CITY OF CLEARWATER S MYRTLE100 S MYRTLE Rental Mono MFP HP LJ M527 MFP HP 52645 29$ 0.01 CITY OF CLEARWATER 2741 SR 580 Rental Mono MFP HP LJ M528 HP 52645 29$ 0.01 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Mono MFP HP LJ M528 HP 52645 29$ 0.01 CITY OF CLEARWATER GAS SYSTEMS777 MAPLE ST Rental Mono MFP HP LJ M528 HP 52645 29$ 0.01 CITY OF CLEARWATER S MYRTLE100 S MYRTLE Rental Mono MFP HP LJ M528 HP 52645 29$ 0.01 CITY OF CLEARWATER MARINA25 CAUSEWAY BLVD Rental Mono Printer HP LJ 4350 PRINTER HP 60155 19$ 0.01 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Mono Printer HP LJ E60155 HP 60155 19$ 0.01 CITY OF CLEARWATER UTILITIES CUST SERVICE100 S MYRTLE AVE Rental Mono Printer HP LJ M602 PRINTER HP 60155 19$ 0.01 CITY OF CLEARWATER UTILITIES CUST SERVICE100 S MYRTLE AVE Rental Mono Printer HP LJ M602 PRINTER HP 60155 19$ 0.01 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Mono Printer HP LJ P2055 PRINTER HP 60155 19$ 0.01 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Customer Mono Printer HP LJ P2055 PRINTER HP 60155 19$ 0.01 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Mono Printer HP LJ P2055 PRINTER HP 60155 19$ 0.01 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Mono Printer HP LJ P2055 PRINTER HP 60155 19$ 0.01 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Customer Mono Printer HP LJ P2055 PRINTER HP 60155 19$ 0.01 CITY OF CLEARWATER FIRE STATION 44950 GULF BLVD Rental Mono Printer HP LJ P2055 PRINTER HP 60155 19$ 0.01 CITY OF CLEARWATER S MYRTLE100 S MYRTLE Rental Mono MFP HP LJ E626XX HP 62655 50$ 0.01 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Mono MFP HP LJ E626XX HP 62655 50$ 0.01 CITY OF CLEARWATER LONG CENTER1501 N BELCHER RD Rental Mono MFP HP LJ M630 MFP HP 62655 50$ 0.01 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Mono MFP HP LJ M631 MFP HP 62655 50$ 0.01 CITY OF CLEARWATER S MYRTLE100 S MYRTLE Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER S MYRTLE100 S MYRTLE Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER S MYRTLE100 S MYRTLE Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER S MYRTLE100 S MYRTLE Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER S MYRTLE100 S MYRTLE Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER S MYRTLE100 S MYRTLE Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER S MYRTLE100 S MYRTLE Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER FIRE STATION 451140 COURT ST, FIRE STATION 45Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER PARK & RECREATION1160 N SEMINOLE ST Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER LONG CENTER1501 N BELCHER RD Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER PUBLIC UTILITIES1650 N ARCTURAS AVE Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER PUBLIC UTILITIES1650 N ARCTURAS AVE Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER PUBLIC UTILITIES1650 N ARCTURAS AVE Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER PALMETTO1657 PALMETTO ST Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER GENERAL SERVICES1900 GRAND AVE Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 MORNINGSIDE RECREATION COMPLEX2400 HARN BLVD Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER MARINA25 CAUSEWAY BLVD Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER PARKS AND REC PBI507 VINE AVE Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER 509 EAST AVE S STE 227 Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER PENNSYLVANIA AVE510 PENNSYLAVANIA AVE Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER CLERKS OFFICE600 CLEVELAND ST STE 600 Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER CLERKS OFFICE600 CLEVELAND ST STE 600 Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER PARKS AND REC ARMORY706 N MISSOURI AVE Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER GAS SYSTEMS777 MAPLE ST Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER GAS SYSTEMS777 MAPLE ST Rental Mono MFP HP LJ M725 MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER MAIN LIBRARY100 N OSCEOLA AVE Rental Mono A3 MFP HP LJ MAN E731DN MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER PUBLIC UTILITIES1650 N ARCTURAS AVE Rental Mono A3 MFP HP LJ MAN E731DN MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER PUBLIC UTILITIES1650 N ARCTURAS AVE - BLDG GRental Mono A3 MFP HP LJ MAN E731DN MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER PUB UTIL RO2 PLANT21133 US HWY 19 N Rental Mono A3 MFP HP LJ MAN E731DN MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER CLERKS OFFICE600 CLEVELAND ST STE 600 Rental Mono A3 MFP HP LJ MAN E731DN MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER POLICE DEPT645 PIERCE ST Rental Mono A3 MFP HP LJ MAN E731DN MFP HP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER SOLID WASTE1701 N HERCULES AVE Rental Mono A3 MFP MONO LASERJET E725 SERIES MFPHP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER CFR TRAINING FACILITY1716 N BELCHER RD Rental Mono A3 MFP MONO LASERJET E725 SERIES MFPHP 731dn 70$ 0.009 0.055 CITY OF CLEARWATER S MYRTLE100 S MYRTLE Rental Color A3 MFP HP CLJ E783DN MFP PRINTERHP 78330dn 85$ 0.009 0.055 CITY OF CLEARWATER PLANNING100 S MYRTLE Rental Mono A3 MFP MONO LASERJET E825 SERIES MFPHP 826 88$ 0.009 0.055 CITY OF CLEARWATER GAS SYSTEMS777 MAPLE ST Rental Color Printer HP CLJ M855 Printer HP 85055 89$ 0.009 0.055 CITY OF CLEARWATER PLANNING100 S MYRTLE Rental Color A3 MFP HP CLJ E876 Series MFP HP 877dn 106$ 0.009 0.055 CITY OF CLEARWATER PLANNING100 S MYRTLE Rental Mono Printer HP LJ M712 Printer HP 85055 89$ 0.009 0.055 CITY OF CLEARWATER MAIN LIBRARY100 N OSCEOLA AVE Rental Color Printer HP CLJ M551 PRINTER HP x55745 21$ 0.01 0.075 CITY OF CLEARWATER LIBRARY2465 DREW ST Rental Color Printer HP CLJ M551 PRINTER HP x55745 21$ 0.01 0.075 CITY OF CLEARWATER PARKS AND REC PBI507 VINE AVE Rental Color Printer HP CLJ M551 PRINTER HP x55745 21$ 0.01 0.075 CITY OF CLEARWATER LONG CENTER1501 N BELCHER RD Rental Color Printer HP CLJ M553 PRINTER HP x55745 21$ 0.01 0.075 CITY OF CLEARWATER COUNTRYSIDE REC2640 SABAL SPRINGS DR Rental Color MFP HP CLJ E57540 HP x579 38$ 0.01 0.075 CITY OF CLEARWATER COMMUNITY REDEV CTR600 CLEVELAND ST STE 600 Rental Color MFP HP CLJ E57540 HP x579 38$ 0.01 0.075 CITY OF CLEARWATER GENERAL SERVICES1900 GRAND AVE Rental Color MFP HP CLJ M MFP X57945DN HP x579 38$ 0.01 0.075 Total 4,843$ Replacement Device Count of Replacement Device HP 731dn 34 HP 45028 28 HP 42540 21 HP 52645 20 HP 40040 13 HP 60155 10 HP 50145 8 HP 47528 6 HP x55745 4 HP 62655 4 HP x579 3 HP A3 Mono Printer 1 HP 78330dn 1 HP 85055 1 HP 826 1 HP 877dn 1 Grand Total 156 September 12, 2024 NOTICE OF INTENT TO AWARD The Selection Committee and the Procurement Division has shortlisted two (2) top ranked companies for RFP No. 56-24, Citywide Printer and Copier Services and proceeded to make an award recommendation to DEX Imaging LLC, dba Total Print USA LLC, the top-ranked company, for a period of one year with three (3), one (1) year renewal options. The two (2) ranked companies in order are as follows: 1. DEX Imaging LLC, dba Total Print USA LLC 2. HP, Inc. Negotiations will begin soon with the top ranked company. Should negotiations fail, the committee will move to the next ranked company on the list. This award recommendation will go before Council for approval in the near future. These meetings are held at the Clearwater Main Library, 100 N Osceola Ave, Clearwater, FL 33755. Inquiries regarding this Intent to Award can be directed to the City’s Procurement Analyst at (727) 444-7902, or mailed to City of Clearwater, Attn: Procurement Division, PO Box 4748, Clearwater, FL 33758-4748. Posted on this date by: Leslie Greve Leslie Greve Procurement Analyst TotalPrint USA | 5100 West Cypress Street Tampa, Florida 33609 | Phone 855-915-1300 info@totalprintusa.com | www.totalprintusa.com Exhibit A Current City Location for Equipment Address Model Class Description Equipment Description Replacement Device Lease Price (All Inclusive) CPC Mono CPC Color CITY OF CLEARWATER GENERAL SERVICES 1900 GRAND AVE Rental Mono Printer HP LJ 1320 PRINTER HP 40040 $7 0.012 0.095 CITY OF CLEARWATER FIRE STATION 46 546 MANDALAY AVE Rental Mono Printer HP LJ M401 PRINTER HP 40040 $7 0.012 0.095 CITY OF CLEARWATER UTILITIES CUST SERVICE 100 S MYRTLE AVE Rental Mono Printer HP LJ M402 PRINTER HP 40040 $7 0.012 0.095 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Mono Printer HP LJ M402 PRINTER HP 40040 $7 0.012 0.095 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Mono Printer HP LJ M402 PRINTER HP 40040 $7 0.012 0.095 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Mono Printer HP LJ M402 PRINTER HP 40040 $7 0.012 0.095 CITY OF CLEARWATER HUMAN RESOURCES 100 S MYRTLE AVE Rental Mono Printer HP LJ M404 PRINTER HP 40040 $7 0.012 0.095 CITY OF CLEARWATER FIRE STATION 48 1700 N BELCHER RD Rental Mono Printer HP LJ M404 PRINTER HP 40040 $7 0.012 0.095 CITY OF CLEARWATER PUB UTIL RO2 PLANT 21133 US HWY 19 N Rental Mono Printer HP LJ M404 PRINTER HP 40040 $7 0.012 0.095 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Mono Printer HP LJ M404 PRINTER HP 40040 $7 0.012 0.095 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Mono Printer HP LJ M404 PRINTER HP 40040 $7 0.012 0.095 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Mono Printer HP LJ M404 PRINTER HP 40040 $7 0.012 0.095 CITY OF CLEARWATER GAS SYSTEMS 777 MAPLE ST Rental Mono Printer HP LJ M404 PRINTER HP 40040 $7 0.012 0.095 CITY OF CLEARWATER S MYRTLE 100 S MYRTLE AVE F1 Rental Mono MFP HP LJ E42540 HP 42540 $11 0.012 0.095 CITY OF CLEARWATER FIRE STATION 45 1140 COURT ST, FIRE STATION 45 Rental Mono MFP HP LJ E42540 HP 42540 $11 0.012 0.095 CITY OF CLEARWATER PUBLIC UTILITIES 1650 N ARCTURAS AVE Rental Mono MFP HP LJ M425 MFP HP 42540 $11 0.012 0.095 CITY OF CLEARWATER POLICE SUBSTATION 700 BAYWAY BLVD Rental Mono MFP HP LJ M425 MFP HP 42540 $11 0.012 0.095 CITY OF CLEARWATER OFFICE OF AGING 1501 N BELCHER RD Rental Mono MFP HP LJ M426 MFP HP 42540 $11 0.012 0.095 CITY OF CLEARWATER MARSHALL STREET 1605 HARBOR DR Rental Mono MFP HP LJ M426 MFP HP 42540 $11 0.012 0.095 CITY OF CLEARWATER PUBLIC UTILITIES 1650 N ARCTURAS AVE Rental Mono MFP HP LJ M426 MFP HP 42540 $11 0.012 0.095 CITY OF CLEARWATER SOLID WASTE 1701 N HERCULES AVE Rental Mono MFP HP LJ M426 MFP HP 42540 $11 0.012 0.095 CITY OF CLEARWATER GENERAL SERVICES 1900 GRAND AVE Rental Mono MFP HP LJ M426 MFP HP 42540 $11 0.012 0.095 CITY OF CLEARWATER MARINA 25 CAUSEWAY BLVD Rental Mono MFP HP LJ M426 MFP HP 42540 $11 0.012 0.095 TotalPrint USA | 5100 West Cypress Street Tampa, Florida 33609 | Phone 855-915-1300 info@totalprintusa.com | www.totalprintusa.com CITY OF CLEARWATER COUNTRYSIDE LIBRARY 2642 SABAL SPRINGS DR Rental Mono MFP HP LJ M426 MFP HP 42540 $11 0.012 0.095 CITY OF CLEARWATER MOCCASIN LAKE PARK 2750 PARK TRAIL LN Rental Mono MFP HP LJ M426 MFP HP 42540 $11 0.012 0.095 CITY OF CLEARWATER CPD DISTRICT 3 2851 MCMULLEN BOOTH RD Rental Mono MFP HP LJ M426 MFP HP 42540 $11 0.012 0.095 CITY OF CLEARWATER EAST PLANT 3141 GULF TO BAY BLVD Rental Mono MFP HP LJ M426 MFP HP 42540 $11 0.012 0.095 CITY OF CLEARWATER WASTEWATER FACILITY 3290 SR580 Rental Mono MFP HP LJ M426 MFP HP 42540 $11 0.012 0.095 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Mono MFP HP LJ M426 MFP HP 42540 $11 0.012 0.095 CITY OF CLEARWATER GAS SYSTEMS 777 MAPLE ST Rental Mono MFP HP LJ M426 MFP HP 42540 $11 0.012 0.095 CITY OF CLEARWATER N SATURN AVE 901 N SATURN AVE Rental Mono MFP HP LJ M426 MFP HP 42540 $11 0.012 0.095 CITY OF CLEARWATER MAIN LIBRARY 100 N OSCEOLA AVE Rental Mono MFP HP LJ M428 MFP HP 42540 $11 0.012 0.095 CITY OF CLEARWATER S MARTIN LUTHER KING 1426 S MARTIN LUTHER KING AVE Rental Mono MFP HP LJ M428 MFP HP 42540 $11 0.012 0.095 CITY OF CLEARWATER BEACH RECREATION CTR 69 BAY ESPLANADE Rental Mono MFP HP LJ M428 MFP HP 42540 $11 0.012 0.095 CITY OF CLEARWATER CPD DISTRICT 3 2851 MCMULLEN BOOTH RD Rental Color Printer HP CLJ E45028 SERIES PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER ATTORNEY 600 CLEVELAND ST Rental Color Printer HP CLJ E45028 SERIES PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER CLERKS OFFICE 600 CLEVELAND ST STE 600 Rental Color Printer HP CLJ E45028 SERIES PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER CLERKS OFFICE 600 CLEVELAND ST STE 600 Rental Color Printer HP CLJ E45028 SERIES PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER CITY HALL 600 CLEVELAND ST STE 600 Rental Color Printer HP CLJ E45028 SERIES PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Color Printer HP CLJ E45028 SERIES PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Color Printer HP CLJ E45028 SERIES PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Color Printer HP CLJ E45028 SERIES PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Color Printer HP CLJ E45028 SERIES PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Color Printer HP CLJ E45028 SERIES PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Color Printer HP CLJ E45028 SERIES PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER POLICE SUBSTATION 700 BAYWAY BLVD Rental Color Printer HP CLJ E45028 SERIES PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Color Printer HP CLJ M451 PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER PARK AND RECREATION 1160 N SEMINOLE ST Rental Color Printer HP CLJ M452 PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER MARINA 25 CAUSEWAY BLVD Rental Color Printer HP CLJ M452 PRINTER HP 45028 $11 0.012 0.095 TotalPrint USA | 5100 West Cypress Street Tampa, Florida 33609 | Phone 855-915-1300 info@totalprintusa.com | www.totalprintusa.com CITY OF CLEARWATER PARKS AND REC ARMORY 706 N MISSOURI AVE Rental Color Printer HP CLJ M452 PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER N GREENWOOD LIBRARY 905 N MLK JR AVE Rental Color Printer HP CLJ M452 PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER FIRE STATION 45 1140 COURT ST, FIRE STATION 45 Rental Color Printer HP CLJ M454 PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER PALMETTO 1657 PALMETTO ST Rental Color Printer HP CLJ M454 PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER SOLID WASTE 1701 N HERCULES AVE Rental Color Printer HP CLJ M454 PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER COUNTRYSIDE LIBRARY 2642 SABAL SPRINGS DR Rental Color Printer HP CLJ M454 PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Color Printer HP CLJ M454 PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Color Printer HP CLJ M454 PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Color Printer HP CLJ M454 PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Color Printer HP CLJ M454 PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Color Printer HP CLJ M454 PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Color Printer HP CLJ M454 PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Color Printer HP CLJ M454 PRINTER HP 45028 $11 0.012 0.095 CITY OF CLEARWATER FIRE STATION 45 1140 COURT ST, FIRE STATION 45 Rental Color MFP HP CLJ E47528 HP 47528 $16 0.012 0.095 CITY OF CLEARWATER MARSHALL STREET 1605 HARBOR DR Rental Color MFP HP CLJ E47528 HP 47528 $16 0.012 0.095 CITY OF CLEARWATER CFR TRAINING FACILITY 1716 N BELCHER RD Rental Color MFP HP CLJ PRO M479FDN MFP HP 47528 $16 0.012 0.095 CITY OF CLEARWATER CPD DISTRICT 3 2851 MCMULLEN BOOTH RD Rental Color MFP HP CLJ PRO M479FDN MFP HP 47528 $16 0.012 0.095 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Color MFP HP CLJ PRO M479FDN MFP HP 47528 $16 0.012 0.095 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Color MFP HP CLJ PRO M479FDN MFP HP 47528 $16 0.012 0.095 CITY OF CLEARWATER FINANCE DEPARTMENT 100 S MYRTLE AVE F3 Rental Mono Printer HP LJ E50145 HP 50145 $14 0.01 CITY OF CLEARWATER GENERAL SERVICES 1900 GRAND AVE Rental Mono Printer HP LJ E50145 HP 50145 $14 0.01 CITY OF CLEARWATER GAS SYSTEMS 777 MAPLE ST Rental Mono Printer HP LJ M506 PRINTER HP 50145 $14 0.01 CITY OF CLEARWATER GAS SYSTEMS 777 MAPLE ST 1ST FL - SALES DEPT Rental Mono Printer HP LJ M506 PRINTER HP 50145 $14 0.01 CITY OF CLEARWATER FINANCE DEPARTMENT 100 S MYRTLE AVE F3 Rental Mono Printer HP LJ M507 SERIES PRINTERS HP 50145 $14 0.01 CITY OF CLEARWATER SOLID WASTE 1701 N HERCULES AVE Customer Mono Printer HP LJ P3005 PRINTER HP 50145 $14 0.01 CITY OF CLEARWATER FINANCE DEPARTMENT 100 S MYRTLE AVE F3 Rental Mono Printer HP LJ P3015 PRINTER HP 50145 $14 0.01 TotalPrint USA | 5100 West Cypress Street Tampa, Florida 33609 | Phone 855-915-1300 info@totalprintusa.com | www.totalprintusa.com CITY OF CLEARWATER SOLID WASTE 1701 N HERCULES AVE Rental Mono Printer HP LJ P4015 PRINTER HP 50145 $14 0.01 CITY OF CLEARWATER S MYRTLE 100 S MYRTLE Rental Mono MFP HP LJ E52645dn HP 52645 $29 0.01 CITY OF CLEARWATER MCMULLEN TENNIS 1000 EDENVILLE Rental Mono MFP HP LJ M521 MFP HP 52645 $29 0.01 CITY OF CLEARWATER FIRE STATION 45 1140 COURT ST, FIRE STATION 45 Rental Mono MFP HP LJ M521 MFP HP 52645 $29 0.01 CITY OF CLEARWATER MARSHALL STREET 1605 HARBOR DR Rental Mono MFP HP LJ M521 MFP HP 52645 $29 0.01 CITY OF CLEARWATER LIBRARY 2465 DREW ST Rental Mono MFP HP LJ M521 MFP HP 52645 $29 0.01 CITY OF CLEARWATER MARINA 25 CAUSEWAY BLVD Rental Mono MFP HP LJ M521 MFP HP 52645 $29 0.01 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Mono MFP HP LJ M521 MFP HP 52645 $29 0.01 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Mono MFP HP LJ M521 MFP HP 52645 $29 0.01 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Mono MFP HP LJ M521 MFP HP 52645 $29 0.01 CITY OF CLEARWATER S MYRTLE 100 S MYRTLE Rental Mono MFP HP LJ M527 MFP HP 52645 $29 0.01 CITY OF CLEARWATER PUBLIC WORKS 28 N GARDEN AVE Rental Mono MFP HP LJ M527 MFP HP 52645 $29 0.01 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Mono MFP HP LJ M527 MFP HP 52645 $29 0.01 CITY OF CLEARWATER GAS SYSTEMS 777 MAPLE ST Rental Mono MFP HP LJ M527 MFP HP 52645 $29 0.01 CITY OF CLEARWATER GAS SYSTEMS 777 MAPLE ST Rental Mono MFP HP LJ M527 MFP HP 52645 $29 0.01 CITY OF CLEARWATER N GREENWOOD REC 900 N MLK JR AVE Rental Mono MFP HP LJ M527 MFP HP 52645 $29 0.01 CITY OF CLEARWATER S MYRTLE 100 S MYRTLE Rental Mono MFP HP LJ M527 MFP HP 52645 $29 0.01 CITY OF CLEARWATER 2741 SR 580 Rental Mono MFP HP LJ M528 HP 52645 $29 0.01 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Mono MFP HP LJ M528 HP 52645 $29 0.01 CITY OF CLEARWATER GAS SYSTEMS 777 MAPLE ST Rental Mono MFP HP LJ M528 HP 52645 $29 0.01 CITY OF CLEARWATER S MYRTLE 100 S MYRTLE Rental Mono MFP HP LJ M528 HP 52645 $29 0.01 CITY OF CLEARWATER MARINA 25 CAUSEWAY BLVD Rental Mono Printer HP LJ 4350 PRINTER HP 60155 $19 0.01 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Mono Printer HP LJ E60155 HP 60155 $19 0.01 CITY OF CLEARWATER UTILITIES CUST SERVICE 100 S MYRTLE AVE Rental Mono Printer HP LJ M602 PRINTER HP 60155 $19 0.01 CITY OF CLEARWATER UTILITIES CUST SERVICE 100 S MYRTLE AVE Rental Mono Printer HP LJ M602 PRINTER HP 60155 $19 0.01 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Mono Printer HP LJ P2055 PRINTER HP 60155 $19 0.01 TotalPrint USA | 5100 West Cypress Street Tampa, Florida 33609 | Phone 855-915-1300 info@totalprintusa.com | www.totalprintusa.com CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Customer Mono Printer HP LJ P2055 PRINTER HP 60155 $19 0.01 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Mono Printer HP LJ P2055 PRINTER HP 60155 $19 0.01 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Mono Printer HP LJ P2055 PRINTER HP 60155 $19 0.01 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Customer Mono Printer HP LJ P2055 PRINTER HP 60155 $19 0.01 CITY OF CLEARWATER FIRE STATION 44 950 GULF BLVD Rental Mono Printer HP LJ P2055 PRINTER HP 60155 $19 0.01 CITY OF CLEARWATER S MYRTLE 100 S MYRTLE Rental Mono MFP HP LJ E626XX HP 62655 $50 0.01 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Mono MFP HP LJ E626XX HP 62655 $50 0.01 CITY OF CLEARWATER LONG CENTER 1501 N BELCHER RD Rental Mono MFP HP LJ M630 MFP HP 62655 $50 0.01 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Mono MFP HP LJ M631 MFP HP 62655 $50 0.01 CITY OF CLEARWATER S MYRTLE 100 S MYRTLE Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER S MYRTLE 100 S MYRTLE Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER S MYRTLE 100 S MYRTLE Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER S MYRTLE 100 S MYRTLE Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER S MYRTLE 100 S MYRTLE Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER S MYRTLE 100 S MYRTLE Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER S MYRTLE 100 S MYRTLE Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER FIRE STATION 45 1140 COURT ST, FIRE STATION 45 Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER PARK & RECREATION 1160 N SEMINOLE ST Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER LONG CENTER 1501 N BELCHER RD Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER PUBLIC UTILITIES 1650 N ARCTURAS AVE Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER PUBLIC UTILITIES 1650 N ARCTURAS AVE Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER PUBLIC UTILITIES 1650 N ARCTURAS AVE Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER PALMETTO 1657 PALMETTO ST Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER GENERAL SERVICES 1900 GRAND AVE Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 MORNINGSIDE RECREATION COMPLEX 2400 HARN BLVD Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER MARINA 25 CAUSEWAY BLVD Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 TotalPrint USA | 5100 West Cypress Street Tampa, Florida 33609 | Phone 855-915-1300 info@totalprintusa.com | www.totalprintusa.com CITY OF CLEARWATER PARKS AND REC PBI 507 VINE AVE Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER 509 EAST AVE S STE 227 Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER PENNSYLVANIA AVE 510 PENNSYLAVANIA AVE Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER CLERKS OFFICE 600 CLEVELAND ST STE 600 Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER CLERKS OFFICE 600 CLEVELAND ST STE 600 Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER PARKS AND REC ARMORY 706 N MISSOURI AVE Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER GAS SYSTEMS 777 MAPLE ST Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER GAS SYSTEMS 777 MAPLE ST Rental Mono MFP HP LJ M725 MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER MAIN LIBRARY 100 N OSCEOLA AVE Rental Mono A3 MFP HP LJ MAN E731DN MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER PUBLIC UTILITIES 1650 N ARCTURAS AVE Rental Mono A3 MFP HP LJ MAN E731DN MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER PUBLIC UTILITIES 1650 N ARCTURAS AVE - BLDG G Rental Mono A3 MFP HP LJ MAN E731DN MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER PUB UTIL RO2 PLANT 21133 US HWY 19 N Rental Mono A3 MFP HP LJ MAN E731DN MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER CLERKS OFFICE 600 CLEVELAND ST STE 600 Rental Mono A3 MFP HP LJ MAN E731DN MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER POLICE DEPT 645 PIERCE ST Rental Mono A3 MFP HP LJ MAN E731DN MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER SOLID WASTE 1701 N HERCULES AVE Rental Mono A3 MFP MONO LASERJET E725 SERIES MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER CFR TRAINING FACILITY 1716 N BELCHER RD Rental Mono A3 MFP MONO LASERJET E725 SERIES MFP HP 731dn $70 0.009 0.055 CITY OF CLEARWATER S MYRTLE 100 S MYRTLE Rental Color A3 MFP HP CLJ E783DN MFP PRINTER HP 78330dn $85 0.009 0.055 CITY OF CLEARWATER PLANNING 100 S MYRTLE Rental Mono A3 MFP MONO LASERJET E825 SERIES MFP HP 826 $88 0.009 0.055 CITY OF CLEARWATER GAS SYSTEMS 777 MAPLE ST Rental Color Printer HP CLJ M855 Printer HP 85055 $89 0.009 0.055 CITY OF CLEARWATER PLANNING 100 S MYRTLE Rental Color A3 MFP HP CLJ E876 Series MFP HP 877dn $106 0.009 0.055 CITY OF CLEARWATER PLANNING 100 S MYRTLE Rental Mono Printer HP LJ M712 Printer HP 85055 $89 0.009 0.055 CITY OF CLEARWATER MAIN LIBRARY 100 N OSCEOLA AVE Rental Color Printer HP CLJ M551 PRINTER HP x55745 $21 0.01 0.075 CITY OF CLEARWATER LIBRARY 2465 DREW ST Rental Color Printer HP CLJ M551 PRINTER HP x55745 $21 0.01 0.075 CITY OF CLEARWATER PARKS AND REC PBI 507 VINE AVE Rental Color Printer HP CLJ M551 PRINTER HP x55745 $21 0.01 0.075 CITY OF CLEARWATER LONG CENTER 1501 N BELCHER RD Rental Color Printer HP CLJ M553 PRINTER HP x55745 $21 0.01 0.075 TotalPrint USA | 5100 West Cypress Street Tampa, Florida 33609 | Phone 855-915-1300 info@totalprintusa.com | www.totalprintusa.com CITY OF CLEARWATER COUNTRYSIDE REC 2640 SABAL SPRINGS DR Rental Color MFP HP CLJ E57540 HP x579 $38 0.01 0.075 CITY OF CLEARWATER COMMUNITY REDEV CTR 600 CLEVELAND ST STE 600 Rental Color MFP HP CLJ E57540 HP x579 $38 0.01 0.075 CITY OF CLEARWATER GENERAL SERVICES 1900 GRAND AVE Rental Color MFP HP CLJ M MFP X57945DN HP x579 $38 0.01 0.075 STANDARD TERMS AND CONDITIONS S.1 DEFINITIONS. Uses of the following terms are interchangeable as referenced: “vendor, contractor, supplier, proposer, company, parties, persons”, “purchase order, PO, contract, agreement”, “city, Clearwater, agency, requestor, parties”, “bid, proposal, response, quote”. S.2 INDEPENDENT CONTRACTOR. It is expressly understood that the relationship of Contractor to the City will be that of an independent contractor. Contractor and all persons employed by Contractor, either directly or indirectly, are Contractor’s employees, not City employees. Accordingly, Contractor and Contractor’s employees are not entitled to any benefits provided to City employees including, but not limited to, health benefits, enrollment in a retirement system, paid time off or other rights afforded City employees. Contractor employees will not be regarded as City employees or agents for any purpose, including the payment of unemployment or workers’ compensation. If any Contractor employees or subcontractors assert a claim for wages or other employment benefits against the City, Contractor will defend, indemnify and hold harmless the City from all such claims. S.3 SUBCONTRACTING. Contractor may not subcontract work under this Agreement without the express written permission of the City. If Contractor has received authorization to subcontract work, it is agreed that all subcontractors performing work under the Agreement must comply with its provisions. Further, all agreements between Contractor and its subcontractors must provide that the terms and conditions of this Agreement be incorporated therein. S.4 ASSIGNMENT. This Agreement may not be assigned either in whole or in part without first receiving the City’s written consent. Any attempted assignment, either in whole or in part, without such consent will be null and void and in such event the City will have the right at its option to terminate the Agreement. No granting of consent to any assignment will relieve Contractor from any of its obligations and liabilities under the Agreement. S.5 SUCCESSORS AND ASSIGNS, BINDING EFFECT. This Agreement will be binding upon and inure to the benefit of the parties and their respective permitted successors and assigns. S.6 NO THIRD-PARTY BENEFICIARIES. This Agreement is intended for the exclusive benefit of the parties. Nothing set forth in this Agreement is intended to create, or will create any benefits, rights, or responsibilities in any third parties. S.7 NON- EXCLUSIVITY. The City, in its sole discretion, reserves the right to request the materials or services set forth herein from other sources when deemed necessary and appropriate. No exclusive rights are encompassed through this Agreement. S.8 AMENDMENTS. There will be no oral changes to this Agreement. This Agreement can only be modified in a writing signed by both parties. No charge for extra work or material will be allowed unless approved in writing, in advance, by the City and Contractor. S.9 TIME OF THE ESSENCE. Time is of the essence to the performance of the parties’ obligations under this Agreement. S.10 COMPLIANCE WITH APPLICABLE LAWS. a. General. Contractor must procure all permits and licenses and pay all charges and fees necessary and incidental to the lawful conduct of business. Contractor must stay fully informed of existing and future federal, state, and local laws, ordinances, and regulations that in any manner affect the fulfillment of this Agreement and must comply with the same at its own expense. Contractor bears full responsibility for training, safety, and providing necessary equipment for all Contractor personnel to achieve throughout the term of the Agreement. Upon request, Contractor will demonstrate to the City's satisfaction any programs, procedures, and other activities used to ensure compliance. b. Drug-Free Workplace. Contractor is hereby advised that the City has adopted a policy establishing a drug-free workplace for itself and those doing business with the City to ensure the safety and health of all persons working on City contracts and projects. Contractor will require a drug-free workplace for all Contractor personnel working under this Agreement. Specifically, all Contractor personnel who are working under this Agreement must be notified in writing by Contractor that they are prohibited from the manufacture, distribution, dispensation, possession, or unlawful use of a controlled substance in the workplace. STANDARD TERMS AND CONDITIONS Contractor agrees to prohibit the use of intoxicating substances by all Contractor personnel, and will ensure that Contractor personnel do not use or possess illegal drugs while in the course of performing their duties. c. Federal and State Immigration Laws. Contractor agrees to comply with the Immigration Reform and Control Act of 1986 (IRCA) in performance under this Agreement and to permit the City and its agents to inspect applicable personnel records to verify such compliance as permitted by law. Contractor will ensure and keep appropriate records to demonstrate that all Contractor personnel have a legal right to live and work in the United States. (i) As applicable to Contractor, under this provision, Contractor hereby warrants to the City that Contractor and each of its subcontractors will comply with, and are contractually obligated to comply with, all federal immigration laws and regulations that relate to their employees (hereinafter “Contractor Immigration Warranty”). (ii) A breach of the Contractor Immigration Warranty will constitute as a material breach of this Agreement and will subject Contractor to penalties up to and including termination of this Agreement at the sole discretion of the City. (iii) The City retains the legal right to inspect the papers of all Contractor personnel who provide services under this Agreement to ensure that Contractor or its subcontractors are complying with the Contractor Immigration Warranty. Contractor agrees to assist the City in regard to any such inspections. (iv) The City may, at its sole discretion, conduct random verification of the employment records of Contractor and any subcontractor to ensure compliance with the Contractor Immigration Warranty. Contractor agrees to assist the City in regard to any random verification performed. (v) Neither Contractor nor any subcontractor will be deemed to have materially breached the Contractor Immigration Warranty if Contractor or subcontractor establishes that it has complied with the employment verification provisions prescribed by Sections 274A and 274B of the Federal Immigration and Nationality Act. d. Nondiscrimination. Contractor represents and warrants that it does not discriminate against any employee or applicant for employment or person to whom it provides services because of race, color, religion, sex, national origin, or disability, and represents and warrants that it complies with all applicable federal, state, and local laws and executive orders regarding employment. Contractor and Contractor’s personnel will comply with applicable provisions of Title VII of the U.S. Civil Rights Act of 1964, as amended, Section 504 of the Federal Rehabilitation Act, the Americans with Disabilities Act (42 U.S.C. § 12101 et seq.), and applicable rules in performance under this Agreement. S.11 SALES/USE TAX, OTHER TAXES. a. Contractor is responsible for the payment of all taxes including federal, state, and local taxes related to or arising out of Contractor’s services under this Agreement, including by way of illustration but not limitation, federal and state income tax, Social Security tax, unemployment insurance taxes, and any other taxes or business license fees as required. If any taxing authority should deem Contractor or Contractor employees an employee of the City, or should otherwise claim the City is liable for the payment of taxes that are Contractor’s responsibility under this Agreement, Contractor will indemnify the City for any tax liability, interest, and penalties imposed upon the City. b. The City is exempt from paying state and local sales/use taxes and certain federal excise taxes and will furnish an exemption certificate upon request. S.12 AMOUNTS DUE THE CITY. Contractor must be current and remain current in all obligations due to the City during the performance of services under the Agreement. Payments to Contractor may be offset by any delinquent amounts due the City or fees and charges owed to the City. S.13 OPENNESS OF PROCUREMENT PROCESS. Written competitive proposals, replies, oral presentations, meetings where vendors answer questions, other submissions, correspondence, STANDARD TERMS AND CONDITIONS and all records made thereof, as well as negotiations or meetings where negotiation strategies are discussed, conducted pursuant to this RFP, shall be handled in compliance with Chapters 119 and 286, Florida Statutes. Proposals or replies received by the City pursuant to this RFP are exempt from public disclosure until such time that the City provides notice of an intended decision or until 30 days after opening the proposals, whichever is earlier. If the City rejects all proposals or replies pursuant to this RFP and provides notice of its intent to reissue the RFP, then the rejected proposals or replies remain exempt from public disclosure until such time that the City provides notice of an intended decision concerning the reissued RFP or until the City withdraws the reissued RFP. A proposal or reply shall not be exempt from public disclosure longer than 12 months after the initial City notice rejecting all proposals or replies. Oral presentations, meetings where vendors answer questions, or meetings convened by City staff to discuss negotiation strategies, if any, shall be closed to the public (and other proposers) in compliance with Chapter 286 Florida Statutes. A complete recording shall be made of such closed meeting. The recording of, and any records presented at, the exempt meeting shall be available to the public when the City provides notice of an intended decision or until 30 days after opening proposals or final replies, whichever occurs first. If the City rejects all proposals or replies pursuant to this RFP and provides notice of its intent to reissue the RFP, then the recording and any records presented at the exempt meeting remain exempt from public disclosure until such time that the City provides notice of an intended decision concerning the reissued RFP or until the City withdraws the reissued RFP. A recording and any records presented at an exempt meeting shall not be exempt from public disclosure longer than 12 months after the initial City notice rejecting all proposals or replies. In addition to all other contract requirements as provided by law, the contractor executing this agreement agrees to comply with public records law. IF THE CONTRACTOR HAS QUESTIONS REGARDING THE APPLICATION OF CHAPTER 119, FLORIDA STATUTES, TO THE CONTRACTOR’S DUTY TO PROVIDE PUBLIC RECORDS RELATING TO THIS CONTRACT, CONTACT THE CUSTODIAN OF PUBLIC RECORDS, Rosemarie Call, phone: 727-562-4092 or Rosemarie.Call@myclearwater.com, 600 Cleveland Street, Suite 600, Clearwater, FL 33755. The contractor’s agreement to comply with public records law applies specifically to: a) Keep and maintain public records required by the City of Clearwater (hereinafter “public agency”) to perform the service being provided by the contractor hereunder. b) Upon request from the public agency’s custodian of public records, provide the public agency with a copy of the requested records or allow the records to be inspected or copied within a reasonable time at a cost that does not exceed the cost provided for in Chapter 119, Florida Statutes, as may be amended from time to time, or as otherwise provided by law. c) Ensure that the public records that are exempt or confidential and exempt from public records disclosure requirements are not disclosed except as authorized by law for the duration of the contract term and following completion of the contract if the contractor does not transfer the records to the public agency. d) Upon completion of the contract, transfer, at no cost, to the public agency all public records in possession of the contractor or keep and maintain public records required by the public agency to perform the service. If the contractor transfers all public records to the public agency upon completion of the contract, the contractor shall destroy any duplicate public records that are exempt or confidential and exempt from public records disclosure requirements. If the contractor keeps and maintains public records upon completion of the contract, the contractor shall meet all applicable requirements for retaining public records. All records stored electronically must be provided to the public agency, upon request from the public agency’s STANDARD TERMS AND CONDITIONS custodian of public records, in a format that is compatible with the information technology systems of the public agency. e) A request to inspect or copy public records relating to a public agency’s contract for services must be made directly to the public agency. If the public agency does not possess the requested records, the public agency shall immediately notify the contractor of the request and the contractor must provide the records to the public agency or allow the records to be inspected or copied within a reasonable time. f) The contractor hereby acknowledges and agrees that if the contractor does not comply with the public agency’s request for records, the public agency shall enforce the contract provisions in accordance with the contract. g) A contractor who fails to provide the public records to the public agency within a reasonable time may be subject to penalties under Section 119.10, Florida Statutes. h) If a civil action is filed against a contractor to compel production of public records relating to a public agency’s contract for services, the court shall assess and award against the contractor the reasonable costs of enforcement, including reasonable attorney fees, if: 1. The court determines that the contractor unlawfully refused to comply with the public records request within a reasonable time; and 2. At least eight (8) business days before filing the action, the plaintiff provided written notice of the public records request, including a statement that the contractor has not complied with the request, to the public agency and to the contractor. i) A notice complies with subparagraph (h)2. if it is sent to the public agency’s custodian of public records and to the contractor at the contractor’s address listed on its contract with the public agency or to the contractor’s registered agent. Such notices must be sent by common carrier delivery service or by registered, Global Express Guaranteed, or certified mail, with postage or shipping paid by the sender and with evidence of delivery, which may be in an electronic format. A contractor who complies with a public records request within 8 business days after the notice is sent is not liable for the reasonable costs of enforcement. S.14 AUDITS AND RECORDS. Contractor must preserve the records related to this Agreement for five (5) years after completion of the Agreement. The City or its authorized agent reserves the right to inspect any records related to the performance of work specified herein. In addition, the City may inspect any and all payroll, billing or other relevant records kept by Contractor in relation to the Agreement. Contractor will permit such inspections and audits during normal business hours and upon reasonable notice by the City. The audit of records may occur at Contractor’s place of business or at City offices, as determined by the City. S.15 BACKGROUND CHECK. The City may conduct criminal, driver history, and all other requested background checks of Contractor personnel who would perform services under the Agreement or who will have access to the City’s information, data, or facilities in accordance with the City’s current background check policies. Any officer, employee, or agent that fails the background check must be replaced immediately for any reasonable cause not prohibited by law. S.16 SECURITY CLEARANCE AND REMOVAL OF CONTRACTOR PERSONNEL. The City will have final authority, based on security reasons: (i) to determine when security clearance of Contractor personnel is required; (ii) to determine the nature of the security clearance, up to and including fingerprinting Contractor personnel; and (iii) to determine whether or not any individual or entity may provide services under this Agreement. If the City objects to any Contractor personnel for any reasonable cause not prohibited by law, then Contractor will, upon notice from the City, remove any such individual from performance of services under this Agreement. STANDARD TERMS AND CONDITIONS S.17 DEFAULT. a. A party will be in default if that party: (i) Is or becomes insolvent or is a party to any voluntary bankruptcy or receivership proceeding, makes an assignment for a creditor, or there is any similar action that affects Contractor’s capability to perform under the Agreement; (ii) Is the subject of a petition for involuntary bankruptcy not removed within sixty (60) calendar days; (iii) Conducts business in an unethical manner or in an illegal manner; or (iv) Fails to carry out any term, promise, or condition of the Agreement. b. Contractor will be in default of this Agreement if Contractor is debarred from participating in City procurements and solicitations in accordance with Section 27 of the City’s Purchasing and Procedures Manual. c. Notice and Opportunity to Cure. In the event a party is in default then the other party may, at its option and at any time, provide written notice to the defaulting party of the default. The defaulting party will have thirty (30) days from receipt of the notice to cure the default; the thirty (30) day cure period may be extended by mutual agreement of the parties, but no cure period may exceed ninety (90) days. A default notice will be deemed to be sufficient if it is reasonably calculated to provide notice of the nature and extent of such default. Failure of the non- defaulting party to provide notice of the default does not waive any rights under the Agreement. d. Anticipatory Repudiation. Whenever the City in good faith has reason to question Contractor’s intent or ability to perform, the City may demand that Contractor give a written assurance of its intent and ability to perform. In the event that the demand is made and no written assurance is given within five (5) calendar days, the City may treat this failure as an anticipatory repudiation of the Agreement. S.18 REMEDIES. The remedies set forth in this Agreement are not exclusive. Election of one remedy will not preclude the use of other remedies. In the event of default: a. The non-defaulting party may terminate the Agreement, and the termination will be effective immediately or at such other date as specified by the terminating party. b. The City may purchase the services required under the Agreement from the open market, complete required work itself, or have it completed at the expense of Contractor. If the cost of obtaining substitute services exceeds the contract price, the City may recover the excess cost by: (i) requiring immediate reimbursement to the City; (ii) deduction from an unpaid balance due to Contractor; (iii) collection against the proposal and/or performance security, if any; (iv) collection against liquidated damages (if applicable); or (v) a combination of the aforementioned remedies or other remedies as provided by law. Costs includes any and all, fees, and expenses incurred in obtaining substitute services and expended in obtaining reimbursement, including, but not limited to, administrative expenses, attorneys’ fees, and costs. c. The non-defaulting party will have all other rights granted under this Agreement and all rights at law or in equity that may be available to it. d. Neither party will be liable for incidental, special, or consequential damages. S.19 CONTINUATION DURING DISPUTES. Contractor agrees that during any dispute between the parties, Contractor will continue to perform its obligations until the dispute is settled, instructed to cease performance by the City, enjoined or prohibited by judicial action, or otherwise required or obligated to cease performance by other provisions in this Agreement. S.20 TERMINATION FOR CONVENIENCE. The City reserves the right to terminate this Agreement in part or in whole upon thirty (30) calendar days’ written notice. STANDARD TERMS AND CONDITIONS S.21 CONFLICT OF INTEREST F.S. Section 112. Pursuant to F.S. Section 112, the City may cancel this Agreement after its execution, without penalty or further obligation, if any person significantly involved in initiating, securing, drafting, or creating the Agreement for the City becomes an employee or agent of Contractor. S.22 TERMINATION FOR NON-APPROPRIATION AND MODIFICATION FOR BUDGETARY CONSTRAINT. The City is a governmental agency which relies upon the appropriation of funds by its governing body to satisfy its obligations. If the City reasonably determines that it does not have funds to meet its obligations under this Agreement, the City will have the right to terminate the Agreement without penalty on the last day of the fiscal period for which funds were legally available. In the event of such termination, the City agrees to provide written notice of its intent to terminate thirty (30) calendar days prior to the stated termination date. S.23 PAYMENT TO CONTRACTOR UPON TERMINATION. Upon termination of this Agreement, Contractor will be entitled only to payment for those services performed up to the date of termination, and any authorized expenses already incurred up to such date of termination. The City will make final payment within thirty (30) calendar days after the City has both completed its appraisal of the materials and services provided and received Contractor’s properly prepared final invoice. S.24 NON-WAIVER OF RIGHTS. There will be no waiver of any provision of this agreement unless approved in writing and signed by the waiving party. Failure or delay to exercise any rights or remedies provided herein or by law or in equity, or the acceptance of, or payment for, any services hereunder, will not release the other party of any of the warranties or other obligations of the Agreement and will not be deemed a waiver of any such rights or remedies. S.25 INDEMNIFICATION/LIABILITY. a. To the fullest extent permitted by law, Contractor agrees to defend, indemnify, and hold the City, its officers, agents, and employees, harmless from and against any and all liabilities, demands, claims, suits, losses, damages, causes of action, fines or judgments, including costs, attorneys’, witnesses’, and expert witnesses’ fees, and expenses incident thereto, relating to, arising out of, or resulting from: (i) the services provided by Contractor personnel under this Agreement; (ii) any negligent acts, errors, mistakes or omissions by Contractor or Contractor personnel; and (iii) Contractor or Contractor personnel’s failure to comply with or fulfill the obligations established by this Agreement. b. Contractor will update the City during the course of the litigation to timely notify the City of any issues that may involve the independent negligence of the City that is not covered by this indemnification. c. The City assumes no liability for actions of Contractor and will not indemnify or hold Contractor or any third party harmless for claims based on this Agreement or use of Contractor-provided supplies or services. S.26 WARRANTY. Contractor warrants that the services and materials will conform to the requirements of the Agreement. Additionally, Contractor warrants that all services will be performed in a good, workman-like and professional manner. The City’s acceptance of service or materials provided by Contractor will not relieve Contractor from its obligations under this warranty. If any materials or services are of a substandard or unsatisfactory manner as determined by the City, Contractor, at no additional charge to the City, will provide materials or redo such services until in accordance with this Agreement and to the City’s reasonable satisfaction. Unless otherwise agreed, Contractor warrants that materials will be new, unused, of most current manufacture and not discontinued, will be free of defects in materials and workmanship, will be provided in accordance with manufacturer's standard warranty for at least one (1) year unless otherwise specified, and will perform in accordance with manufacturer's published specifications. S.27 THE CITY’S RIGHT TO RECOVER AGAINST THIRD PARTIES. Contractor will do nothing to prejudice the City’s right to recover against third parties for any loss, destruction, or damage to City property, and will at the City’s request and expense, furnish to the City reasonable assistance and STANDARD TERMS AND CONDITIONS cooperation, including assistance in the prosecution or defense of suit and the execution of instruments of assignment in favor of the City in obtaining recovery. S.28 NO GUARANTEE OF WORK. Contractor acknowledges and agrees that it is not entitled to deliver any specific amount of materials or services or any materials or services at all under this Agreement and acknowledges and agrees that the materials or services will be requested by the City on an as needed basis at the sole discretion of the City. Any document referencing quantities or performance frequencies represent the City's best estimate of current requirements, but will not bind the City to purchase, accept, or pay for materials or services which exceed its actual needs. S.29 OWNERSHIP. All deliverables, services, and information provided by Contractor or the City pursuant to this Agreement (whether electronically or manually generated) including without limitation, reports, test plans, and survey results, graphics, and technical tables, originally prepared in the performance of this Agreement, are the property of the City and will not be used or released by Contractor or any other person except with prior written permission by the City. S.30 USE OF NAME. Contractor will not use the name of the City of Clearwater in any advertising or publicity without obtaining the prior written consent of the City. S.31 PROHIBITED ACTS. Pursuant to Florida Constitution Article II Section 8, a current or former public officer or employee within the last two (2) years shall not represent another organization before the City on any matter for which the officer or employee was directly concerned and personally participated in during their service or employment or over which they had a substantial or material administrative discretion. S.32 FOB DESTINATION FREIGHT PREPAID AND ALLOWED. All deliveries will be FOB destination freight prepaid and allowed unless otherwise agreed. S.33 RISK OF LOSS. Contractor agrees to bear all risks of loss, injury, or destruction of goods or equipment incidental to providing these services and such loss, injury, or destruction will not release Contractor from any obligation hereunder. S.34 SAFEGUARDING CITY PROPERTY. Contractor will be responsible for any damage to City real property or damage or loss of City personal property when such property is the responsibility of or in the custody of Contractor or its employees. S.35 WARRANTY OF RIGHTS. Contractor warrants it has title to, or the right to allow the City to use, the materials and services being provided and that the City may use same without suit, trouble or hindrance from Contractor or third parties. S.36 PROPRIETARY RIGHTS INDEMNIFICATION. Without limiting the foregoing, Contractor will without limitation, at its expense defend the City against all claims asserted by any person that anything provided by Contractor infringes a patent, copyright, trade secret or other intellectual property right and must, without limitation, pay the costs, damages and attorneys' fees awarded against the City in any such action, or pay any settlement of such action or claim. Each party agrees to notify the other promptly of any matters to which this provision may apply and to cooperate with each other in connection with such defense or settlement. If a preliminary or final judgment is obtained against the City’s use or operation of the items provided by Contractor hereunder or any part thereof by reason of any alleged infringement, Contractor will, at its expense and without limitation, either: (a) modify the item so that it becomes non-infringing; (b) procure for the City the right to continue to use the item; (c) substitute for the infringing item other item(s) having at least equivalent capability; or (d) refund to the City an amount equal to the price paid, less reasonable usage, from the time of installation acceptance through cessation of use, which amount will be calculated on a useful life not less than five (5) years, plus any additional costs the City may incur to acquire substitute supplies or services. S.37 CONTRACT ADMINISTRATION. The contract will be administered by the Procurement Division and/or an authorized representative from the using department. All questions regarding the contract will be referred to the Procurement Division for resolution. Supplements may be written to the contract for the addition or deletion of services. S.38 FORCE MAJEURE. Failure by either party to perform its duties and obligations will be excused by unforeseeable circumstances beyond its reasonable control, including acts of nature, acts of the STANDARD TERMS AND CONDITIONS public enemy, riots, fire, explosion, legislation, and governmental regulation. The party whose performance is so affected will within five (5) calendar days of the unforeseeable circumstance notify the other party of all pertinent facts and identify the force majeure event. The party whose performance is so affected must also take all reasonable steps, promptly and diligently, to prevent such causes if it is feasible to do so, or to minimize or eliminate the effect thereof. The delivery or performance date will be extended for a period equal to the time lost by reason of delay, plus such additional time as may be reasonably necessary to overcome the effect of the delay, provided however, under no circumstances will delays caused by a force majeure extend beyond one hundred-twenty (120) calendar days from the scheduled delivery or completion date of a task unless agreed upon by the parties. S.39 COOPERATIVE USE OF CONTRACT. The City has entered into various cooperative purchasing agreements with other Florida government agencies, including the Tampa Bay Area Purchasing Cooperative. Under a Cooperative Purchasing Agreement, any contract may be extended for use by other municipalities, school districts and government agencies with the approval of Contractor. Any such usage by other entities must be in accordance with the statutes, codes, ordinances, charter and/or procurement rules and regulations of the respective government agency. Orders placed by other agencies and payment thereof will be the sole responsibility of that agency. The City is not responsible for any disputes arising out of transactions made by others. S.40 FUEL CHARGES AND PRICE INCREASES. No fuel surcharges will be accepted. No price increases will be accepted without proper request by Contractor and response by the City’s Procurement Division. S.41 NOTICES. All notices to be given pursuant to this Agreement must be delivered to the parties at their respective addresses. Notices may be (i) personally delivered; (ii) sent via certified or registered mail, postage prepaid; (iii) sent via overnight courier; or (iv) sent via facsimile. If provided by personal delivery, receipt will be deemed effective upon delivery. If sent via certified or registered mail, receipt will be deemed effective three (3) calendar days after being deposited in the United States mail. If sent via overnight courier or facsimile, receipt will be deemed effective two (2) calendar days after the sending thereof. S.42 GOVERNING LAW, VENUE. This Agreement is governed by the laws of the State of Florida. The exclusive venue selected for any proceeding or suit in law or equity arising from or incident to this Agreement will be Pinellas County, Florida. S.43 INTEGRATION CLAUSE. This Agreement, including all attachments and exhibits hereto, supersede all prior oral or written agreements, if any, between the parties and constitutes the entire agreement between the parties with respect to the work to be performed. S.44 PROVISIONS REQUIRED BY LAW. Any provision required by law to be in this Agreement is a part of this Agreement as if fully stated in it. S.45 SEVERABILITY. If any provision of this Agreement is declared void or unenforceable, such provision will be severed from this Agreement, which will otherwise remain in full force and effect. The parties will negotiate diligently in good faith for such amendment(s) of this Agreement as may be necessary to achieve the original intent of this Agreement, notwithstanding such invalidity or unenforceability. S.46 SURVIVING PROVISIONS. Notwithstanding any completion, termination, or other expiration of this Agreement, all provisions which, by the terms of reasonable interpretation thereof, set forth rights and obligations that extend beyond completion, termination, or other expiration of this Agreement, will survive and remain in full force and effect. Except as specifically provided in this Agreement, completion, termination, or other expiration of this Agreement will not release any party from any liability or obligation arising prior to the date of termination. Cover Memo City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 File Number: ID#24-1498 Agenda Date: 1/16/2025 Status: Consent AgendaVersion: 1 File Type: Action ItemIn Control: Public Utilities Agenda Number: 6.12 SUBJECT/RECOMMENDATION: Authorize a purchase order to Hadronex Inc. DBA SmartCover of Escondido, California, for renewal of the SmartCare program which provides maintenance and service of the City’s SmartCover sewer level monitoring system for term December 1,2024 through January 01, 2026, in the not-to-exceed amount of $50,000.00 pursuant to Clearwater Code of Ordinances Section 2.563(1)(d), non-competitive purchase, and authorize the appropriate official to execute same. (consent) SUMMARY: The City’s SmartCover system enables remote monitoring of sewer water levels at critical locations citywide, allowing Public Utilities to proactively address problem areas and prevent sewer overflows. Most SmartCovers were installed to satisfy settlement conditions with the Florida Department of Environmental Protection (FDEP) for sanitary sewer overflows. This standardized product enhances integration and efficiency within the City’s system. The SmartCare labor warranty program provides routine maintenance, part disposal, system troubleshooting, remote monitoring, training, and labor to ensure consistent uptime for the City’s fifty-two (52) SmartCovers. Public Utilities is seeking approval to renew the SmartCare labor warranty for all installed SmartCovers across the City and to extend the warranty on the future purchase of 30 new SmartCover units authorized by Council on July 15, 2024. Looking ahead, Public Utilities plans to consolidate purchases and services upon contract expirations in January 2026 to streamline procurement processes. Notes: This item is being presented to Council because the accumulative amount from multiple purchase contracts with Hardronex Inc. DBA SmartCover exceeds $100,000, as indicated below: - Contract #902152 for the purchase of new units expires on July 31, 2026, in the NTE amount of $208,695.00 - Contract #902056 for Smartcover warranties for existing units expires January 31, 2026, in the NTE amount of $74,236.65 - PO24000312 Smartcare not authorized by council because under $50,000 in the NTE amount of $39,800.00 APPROPRIATION CODE AND AMOUNT: Funding for the current year is available in Public Utilities cost code 4211346-530300, contractual services, to fund this contract. Future year funding will be requested as part of the annual budget process. The Public Utilities department is funded by Water and Sewer Utility Enterprise Fund revenues. STRATEGIC PRIORITY: In furtherance of the Council’s Strategic Plan to achieve High Performing Government by maintaining public infrastructure through systematic management efforts, approval for an agreement is requested. Page 1 City of Clearwater Printed on 1/14/2025 ANY PROPRIETOR/PARTNER/EXECUTIVEOFFICER/MEMBER EXCLUDED? INSR ADDL SUBRLTRINSDWVD PRODUCER CONTACTNAME: FAXPHONE(A/C, No):(A/C, No, Ext): E-MAILADDRESS: INSURER A : INSURED INSURER B : INSURER C : INSURER D : INSURER E : INSURER F : POLICY NUMBER POLICY EFF POLICY EXPTYPE OF INSURANCE LIMITS(MM/DD/YYYY)(MM/DD/YYYY) AUTOMOBILE LIABILITY UMBRELLA LIAB EXCESS LIAB WORKERS COMPENSATION AND EMPLOYERS' LIABILITY DESCRIPTION OF OPERATIONS / LOCATIONS / VEHICLES (ACORD 101, Additional Remarks Schedule, may be attached if more space is required) AUTHORIZED REPRESENTATIVE EACH OCCURRENCE $DAMAGE TO RENTEDCLAIMS-MADE OCCUR $PREMISES (Ea occurrence) MED EXP (Any one person)$ PERSONAL & ADV INJURY $ GEN'L AGGREGATE LIMIT APPLIES PER:GENERAL AGGREGATE $ PRO-POLICY LOC PRODUCTS - COMP/OP AGGJECT OTHER:$COMBINED SINGLE LIMIT $(Ea accident) ANY AUTO BODILY INJURY (Per person)$OWNED SCHEDULED BODILY INJURY (Per accident)$AUTOS ONLY AUTOS HIRED NON-OWNED PROPERTY DAMAGE $AUTOS ONLY AUTOS ONLY (Per accident) $ OCCUR EACH OCCURRENCE CLAIMS-MADE AGGREGATE $ DED RETENTION$ PER OTH-STATUTE ER E.L. EACH ACCIDENT E.L. DISEASE - EA EMPLOYEE $If yes, describe under E.L. DISEASE - POLICY LIMITDESCRIPTION OF OPERATIONS below INSURER(S) AFFORDING COVERAGE NAIC # COMMERCIAL GENERAL LIABILITY Y / N N / A (Mandatory in NH) SHOULD ANY OF THE ABOVE DESCRIBED POLICIES BE CANCELLED BEFORE THE EXPIRATION DATE THEREOF, NOTICE WILL BE DELIVERED IN ACCORDANCE WITH THE POLICY PROVISIONS. THIS IS TO CERTIFY THAT THE POLICIES OF INSURANCE LISTED BELOW HAVE BEEN ISSUED TO THE INSURED NAMED ABOVE FOR THE POLICY PERIODINDICATED. NOTWITHSTANDING ANY REQUIREMENT, TERM OR CONDITION OF ANY CONTRACT OR OTHER DOCUMENT WITH RESPECT TO WHICH THISCERTIFICATE MAY BE ISSUED OR MAY PERTAIN, THE INSURANCE AFFORDED BY THE POLICIES DESCRIBED HEREIN IS SUBJECT TO ALL THE TERMS,EXCLUSIONS AND CONDITIONS OF SUCH POLICIES. LIMITS SHOWN MAY HAVE BEEN REDUCED BY PAID CLAIMS. THIS CERTIFICATE IS ISSUED AS A MATTER OF INFORMATION ONLY AND CONFERS NO RIGHTS UPON THE CERTIFICATE HOLDER. THIS CERTIFICATE DOES NOT AFFIRMATIVELY OR NEGATIVELY AMEND, EXTEND OR ALTER THE COVERAGE AFFORDED BY THE POLICIES BELOW. THIS CERTIFICATE OF INSURANCE DOES NOT CONSTITUTE A CONTRACT BETWEEN THE ISSUING INSURER(S), AUTHORIZED REPRESENTATIVE OR PRODUCER, AND THE CERTIFICATE HOLDER. IMPORTANT: If the certificate holder is an ADDITIONAL INSURED, the policy(ies) must have ADDITIONAL INSURED provisions or be endorsed. If SUBROGATION IS WAIVED, subject to the terms and conditions of the policy, certain policies may require an endorsement. A statement on this certificate does not confer rights to the certificate holder in lieu of such endorsement(s). COVERAGES CERTIFICATE NUMBER:REVISION NUMBER: CERTIFICATE HOLDER CANCELLATION © 1988-2015 ACORD CORPORATION. All rights reserved.ACORD 25 (2016/03) CERTIFICATE OF LIABILITY INSURANCE DATE (MM/DD/YYYY) $ $ $ $ $ The ACORD name and logo are registered marks of ACORD 11/7/2024 License # 0C36861 (619) 816-3740 35289 Hadronex, Inc. dba: SmartCover Systems 2110 Enterprise Escondido, CA 92029 42376 A 1,000,000 X 7018210531 2/2/2024 2/2/2025 100,000 15,000 1,000,000 2,000,000 2,000,000 POL AGG LIMIT 25,000,000 1,000,000A X BUA 7018210545 2/2/2024 2/2/2025 2,000,000A CUE 7018210528 2/2/2024 2/2/2025 2,000,000 10,000 B TWC4416955 4/1/2024 4/1/2025 1,000,000 1,000,000 1,000,000 Certificate holder is named as additional insured as respects to General Liability and Auto Liability when required by written contract or agreement City of Clearwater 600 Cleveland St Clearwater, FL 33755 HADRINC-01 NNIE San Marcos - Escondido 277 Rancheros Dr, Ste 300 San Marcos, CA 92069 Chad Evans Chad.Evans@alliant.com Continental Insurance Company Technology Insurance Company Inc X X X X X X X X X CNA PARAMOUNT Blanket Additional Insured -Owners,Lessees or Contractors - with Products-Completed Operations Coverage Endorsement This endorsement modifies insurance provided under the following: COMMERCIAL GENERAL LIABILITY COVERAGE PART It is understood and agreed as follows: I.WHO IS AN INSURED is amended to include as an Insured any person or organization whom you are required by written contract to add as an additional insured on this Coverage Part,but only with respect to liability for bodily injury,property damage or personal and advertising injury caused in whole or in part by your acts or omissions,or the acts or omissions of those acting on your behalf: A.In the performance of your ongoing operations subject to such written contract;or B.In the performance of your work subject to such written contract,but only with respect to bodily injury or property damage included in the products-completed operations hazard,and only if: 1.The written contract requires you to provide the additional insured such coverage;and 2.This Coverage Part provides such coverage;and C.Subject always to the terms and conditions of this policy,including the limits of insurance,the Insurer will not provide such additional insured with: 1.Coverage broader than what you are required to provide by the written contract;or 2.A higher limit of insurance than what you are required to provide by the written contract. Any coverage granted by this Paragraph I.shall apply solely to the extent permissible by law. II.If the written contract requires additional insured coverage under the 07-04 edition of CG2010 or CG2037,then paragraph I.above is deleted in its entirety and replaced by the following: WHO IS AN INSURED is amended to include as an Insured any person or organization whom you are required by written contract to add as an additional insured on this Coverage Part,but only with respect to liability for bodily injury,property damage or personal and advertising injury caused in whole or in part by your acts or omissions,or the acts or omissions of those acting on your behalf: A.In the performance of your ongoing operations subject to such written contract;or B.In the performance of your work subject to such written contract,but only with respect to bodily injury or property damage included in the products-completed operations hazard,and only if: 1.The written contract requires you to provide the additional insured such coverage;and 2.This Coverage Part provides such coverage. III.But if the written contract requires: A.Additional insured coverage under the 11-85 edition,10-93 edition,or 10-01 edition of CG2010,or under the 10- 01 edition of CG2037;or B.Additional insured coverage with “arising out of”language; then paragraph I.above is deleted in its entirety and replaced by the following: WHO IS AN INSURED is amended to include as an Insured any person or organization whom you are required by written contract to add as an additional insured on this Coverage Part,but only with respect to liability for bodily injury,property damage or personal and advertising injury arising out of your work that is subject to such written contract. 7018210531CNA75079XX(3-22)Policy No: 11Page1of3EndorsementNo: The Continental Insurance Co.02/02/2024EffectiveDate: HADRONEX,INC.Insured Name: Copyright CNA All Rights Reserved.20020003170182105316495 CNA PARAMOUNT Blanket Additional Insured -Owners,Lessees or Contractors - with Products-Completed Operations Coverage Endorsement IV.But if the written contract requires additional insured coverage to the greatest extent permissible by law,then paragraph I.above is deleted in its entirety and replaced by the following: WHO IS AN INSURED is amended to include as an Insured any person or organization whom you are required by written contract to add as an additional insured on this Coverage Part,but only with respect to liability for bodily injury,property damage or personal and advertising injury arising out of your work that is subject to such written contract. V.The insurance granted by this endorsement to the additional insured does not apply to bodily injury,property damage,or personal and advertising injury arising out of: A.The rendering of,or the failure to render,any professional architectural,engineering,or surveying services, including: 1.The preparing,approving,or failing to prepare or approve maps,shop drawings,opinions,reports,surveys, field orders,change orders or drawings and specifications;and 2.Supervisory,inspection,architectural or engineering activities;or B.Any premises or work for which the additional insured is specifically listed as an additional insured on another endorsement attached to this Coverage Part. VI.Under COMMERCIAL GENERAL LIABILITY CONDITIONS,the Condition entitled Other Insurance is amended to add the following,which supersedes any provision to the contrary in this Condition or elsewhere in this Coverage Part: Primary and Noncontributory Insurance With respect to other insurance available to the additional insured under which the additional insured is a named insured,this insurance is primary to and will not seek contribution from such other insurance,provided that a written contract requires the insurance provided by this policy to be: 1.Primary and non-contributing with other insurance available to the additional insured;or 2.Primary and to not seek contribution from any other insurance available to the additional insured. But except as specified above,this insurance will be excess of all other insurance available to the additional insured. VII.Solely with respect to the insurance granted by this endorsement,the section entitled COMMERCIAL GENERAL LIABILITY CONDITIONS is amended as follows: The Condition entitled Duties In The Event of Occurrence,Offense,Claim or Suit is amended with the addition of the following: Any additional insured pursuant to this endorsement will as soon as practicable: 1.Give the Insurer written notice of any claim,or any occurrence or offense which may result in a claim; 2.Send the Insurer copies of all legal papers received,and otherwise cooperate with the Insurer in the investigation, defense,or settlement of the claim;and 3.Make available any other insurance,and endeavor to tender the defense and indemnity of any claim to any other insurer or self-insurer,whose policy or program applies to a loss that the Insurer covers under this coverage part. However,if the written contract requires this insurance to be primary and non-contributory,this paragraph 3. does not apply to other insurance under which the additional insured is a named insured. The Insurer has no duty to defend or indemnify an additional insured under this endorsement until the Insurer receives written notice of a claim from the additional insured. 7018210531CNA75079XX(3-22)Policy No: 11Page2of3EndorsementNo: The Continental Insurance Co.02/02/2024EffectiveDate: HADRONEX,INC.Insured Name: Copyright CNA All Rights Reserved. CNA PARAMOUNT Blanket Additional Insured -Owners,Lessees or Contractors - with Products-Completed Operations Coverage Endorsement VIII.Solely with respect to the insurance granted by this endorsement,the section entitled DEFINITIONS is amended to add the following definition: Written contract means a written contract or written agreement that requires you to make a person or organization an additional insured on this Coverage Part,provided the contract or agreement: A.Was executed prior to: 1.The bodily injury or property damage;or 2.The offense that caused the personal and advertising injury; for which the additional insured seeks coverage;and B.Is still in effect at the time of the bodily injury or property damage occurrence or personal and advertising injury offense. All other terms and conditions of the Policy remain unchanged. This endorsement,which forms a part of and is for attachment to the Policy issued by the designated Insurers,takes effect on the effective date of said Policy at the hour stated in said Policy,unless another effective date is shown below,and expires concurrently with said Policy. 7018210531CNA75079XX(3-22)Policy No: 11Page3of3EndorsementNo: The Continental Insurance Co.02/02/2024EffectiveDate: HADRONEX,INC.Insured Name: Copyright CNA All Rights Reserved.20020003170182105316496 Business Auto Policy Policy Endorsement ADDITIONAL INSURED - PRIMARY AND NON-CONTRIBUTORY It is understood and agreed that this endorsement amends the BUSINESS AUTO COVERAGE FORM as follows: SCHEDULE Name of Additional Insured Person Or Organization ANY PERSON OR ORGANIZATION THAT YOU ARE REQUIRED BY WRITTEN CONTRACT OR WRITTEN AGREEMENT TO NAME AS AN ADDITIONAL INSURED. 1.In conformance with paragraph A.1.c. of Who Is An Insured of Section II - LIABILITY COVERAGE, the person or organization scheduled above is an insured under this policy. 2.The insurance afforded to the additional insured under this policy will apply on a primary and non-contributory basis if you have committed it to be so in a written contract or written agreement executed prior to the date of the “accident” for which the additional insured seeks coverage under this policy. All other terms and conditions of the policy remain unchanged This endorsement, which forms a part of and is for attachment to the policy issued by the designated Insurers, takes effect on the Policy Effective date of said policy at the hour stated in said policy, unless another effective date (the Endorsement Effective Date) is shown below, and expires concurrently with said policy. BUA 7018210545 Endorsement No: 25; Page: 1 of 1 Policy Page: 123 of 150 Underwriting Company: Continental Casualty Company, 151 N Franklin St, Chicago, IL 60606 Form No: CNA71527XX (10-2012) Endorsement Effective Date: Policy No: Policy Effective Date: 02/02/2024Endorsement Expiration Date: © Copyright CNA All Rights Reserved. January 2, 2024 SmartCover is implementing a moderate price increase to cover higher costs we are experiencing. We are asking for your support as we address these current market conditions. Effective March 1, 2024, or as contracts permit, SmartCover is increasing the price of all systems and system components by 3.0% and Active Site Management (ASM), warranty programs and H2S Calibration Services by 3.2%. This moderate price adjustment will allow us to maintain a secure and reliable software platform, world-class support with a live person, as well as deliver future innovation. SmartCover values your partnership and appreciates your understanding. We will continue to provide you with the highest quality products and services for all remote sewer monitoring needs. If you have any questions regarding the increase or current pricing, don't hesitate to reach out to me or directly to your account manager. Sincerely, Paris Neofotistos Paris Neofotistos Executive Vice President, Sales and Marketing | SmartCover pneofotistos@smartcoversystems.com 2110 Enterprise Street | Escondido, CA 92029 2 1 1 0 E n t e r p r i s e S t r e e t | E s c o n d i d o, C A | 9 2 0 2 9 Budget Quote SmartCare only Page 1 of 3 Due Date Period Covered Quote Number 12/31/2024 12/01/2024-01/31/2026 00002141 Hadronex, Inc. DBA SmartCover Systems 2110 Enterprise Street Escondido, CA 92029 USA P: 760-291-1980 F: 760-291-1982 Remit PO to orders@smartcoversystems.com or return this quote signed with PO number. Scan of PO is preferred. Bill To:Ship To:Date 10/16/2024 City of Clearwater Public Utilities One Clearwater Tower 6th Floor 600 Cleveland St Clearwater, FL 33756, USA City of Clearwater 1650 N Arcturas Ave Bldg A Clearwater, FL 33765, USA #Product Description Qty Mo Rate Total 1 Extended Warranty Labor Labor services for onsite visits during coverage period. Level,FLOE, Vault. SmartCare. Period Covered: 12/1/2024-1/31/2026 SIN Site 8327 Stag Run MH 263B8040 8315 Sherwood St MH 270B7075 9136 Sheraton Sand Key MH 294A2035 10803 Seville Blvd. MH 300A4100 8323 Rosewood St MH 279A4115 8317 Ridge Ave MH 270B5005 10800 Ream Wilson Trail/NE of Carpenter Field 8319 Powderhorn Dr MH 252A3080 8311 Nursery Rd MH 317B7075 8318 Nash St. 8314 Montclair Apts. 10802 Mandalay Ave/San Marco 12052 Imperial Lake & MH 318A1025 8324 Highland Ave MH 270A3005 8316 Harn Blvd MH 309B6075 8326 Gulf View Blvd MH 285A3110 12043 Fairwood Ave 282A3015 8321 Enterprise Rd MH233B5055 12055 Douglas Ave MH 269B6060 8312 Corona MH 289A2080 8320 Brattle Ln MH 178A3055 8313 Barrington Dr West MH 262A3020 12050 901 Fairwood Ave. MH 282A3005 12045 701 South Madison MH 296A3100 9131 610 Woodlawn St MH 313B7105 10192 608 N Bayshore MH 283B8005 9132 409 East Shore Dr MH 267A4010 10801 400 Larboard Way MH 267B5015 12048 3030 Enterprise Rd East MH 323A2085 12049 2690 Drew St MH 282A2120 10804 25720 US 19 9134 2450 Drew St MH 290B5005 12046 2346 DRUID 299A4010 12053 2246 Gulf to Bay 290A2120 12051 212 David Ave MH 291B6030 9137 1846 Union St MH242A2090 52 14 $850.00 $44,200.00 Budget Quote SmartCare only Page 2 of 3 9138 1751 N Highland MH 261A4095 9133 1484 South Belcher Rd MH 316B7130 9129 1480 Barry MH 307A1100 9130 1219 South Fort Harrison MH 305B5090 9135 1201 Gulf Blvd MH 303B7005 12054 115 N Duncan MH 288B7005 12044 1115 Pinellas Street MH306A3080 12047 1001 N MLK Jr MH 269A4115 8325 MLK Apartments 14565 604 Brookside Dr /298A1065 14559 518 Bamboo Ln. /2987035 14562 211 S. Prospect Ave /287A2100 14561 2027 Gulf to Bay Blvd. /298B5010 14563 1928 Gulf to Bay Blvd. /298A4085 14564 1040 Sunset Point Rd./251A2135 14560 1014 Pine Brook Dr. /269B8045 2 Notes Details regarding order. ASM, Power and parts are covered till Jan 2026 1 $0.00 $0.00 Budget Quote SmartCare only Page 3 of 3 Signature for Approval __________________________ P.O. No. We appreciate your business! Terms and Conditions for this transaction: 1.Payment: Net 30 days 2.All pricing subject to change. 3.All hardware, rentals, software subscriptions and renewals may be subject to tax. 4.Taxes were calculated at the time of quote creation and may change at the time of invoice. 5.Customer is responsible for paying the appropriate taxes due at time of invoice. 6.SmartCover is not responsible for the loss of wireless communication or internet communications or any communications used in the operation of this system. SmartCover is an advisory service only. As such, SmartCover is not responsible for any damage of any kind or from any cause whatsoever that may result from, in relation to, in connection with, due to, or as a result of the installation or operation of the system, including without limitation, equipment failure, or any consequential damages caused by, or resulting from, the use or installation of the SmartCover system. Subtotal $44,200.00 Tax $0.00 Total $44,200.00 Cover Memo City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 File Number: ID#24-1625 Agenda Date: 1/16/2025 Status: Consent AgendaVersion: 1 File Type: Action ItemIn Control: Public Utilities Agenda Number: 6.13 SUBJECT/RECOMMENDATION: Approve a Work Order to McKim and Creed for engineering services through construction for the installation of a solar photovoltaic (PV) system on top of the Chlorine Contact Chambers (CCC) at the Northeast Water Reclamation Facility (NE WRF), Project 24-0039-UT, in the amount of $221,407.00 pursuant to RFQ 34-23, Engineer of Record (EOR) Consulting Services and authorize the appropriate officials to execute same. (consent) SUMMARY: The CCC is a critical stage in the wastewater treatment process, where effluent is disinfected before being fed into the reclaimed water system. This project aims to provide shade to reduce algae growth, minimize sodium hypochlorite usage, and generate clean energy through solar power. The energy produced will help offset the facility’s overall energy consumption. Additionally, Elective Pay is a new program resulting from the 2022 Inflation Reduction Act and allows local governments, such as the City of Clearwater, to apply for clean energy credits with the IRS. Public Utilities will work with Sustainability Division to apply for clean energy credits for 30-40% of the expenses for this clean energy project. McKim & Creed was selected for this project due to their expertise, demonstrated success on similar initiatives, and their completion of a Solar Feasibility Study in early 2023, specifically focused on the Water Reclamation Facilities (WRFs). Their in-depth familiarity with the project scope and consistent track record of delivering high-quality results on time and with professionalism further support their selection. It is anticipated the design will be completed within approximately 270 days (not including construction time) from the date of council approval. Both the City of Clearwater and the City of Safety Harbor utilize the NE WRF, with Clearwater accounting for 75% of its use and Safety Harbor for 25%. The City of Clearwater Public Utilities Department oversees its operation and maintenance. APPROPRIATION CODE AND AMOUNT: 3277327-530100-M1906 Enterprise funds are available in capital improvement project M1906, Northeast Plant R&R to fund this work order. STRATEGIC PRIORITY: In furtherance of the Council’s Strategic Plan to achieve High Performing Government by maintaining public infrastructure through systematic management efforts, approval of a Work Order to McKim & Creed is requested. Page 1 City of Clearwater Printed on 1/14/2025 City of Clearwater Consultant Work Order Page 1 of 12 Revised: 11/28/2022 CONSULTANT WORK ORDER Date: 11/06/2024 1. PROJECT INFORMATION: Project Title: NE WRF Chlorine Contact Chamber Solar Energy Project City Project Number: 24-0039-UT City Plan Set Number: NA Consultant Project Number: 00992-0255 2. SCOPE OF SERVICES: The City of Clearwater has tasked McKim & Creed to provide engineering and construction services to compare the costs and benefits of installing a solar photovoltaic (PV) system on top of the Chlorine Contact Chamber’s (CCC) at the Northeast Water Reclamation Facility (NEWRF) with the installation of standard contact chamber covering. The project aims to provide cover from the sun to mitigate algae growth, reduce the amount of sodium hypochlorite usage, while potentially generating clean energy, demonstrating the municipality's commitment to sustainability. The solar power generated will be used to offset the plant’s energy consumption. CONSULTANT WORK ORDER NE WRF Chlorine Contact Chamber Solar Energy Project McKim & Creed Inc. 24-0039-UT City of Clearwater Consultant Work Order Page 2 of 12 Revised: 11/28/2022 This PV system will be connected downstream of the portion of the plant’s primary metering from Duke Energy. The power generated will be downstream of this meter and the Duke Energy’s transformers served. In furtherance of the Council’s Strategic Plan to achieve a high-performing government and environmental stewardship, Public Utilities aims to maintain public infrastructure through systematic management efforts. Design and Construction Deliverable Schedule A complete design and construction documents submittal will be performed using the standard Design-Bid-Build submittals stages of 30,60,90,100% and Issue for Bid (IFB) submitted deliverables. Design documents will be presented to the City of Clearwater Staff for review and comment at each submittal stage with signed and sealed documents for permitting and IFB. The design plans shall be compiled using the City of Clearwater CAD standards as outlined Attachment ‘B’ of this document. I. PRE-DESIGN PHASE: Task 1.0 PROJECT MANAGEMENT As part of the design service McKim & Creed shall provide project management service for discipline design and coordination with City Staff. These include: • Project setup, meeting minutes and invoicing. Review Record Drawings and obtain operational data. • Attend Virtual kick off and monthly progress meetings, perform site visits as needed. • Provide health and safety plan and submit to the City Project Manager prior to EOR mobilizing to site. EOR will schedule meetings, send invites, prepare agendas, meeting notes, etc. for all meetings. • Coordinate with City on project and construction schedule. • Coordination with City staff and EOR for Waste Gas Co-Generation design. • Assist City to submit written solar interconnection application to be submitted by City to Duke Energy for net metering. The City will provide a copy of the approved interconnection agreement to the EOR. Deliverables • Kick-off Meeting Summary • Progress Meeting Summaries Task 1.1: A 30% Basis of Design Report (BODR) will be produced outlining the feasibility of installing a solar array on top of the CCC’s. It will describe the potential for power to be produced and the offset to the current power usage along with the return on investment (ROI) based on current and future costs. This will be compared to providing standard contact tank covers for the same area from the standpoint of overall life cycle cost. CONSULTANT WORK ORDER NE WRF Chlorine Contact Chamber Solar Energy Project McKim & Creed Inc. 24-0039-UT City of Clearwater Consultant Work Order Page 3 of 12 Revised: 11/28/2022 As part of the BODR, for the solar portion, there will be a description of the electrical equipment and structural mounting components along with any challenges and the means to mitigate them. All of the items in the BODR will be discussed with City staff while producing the draft and then final document. The BODR will use existing Duke Energy information provided by the City and the Feasibility Study previously performed by McKim & Creed in October 2022. Segments of the study will be used for design and power calculations that will be adjusted for the current design configuration and output. A discussion with City staff and engineering of the current ongoing project of Co- Generation using waste gas will be needed to assess any potential conflicts and adjustments that may be needed. The final report will include: • Preliminary Structural review of the as-built drawings. • Recommendation of solar PV system size and options, including vendor, technology, equipment, and mounting systems. • An estimate of annual energy production and potential cost savings. o City to provide 24 months of existing billing information. • Preliminary Site and One-line drawings. • Develop a preliminary project budget and schedule. • Propose energy monitoring system and discussions of City reporting requirements. • AACE Class 5 (-50% to +100%) Estimation of Probable Costs (EOPCC) Once the draft report is completed and sent to City for review, a scheduled review meeting will be planned with City staff to go over the design and comments. Deliverable • 30% BODR II. DESIGN PHASE: Task 2.1: Design McKim & Creed shall provide 60%, 90%, 100%, set of drawings and technical specifications at each submittal including the following: • Review meeting updates with City staff of the 60%, 90%, and 100% submittals. • Recommended construction-sequencing plan to keep critical equipment operational. • Plans and specifications to adhere to NEC, NFPA 70 E and Florida Building Code. (FBC) Electrical Drawings to include but not be limited to: CONSULTANT WORK ORDER NE WRF Chlorine Contact Chamber Solar Energy Project McKim & Creed Inc. 24-0039-UT City of Clearwater Consultant Work Order Page 4 of 12 Revised: 11/28/2022 • Electrical Specifications & Notes • Electrical Site Plan • Array Layouts • One‐Line Diagrams for DC and AC power systems with wiring materials and sizes indicated • Schematic Power Wiring Diagram • Grounding diagram indicating wire sizes and material. • Wire, conduit, and equipment schedules for AC and DC power systems • Schematic Controls Wiring Diagrams including communication wiring between inverter and monitoring system. • Stringing Plan (typical) • Wire management details for racking and modules • Electrical Details • Major electrical equipment dimensioned and drawn to scale in the space allocated, including inverters and conduit runs. Illustrated in both plan and elevation views with indicated required clearances. • Labels and Markings • Equipment Specifications • EEOPC AACE Class 3 (-20% to +30%) estimate. Calculations: • Voltage drop calculations to meet industry standards • Cable sizing calculations • Conduit sizing calculations Structural Drawings to include but not be limited to: • Structural design drawings of solar array mounting and support system over CCC concrete troughs, including columns, beams and all mounting. • Structural details of mounting plates, joints and ancillary supports. • Provide design for mounting of solar equipment such as inverters, disconnects, controls, conduit, and other electrical components. This may be on the ground or in other areas of an existing building structure. • Structural calculations meeting the current FBC for wind loading. III. FINAL DESIGN PHASE: Task 3.1: Permitting McKim & Creed shall prepare the permit applications and corresponding supporting documentation and obtain applicable signatures utilizing the 100% Design Plans provided in Task 2.1. In-person meetings with permitting agencies are not anticipated nor included in this scope of work. Correspondence with all permitting CONSULTANT WORK ORDER NE WRF Chlorine Contact Chamber Solar Energy Project McKim & Creed Inc. 24-0039-UT City of Clearwater Consultant Work Order Page 5 of 12 Revised: 11/28/2022 agencies will be done via email or phone call. Phone call discussions will be documented for future reference in an email. It is anticipated that permits will be required from the following agencies: • City of Clearwater Building Department which includes structural and electrical permits. The permit applications will typically consist of the following information and activities: • Submit drawings (signed and sealed by Florida Registered Professional Engineer). • Provide required supplemental information to support permit request. • Complete permit applications for each agency to be signed and sealed by the design engineer. • Prepare tracking sheet with indication of dates of submittal of each application and approval or comments from the corresponding agency. • McKim & Creed will respond to two (2) Request for Additional Information (RAI) for each permitting agency and incorporate revisions requested by the permitting agencies and re-submit information. • Permit application fees (including permit costs in the project fees) will be paid by the consultant and invoiced to the City as a reimbursable. Task 3.2 Issue for Bid Document Phase (IFB) Upon receipt of 100% comments McKim & Creed will provide Signed and Sealed Issue for Bid Contract documents for advertisement to prospective Bidders. McKim & Creed will provide electronic file of signed and sealed drawings and specification to be distributed. • EEOPC AACE Class 2 ( -15% to +20%) estimate. IV. BIDDING PHASE: Task 4.1: Bidding • Assist and attend the City in a Pre-Bid meeting. The City shall prepare an agenda. • Provide Contractor design question responses and aid the City in the preparation of addenda. City will issue all addenda. • Review bids received by the City and provide recommendation of award. CONSULTANT WORK ORDER NE WRF Chlorine Contact Chamber Solar Energy Project McKim & Creed Inc. 24-0039-UT City of Clearwater Consultant Work Order Page 6 of 12 Revised: 11/28/2022 V. CONSTRUCTION PHASE: Task 5.1: Construction Services • CONFORMED DOCUMENTS Prior to Pre-Construction meeting, McKim &Creed will provide Contractor with final construction documents that will include any adjustments to the IFB drawings and specifications. • PRE-CONSTRUCTION MEETING The SUBCONSULTANT project manager and one construction administrator will attend the preconstruction meeting conducted by the City and CONTRACTOR. Construction procedures and lines of communication will be established. SUBCONSULTANT is not responsible for the preparation of meeting agendas or minutes. • SHOP DRAWINGS REVIEW McKim & Creed will establish and maintain an internal system for the review of shop drawing submittals by the CONTRACTOR for conformance to the design concept of the project and for compliance with the Contract Documents. The submittal review system will be structured and managed to provide timely response to the Contractor’s submittals. Shop drawing review efforts are based on the following assumptions: o Each shop drawing review will require three (3) hours average review time. o There are an estimated 35 total shop drawing submittals encompassing all disciplines. o No more than one third of the total number of first shop drawings will require a second submittal and that average review will be no more than two (2) hours. • REQUEST FOR INFORMATION McKim & Creed will address and respond to a maximum of twenty (20) requests for information (RFI). RFI’s from the CONTRACTOR will be received and logged by McKim & Creed. McKim & Creed will prepare the response to the RFI within five business days. Should McKim & Creed require additional time to prepare a response, McKim & Creed will provide CONTRACTOR a summary of the issues, actions required to develop a response, and time estimate for response submittal. McKim & Creed shall keep a log showing the receipt and response of each RFI. CONSULTANT WORK ORDER NE WRF Chlorine Contact Chamber Solar Energy Project McKim & Creed Inc. 24-0039-UT City of Clearwater Consultant Work Order Page 7 of 12 Revised: 11/28/2022 • CHANGE ORDER REVIEW McKim & Creed will review Change Orders prepared by CONTRACTOR for conformance to RFI response items. A maximum of five (5) Change Orders are included in this scope. • SITE VISITS McKim & Creed will participate in up to twenty (20) site visits/observations with the Contractor, Subcontractors, and City representatives, when requested. McKim & Creed will review and comment on the meeting minutes prepared and distributed by others, when requested by McKim & Creed. • SUBSTANTIAL AND FINAL COMPLETION McKim & Creed will attend an inspection at the substantial completion stages and in development of a punch list. It is assumed that there will be separate inspections for the major phases of construction, identified as follows: o Phase 1: Completion of Steel Structure, Solar Array Installation, and connection, prior to preliminary start up. o Phase 2: Final completion of all elements including operation of solar array showing functionality and electrical power output. Final inspection will be after the substantial completion punch list items have been addressed by the Contractor and the City has notified MCKIM & CREED that the project is ready for final inspection. It is assumed that there will be one final inspection. • PROJECT START-UP McKim & Creed will observe the start-up, testing and coordination of electrical systems, instrumentation, controls, and communication systems associated with the project improvements. It is anticipated that the project start-up process will take approximately 1 week to complete. The contractor will guide the City’s relevant department(s) (Public Utilities and General Services) to go through the interconnection process with utility provider to ensure that the solar energy system is properly connected behind the meter, and able to receive renewable energy credits from utility provider after project hand-off. • OPERATIONS & MAINTENANCE MANUAL REVIEW The contractor will prepare Operation & Maintenance (O&M) Manuals per manufacturer’s specifications. McKim & Creed will review O&M documents related to structural, electrical and instrumentation activities. • RECORD DRAWINGS CONSULTANT WORK ORDER NE WRF Chlorine Contact Chamber Solar Energy Project McKim & Creed Inc. 24-0039-UT City of Clearwater Consultant Work Order Page 8 of 12 Revised: 11/28/2022 McKim & Creed will review CONTRACTOR’S as-built drawings. Upon completion of the project, McKim & Creed will utilize the as-built drawings developed by the CONTRACTOR to produce a final set of Record Drawings. The accuracy of the drawings will be limited to the information collected and provided by CONTRACTOR. • STANDARD OPERATING PROCEDURES It is assumed that CONTRACTOR will develop a standard operating procedures (SOP) manual focused on operating and maintaining the new solar power system. McKim & Creed will review SOP documents relative to completeness ease of use. The CONTRACTOR will be responsible for all training of City staff. 3. PROJECT GOALS: Deliverables for the project will include: • Draft and Final BODR in electronic PDF format. • Electronic 60%, 90%, 100%, drawing sets for City review. • Three (3) bound Sets of Permit Documents for Building Department. • Full sized 24”x36” Final Signed and Sealed IFB Construction Documents for Advertise and Bidding. Conform set not included but will be part of the Construction Phase Services. • Project Catalog for Design to be submitted electronically. 4. FEES: This price includes all labor and expenses anticipated to be incurred by McKim & Creed, Inc. for the completion of these tasks in accordance with Professional Services Method “A” – Hourly Rate Completion by Task for a fee not to exceed Two hundred twenty-one thousand four hundred seven Dollars ($221,407.00). 5. SCHEDULE: The project design duration is slated for 9 months (or days) from issuance of notice-to- proceed. Schedule does not include City or Permit review time (Typically 2 weeks). The project deliverables are to be phased as follows: Pre Design Phase: 120 calendar days 60% Construction Plans and Permit Applications: 180 calendar days 90% Construction Plans: 210 calendar days 100% Construction Plans: 240 calendar days CONSULTANT WORK ORDER NE WRF Chlorine Contact Chamber Solar Energy Project McKim & Creed Inc. 24-0039-UT City of Clearwater Consultant Work Order Page 9 of 12 Revised: 11/28/2022 Final Construction Documents: 270 calendar days Bidding Phase 330 calendar days Construction phase 600 calendar days 6. STAFF ASSIGNMENT: McKim & Creed Aubrey Haudricourt –Project Manager - McKim & Creed Sol Haroon – Solar Technical Expert - McKim & Creed John Reese – Senior Electrical Engineer - McKim & Creed Greg Holbrook – Senior Structural Engineer – McKim & Creed City of Clearwater Richard G. Gardner, P.E. – Public Utilities Director Michael Flanigan – Public Utilities Assistant Director Kaylynn Price – Utilities Engineering Manager Christina Goodrich - Wastewater Envt’l Tech (WET) Manager Travis Teuber - Public Utilities (WET) Assistant Manager Jerry Hahn - NE WRF Chief Plant Operator Daniel Trueblood - Public Utilities Infrastructure Maintenance Manager Wayne LaFleur - Public Utilities Infrastructure Maintenance Asst Manager Cassie Cordova – Sustainability Division Manager Melody Yin – Sustainability Specialist Rama Pandkar - Project Manager 7. CORRESPONDENCE/REPORTING PROCEDURES: Consultant’s project correspondence shall be directed to Aubrey Haudricourt, PE. All City project correspondence shall be directed to the City Project Manager Rama Pandkar, with copies to the Utilities Engineering Manager, Public Utilities Director and Public Utilities Assistant Director. Engineer shall provide a minimum of forty-eight (48) hours’ notice to conducting fieldwork/site visits. Engineer shall provide a minimum of three (3) days notification for site visits requiring the assistance of City personnel. Engineer acknowledges that all City directives shall be provided by the City Project Manager. CONSULTANT WORK ORDER NE WRF Chlorine Contact Chamber Solar Energy Project McKim & Creed Inc. 24-0039-UT City of Clearwater Consultant Work Order Page 10 of 12 Revised: 11/28/2022 A health and safety plan must be submitted to the City Project Manager prior to conducting any fieldwork/site visits. In addition to the original copies delivered as stated in the scope of work, all project deliverables will be submitted in electronic format on CD or other City approved device prior to approval of final invoice. Consultant will also be required to assist the City in filing for Elective Pay process by providing relevant documentations throughout the project as requested. Such documents may include solar-specific invoice, substantial completion document for solar system containing start construction date and completion date, interconnection agreement/electrical permit to operate etc. 8. INVOICING/FUNDING PROCEDURES: City Invoicing Code: 3277327-530100-M1906 For work performed, invoices shall be submitted monthly to: CITY OF CLEARWATER, PUBLIC UTILITIES DEPARTMENT ATTENTION: PU Engineering 1650 NO ARCTURAS AVE BLDG-C CLEARWATER, FLORIDA 33765-1945 Email: PUEngineering@MyClearwater.com Contingency services will be billed as incurred only after written authorization provided by the City to proceed with those services. 9. INVOICING PROCEDURES: At a minimum, in addition to the invoice amount(s) the following information shall be provided on all invoices submitted on the Work Order: 1. Purchase Order, Project and Invoice Numbers and Contract Amount. 2. The time period (begin and end date) is covered by the invoice. 3. A short narrative summary of activities completed in the time period. 4. Contract billing method – Lump Sum or Hourly Rate. 5. If Lump Sum, the percent completion, amount due, previous amount earned and total earned to date for all tasks (direct costs, if any, shall be included in lump sum amount). 6. If Hourly Rate, hours, hourly rates, names of individuals being billed, amount due, previous amount earned, the percent completion, total earned to date for each task and other direct costs (receipts will be required for any single item with a cost of $50 or greater or cumulative monthly expenses greater than $100). CONSULTANT WORK ORDER NE WRF Chlorine Contact Chamber Solar Energy Project McKim & Creed Inc. 24-0039-UT City of Clearwater Consultant Work Order Page 11 of 12 Revised: 11/28/2022 7. If the Work Order is funded by multiple funding codes, an itemization of tasks and invoice amounts by funding code. 10. CONSIDERATIONS: Consultant acknowledges the following: 1. The Consultant named above is required to comply with Section 119.0701, Florida Statutes, where applicable. 2. All City directives shall be provided by the City Project Manager. 3. “Alternate equals” shall not be approved until City Project Manager agrees. 4. All submittals must be accompanied by evidence each has been internally checked for QA/QC before providing to City. 5. Consultants/Contractors are not permitted to use City-owned equipment (i.e. sampling equipment, etc.). 6. Documents posted on City website must ADA accessible. 11. ADDITIONAL CONSIDERATIONS: All work orders should include considerations for the following: 1. Sea Level Rise and Flood Resilience, as applicable. 2. Submittal of a Critical Path Method (CPM) Schedule(s). 3. Submittal of a Project Catalog with the following items, as appropriate: a. Data requests, assumptions, critical correspondence, meeting agenda, sign-in sheets, meeting minutes, document comment-response log(s), technical memorandum/reports, addenda, progress reports, regulatory correspondence, and other project-related documents. b. If construction project, also include design plans, conformed plans, change orders, field orders, RFIs, work change directives, addenda, progress reports, shop drawing and progress submittals, as-builts, record drawings, and other project-related documents such as O&M manuals and warranty information. c. At the conclusion of the project, ENGINEER will combine this information into a Project Catalog and submit to the City for review and comment. 4. Arc Flash labeling requirements: a. All electrical designs and construction shall adhere to NFPA 70 E “Standard for Electrical Safety in the Workplace”. b. Updated calculations of Fault and Arc Flash, and provisions for new or updated Arc Flash equipment labeling shall be included in the contract documents. (Performed during Construction as part of Construction Services) CONSULTANT WORK ORDER NE WRF Chlorine Contact Chamber Solar Energy Project McKim & Creed Inc. 24-0039-UT City of Clearwater Consultant Work Order Page 12 of 12 Revised: 11/28/2022 12. SPECIAL CONSIDERATIONS: Items not included in Survey: • Boundary survey, including tree surveys. • Survey of off-site utilities, bridges, or roadways. • Special easements / maps for common areas. • Special easements / maps for utility purposes. • Right of way / easement negotiations / acquisition. • Construction staking. 13. SIGNATURES: PREPARED BY: APPROVED BY: Aubrey Haudricourt Richard Gardner, P.E. Project Manager Public Utilities Director McKim & Creed City of Clearwater 11-06-2024 Date Date ATTACHMENT “A” CONSULTANT WORK ORDER – PROJECT FEES TABLE NE WRF Chlorine Contact Chamber Solar Energy Project McKim & Creed Inc. 24-0039-UT City of Clearwater Consultant Work Order – Project Fees Table Page 1 of 2 Revised: 11/28/2022 CONSULTANT WORK ORDER PROJECT FEES TABLE Task Description Labor Total 1.0 Pre-Design Project Management - Project Discipline Coordination, Schedule, Invoicing, maintaining budget, safety plan, Utility coordination, and assist owner in Utility application. Kick Off Meeting, Project Meetings, Site Visits $20,255.00 1.1 30% Basis of Design Report Draft and Final, Review meeting, Utility and Waste Gas Co-Gen Coordination $31,715.00 Pre-Design Total: $51,970.00 2.0 Design 2.1 60% Submittal Drawings and Specifications, Engineers Cost Estimate $28,420.00 2.2 90% Submittal Drawings and Specifications Engineers Cost Estimate $23,900.00 2.3 100% Submittal Drawings and Specifications Engineers Cost Estimate $18,790.00 Design Total: $71,110.00 3.0 Final Design 3.1 Permitting and RAI’s $6,860.00 Final Design Total: $6,860.00 4.0 Bidding 4.1 S&S IFB Drawings and Specifications, Prebid meeting, Contractor Questions Responses, Addenda $4,305.00 Bidding Total: $4,305.00 5.1 Construction Services Construction Administration, Construction Observations, Submittals, RFI’s, Change Orders, Substantial and Final completion, Start-up. $66,125.00 Construction Services Total: $66,125.00 SUBTOTAL, LABOR AND SUB-CONTRACTORS: $200,370.00 Permit Fees (Estimate) $1,000.00 Contingency (10%) $20,037.00 GRAND TOTAL: $221,407.00 ATTACHMENT “A” CONSULTANT WORK ORDER – PROJECT FEES TABLE NE WRF Chlorine Contact Chamber Solar Energy Project McKim & Creed Inc. 24-0039-UT City of Clearwater Consultant Work Order – Project Fees Table Page 2 of 2 Revised: 11/28/2022 PAGE 1 OF 1 ELECTRICAL WORK TASK BREAKDOWN TASK COMMENTS PROJECT MANGAGER III PROJECT ENGINEER IV PROJECT ENGINEER II DESIGENER II PROJECT ADMIN LABOR HOURS LABOR DOLLARS TOTAL COSTS Direct Rate Labor Multiplier BILLING RATE 220.00$ 210.00$ 175.00$ 130.00$ 90.00$ Task 1.0 Project Management - Project Discipline Coordination, Schedule, Invoicing, maintaining budget, safety plan, Utility coordination, and assist owner in Utility application. 8.0 8.0 16.0 2,480.00$ $2,480.00 Kick Off Meeting (Virtual)1.0 1.0 1.0 3.0 605.00$ $605.00 Clent Project Meeting (One per Month -9 months) Virtual 9.0 9.0 18.0 3,870.00$ $3,870.00 Initial Site Visit(s) 4.0 8.0 8.0 20.0 3,960.00$ $3,960.00 Clearwater Site Visit ( Total 4)12.0 12.0 24.0 4,080.00$ $4,080.00 Submittal Coodination -Total 5 5.0 5.0 1,100.00$ $1,100.00 Elective Pay Process 8.0 8.0 8.0 24.0 4,160.00$ $4,160.00 Subtotal Task 1 35.0 38.0 9.0 12.0 16.0 110.0 20,255.00$ $20,255 Task 1.1 Data Collection for Feasability Study 1.0 8.0 8.0 17.0 3,300.00$ $3,300.00 Draft Design Report Write Up with Feasbility Study 2.0 16.0 4.0 22.0 4,160.00$ $4,160.00 Review Meeting (Virtual)1.0 1.0 1.0 3.0 605.00$ $605.00 Final Report Write Up 8.0 4.0 8.0 20.0 3,100.00$ $3,100.00 8 Intial Utility Contact & Coodination 4.0 8.0 4.0 16.0 3,260.00$ $3,260.00 Intial calculations of Fault Current, for ratings of equipment.4.0 8.0 12.0 2,240.00$ $2,240.00 30% Drawings and Calculations (Electrical)2.0 8.0 8.0 25.0 43.0 6,770.00$ $6,770.00 30% Drawings and Calculations (Structural)1.0 8.0 8.0 12.0 29.0 4,860.00$ $4,860.00 Waste Gas Co-Gen Coordination,4.0 4.0 4.0 12.0 2,080.00$ $2,080.00 Engineers Estimate of Probable Cost (EEoPC) ACEC Class 5 1.0 2.0 4.0 7.0 1,340.00$ $1,340.00 Subtotal Task 1.1 16.0 67.0 45.0 37.0 16.0 181.0 31,715.00$ $31,715 Task 2.1 60% Drawings and Calculations (Electrical)2.0 16.0 24.0 32.0 74.0 12,160.00$ $12,160.00 60% Drawings and Calculations (Structural)1.0 16.0 24.0 41.0 6,700.00$ $6,700.00 60% Specifications 2.0 8.0 24.0 4.0 42.0 7,100.00$ $7,100.00 Engineers Estimate of Probable Cost (EEoPC) ACEC Class 4 1.0 4.0 8.0 13.0 2,460.00$ $2,460.00 Subtotal Task 2.1 6.0 44.0 56.0 56.0 4.0 170.0 28,420.00$ $28,420 Task 2.2 90% Drawings and Calculations (Electrical)1.0 16.0 24.0 32.0 73.0 11,940.00$ $11,940.00 90% Drawings and Calculations (Structural)1.0 16.0 12.0 29.0 5,140.00$ $5,140.00 90% Specifications 1.0 8.0 16.0 4.0 33.0 5,480.00$ $5,480.00 Engineers Estimate of Probable Cost (EEoPC) ACEC Class 3 1.0 2.0 4.0 7.0 1,340.00$ $1,340.00 Subtotal Task 2.2 4.0 42.0 44.0 44.0 4.0 142.0 23,900.00$ $23,900 Task 2.3 100% Drawings and Calculations (Electrical)1.0 16.0 16.0 25.0 58.0 9,630.00$ $9,630.00 100% Drawings and Calculations (Structural)1.0 16.0 12.0 29.0 5,140.00$ $5,140.00 100% Specifications 1.0 4.0 8.0 4.0 21.0 3,240.00$ $3,240.00 Engineers Estimate of Probable Cost (EEoPC) ACEC Class 2 1.0 1.0 2.0 4.0 780.00$ $780.00 Subtotal Task 2.3 4.0 37.0 26.0 37.0 4.0 112.0 18,790.00$ $18,790 Task 3.1 Submit (100%) S&S Drawings and Application 1.0 4.0 4.0 12.0 29.0 4,160.00$ $4,160.00 Request for Addition Information (RAI's)1.0 4.0 4.0 4.0 17.0 2,700.00$ $2,700.00 0.0 -$ $0.00 Subtotal Task 3.1 2.0 8.0 8.0 16.0 0.0 46.0 6,860.00$ $6,860 Task 4.1 S & S Issue for Bid Documents (IFB)1.0 1.0 2.0 12.0 2.0 22.0 2,940.00$ $2,940.00 Attend Pre-Bid Meeting 2.0 6.0 840.00$ $840.00 Provide Contractor Question Responses 1.0 2.0 315.00$ $315.00 Addenda 2.0 210.00$ $210.00 Estimated Permit Costs 0.0 -$ $0.00 Subtotal Task 4.1 1.0 4.0 2.0 12.0 2.0 32.0 4,305.00$ $4,305 Task 5.1 Conformed Documents 16.0 16.0 2,080.00$ $2,080.00 Pre-Construction Meeting 4.0 4.0 700.00$ $700.00 Shop Drawing Review (Est. 35)35.0 105.0 140.0 25,725.00$ $25,725.00 Request for Information (Est. 20)10.0 40.0 50.0 9,100.00$ $9,100.00 Change Order Review (Est.5)2.5 5.0 7.5 1,600.00$ $1,600.00 Site Visits (Est 20)20.0 40.0 60.0 11,200.00$ $11,200.00 Substantial and Final Completion 8.0 8.0 16.0 3,080.00$ $3,080.00 Project Start-Up 16.0 16.0 32.0 6,160.00$ $6,160.00 Record Drawings 24.0 24.0 3,120.00$ $3,120.00 SOP 16.0 16.0 3,360.00$ $3,360.00 Subtotal Task 2.5 110.0 213.0 24.0 0.0 349.5 66,125.00$ $66,125 TOTAL 71 350 403 238 46 545 200,370.00$ $200,370.00 City of Clearwater NE WRF Contact Chamber Solar Project 90% Design Project Administration, Data Collection and Review 30% Basis of Design 100% Design Bid Phase Construction Services Permitting PROPOSAL NO. 242529 60% Design ATTACHMENT “B” (Include if applicable) CONSULTANT WORK ORDER – CITY DELIVERABLES NE WRF Chlorine Contact Chamber Solar Energy Project McKim & Creed Inc. 24-0039-UT City of Clearwater Consultant Work Order – City Deliverables Page 1 of 1 Revised: 11/28/2022 CONSULTANT WORK ORDER CITY DELIVERABLES 1. FORMAT: The design plans shall be compiled utilizing the following methods: 1. City of Clearwater CAD standards. 2. Datum: Horizontal and Vertical datum shall be referenced to North American Vertical Datum of 1988 (vertical) and North American Datum of 1983/90 (horizontal). The unit of measurement shall be the United States Foot. Any deviation from this datum will not be accepted unless reviewed by City of Clearwater Engineering/Geographic Technology Division. 2. DELIVERABLES: The design plans shall be produced on bond material, 24" x 36" at a scale of 1" = 20’ unless approved otherwise. Upon completion the consultant shall deliver all drawing files in digital format with all project data in Autodesk Civil 3D file format. NOTE: If approved deviation from Clearwater CAD standards is used, the Consultant shall include all necessary information to aid in manipulating the drawings including either PCP, CTB file or pen schedule for plotting. The drawing file shall include only authorized fonts, shapes, line types or other attributes contained in the standard release of Autodesk software. All block references and other references contained within the drawing file shall be included. Please address any questions regarding format to Mr. Thomas Mahony, at (727) 562-4762 or email address Thomas.Mahony@myClearwater.com. All electronic files (including CAD and Specification files) must be delivered upon completion of project or with 100% plan submittal to City of Clearwater. PROJECT NUMBER: 24-0039-UT PROJECT NAME: NE WRF CHLORINE CONTACT CHAMBER SOLAR PROJECT MANAGER: RAMA PANDKAR DEPARTMENT: PUBLIC UTILITIES Engineer of Choice: McKim & Creed System Type (select one): ☐ Lift Station ☐ Potable Water Supply/Distribution ☐ Reclaimed Water Distribution ☐ Joint Project Agreement/ FDOT Project ☐ Sanitary Sewer Collection ☒ WRF (Water Reclamation Facility) ☐ WTP (Water Treatment Plant) ☐ Other: _________________ Questions: 1. Are they an Engineer of Record? ☒ Yes ☐ No a. If the answer is ‘No’ were they acquired by RFQ? ☐ Yes ☐ No ☒ N/A 2. Have they done a project with the department previously? ☒ Yes ☐ No 3. Have they done a project with the City previously? ☒ Yes ☐ No 4. Have they done a project at the project area previously? ☐ Yes ☒ No 5. Do they have personnel experienced in the design and construction of similar systems mentioned above? ☒ Yes ☐ No a. Ask for resumes accordingly 6. Do they have a positive track record of past performance with the City and or Public Utilities Department? ☒ Yes ☐ No 7. Is the firm a certified minority business or woman owned enterprise? ☐ Yes ☒ No 8. Has the firm demonstrated that they can meet the time restrictions and budget requirements of the project? ☒ Yes ☐ No 9. Does the firm have an office within 50 miles of the project area? ☒ Yes ☐ No 10. Has the firm demonstrated that they capacity to take on this additional work? ☒ Yes ☐ No Reasoning Why: McKim & Creed was selected for this project due to the exceptional capabilities of their professional project management team and their extensive experience in delivering environmentally friendly and cost-effective solutions for water, wastewater, and renewables projects. McKim & Creed is particularly well-suited for this project, having completed the solar feasibility study in 2023 for all three of Public Utilities' water reclamation facilities, which laid the groundwork for this design initiative. Additionally, their proven track record with Public Utilities on previous projects, demonstrating technical, design, and planning expertise, further strengthens the team's qualifications. Cover Memo City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 File Number: ID#25-0005 Agenda Date: 1/16/2025 Status: Consent AgendaVersion: 1 File Type: Action ItemIn Control: City Clerk Agenda Number: 6.14 SUBJECT/RECOMMENDATION: Schedule a work session on Monday, July 7, 2025 at 1:30 p.m. and a council meeting on Thursday, July 10, 2025 at 6:00 p.m. (consent) SUMMARY: At the November 7, 2024 council meeting, staff was directed to schedule a work session and council meeting in July that would accommodate council schedules. Staff proposes to hold the July work session and council meeting on Monday, July 7 and Thursday, July 10, respectively. Page 1 City of Clearwater Printed on 1/14/2025 Cover Memo City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 File Number: 25-01 Agenda Date: 1/16/2025 Status: Public HearingVersion: 1 File Type: Planning CaseIn Control: Planning & Development Agenda Number: 7.1 SUBJECT/RECOMMENDATION: Continue to February 6, 2025: Provide direction on the proposed Development Agreement between AP Beach Properties, LLC (the property owner) and the City of Clearwater for property located at 405 Coronado Drive, providing for the allocation of 100 units from the Hotel Density Reserve under Beach by Design; and confirm a second public hearing in City Council Chambers before City Council on February 20, 2025 at 6:00 p.m., or as soon thereafter as may be heard. (HDA2024-09001) SUMMARY: Site Location and Existing Conditions: The subject property is a 1.759-acre parcel operating as a surface parking lot with frontage along Coronado and Hamden Drives (420 feet and 370 feet, respectively) and Fifth Street (220 feet). It is located within the Tourist (T) District and the Small Motel District of Beach by Design with an underlying future land use designation of Resort Facilities High (RFH). The surrounding area is characterized by a mix of uses including overnight accommodations (hotels), retail, outdoor recreation and entertainment, restaurant and attached dwellings with heights ranging from one to 15 stories. There are one- to two- story hotels adjacent to the site and a five-story attached dwelling located at the northeast corner of Bayside Drive and Hamden Drive. The City’s Beach Walk project, to the west, has been constructed transforming South Gulfview Boulevard to the north of this site into a winding beachside promenade with tropical landscaping with clear views to Clearwater Beach and the water beyond. Coronado Drive has largely been improved according to Beach by Design. Site History: A portion of the property (originally five parcels on the northern end) was previously subject to a Development Agreement approved by the City Council on October 2, 2014. An amended agreement was subsequently approved on February 4, 2022, that incorporated additional land (three parcels to the south) into the site design (HDA2013-08006/HDA2013-08006A). The original Development Agreement recently expired, and the applicant is proposing a new Development Agreement and conceptual design and is requesting 100 units from the Hotel Density Reserve. The development proposal is described in detail later in this memo. The overall size of the proposed development site has not changed; the eight parcels referenced above have been consolidated into the single subject parcel. However, the various properties comprising the site have different histories which are provided below. Page 1 City of Clearwater Printed on 1/14/2025 File Number: 25-01 North portion of the site (previously 401/405/415/419 Coronado Drive and 406 Hamden Drive): ·On April 19, 2011, the Community Development Board (CDB) approved a Level Two Flexible Development application (FLD2011-02005) for a surface parking lot which has been constructed. ·On September 18, 2014, the City Council approved the allocation of up to 100 units from the Hotel Density Reserve under Beach by Design (HDA2013-08006) and adopted a resolution to the same effect (Resolution No. 14-25). The owners proposed to develop the site with a 166-unit overnight accommodation use with associated accessory/amenity uses including commercial space, restaurant, meeting rooms, and an exercise room. This Development Agreement, as amended on February 4, 2022 (HDA2013-08006A), expired on October 8, 2024. ·On July 21, 2015, the CDB approved a Level Two Flexible Development application (FLD2015-05016) for a 166-room overnight accommodation use in the Tourist (T) District. The CDB approved an amendment on May 17, 2022 (FLD2015-05016A), subsequent to the modifications to the Development Agreement referenced above. A series of extension requests have been approved extending the validity of the issued Development Order until March 14, 2027. South portion of the site (previously 410/420 Hamden Drive): ·On December 28, 2018, the Community Development Coordinator approved a Level One Flexible Standard Development application (FLS2018-05024) for a surface parking lot for property including 410/420 Hamden Drive. The approval expired one year later. ·On November 17, 2020, the CDB approved a Level Two Transfer of Development Rights (TDR2020-07002) which transferred four hotel units from 410 Hamden Drive (Parcel ID 08-29-15-17622-000-0100) and seven hotel units from one of the two parcels comprising 420 Hamden Drive (Parcel ID 08-29-15-17622-000-0080), all to property located at 400/405/408/409/411 East Shore Drive. ·On October 19, 2021, the CDB approved a Level Two Transfer of Development Rights (TDR2021-08004) which transferred the remaining two dwelling units from 410/420 Hamden Drive (Parcel IDs 08-29-15-17622-000-0100, 08-29-15-17622-000-0090 and 08-29-15-17622-000-0080) to property located at 619/629/631/635 Mandalay Avenue. ·The two approved TDR applications removed all development potential from these three additional parcels. Development Proposal: The proposal is to remove all the existing site improvements on the 1.759-acre site and to construct a hotel with 135 overnight accommodation units as well as retail and restaurant spaces. The northern portion of the property that has remaining development potential is 1.32 acres, and as previously discussed, the 0.439-acre southern portion does not have remaining development potential. The underlying Resort Facilities High (RFH) future land use designation allows for 50 overnight accommodations units per acre or 1.2 FAR for nonresidential uses. The proposal of 20,000 square feet of retail area and 6,825 square feet of restaurant area requires 0.613 acres of land, leaving 0.707 acres of land with development potential that can be Page 2 City of Clearwater Printed on 1/14/2025 File Number: 25-01 used for overnight accommodations units. To achieve the proposed number of units, the project utilizes the 35 units possible from this remaining acreage, in addition to the requested 100-unit allocation from the Hotel Density Reserve (Reserve) through Beach by Design. With the incorporation of the retail and restaurant area, and the reduction of the number of hotel units from 166 as approved in 2014 (HDA2013-08006) to 135 rooms, the subject site’s density (hotel units per acre) will decrease from 94.32 hotel units per acre to 77 units per acre. The reduction of the number of hotel units will enable the provision additional services to the hotel guests. The building will continue to be 100 feet in height as measured from the established design flood elevation to flat roof. The proposal continues to include a tropical modern architecture, which is consistent with and complements the tropical vernacular envisioned in Beach by Design. The request includes a conceptual site plan and accompanying building elevations (Exhibit B). The site will be accessed via a two-way driveway from Hamden Drive at the southeast corner of the property which will provide access to the parking garage component of the development. A one-way ingress is provided centrally along the north side of the site along Fifth Street which also provides access to the parking garage as well as an underbuilding drop off area. The egress for the drop off area is also located along Fifth Street. A one-way egress from the parking garage is provided at the northeast side along Hamden Drive. The primary pedestrian entrance is located at the northwest corner of the site. The northwest corner of the building on the ground floor contains a lobby, retail area and restaurant. The first five floors of the building will contain a parking garage as well as miscellaneous back-of-house components such as maintenance rooms and laundry facilities. The sixth floor will include a pool and pool deck and other amenities such as private balconies, exercise areas and related activities such as yoga. The seventh and eighth floors will be dedicated almost entirely to hotel rooms and the nineth floor with include rooms, outdoor amenities as well as an indoor/ outdoor bar and lounge. Proposal’s Consistency with the Community Development Code (CDC): Minimum Lot Area and Width: Pursuant to CDC Table 2-802, the minimum required lot area and width for an overnight accommodations use is 20,000 square feet and between 100 and 150 feet in lot width, respectively. The subject property is 76,622 square feet in area and approximately 420 feet wide. The site is consistent with these Code provisions. Minimum Setbacks: The conceptual site plan depicts setbacks of 15 feet along the Fifth Street and Hamden Drive (north and east) frontages, and 10 feet along all remaining property lines of the site including the frontage along Coronado Drive. The proposed setbacks may be approved as part of a Level One (FLS) application, subject to meeting the applicable flexibility criteria of the Community Development Code; however, other elements such as height may require the project to be a Level Two (FLD) application. Maximum Height: Section B of the Design Guidelines within Beach by Design specifically addresses height. The proposal provides for a building 100 feet in height as measured from the design flood elevation where a height of up to 100 feet is permitted as prescribed by the CDC (subject to meeting the applicable flexibility criteria of the CDC and approved as part of a Level Two Flexible Development application) and as limited by any applicable Beach by Design requirements. Page 3 City of Clearwater Printed on 1/14/2025 File Number: 25-01 The height of the proposed building is consistent with the guidelines of Beach by Design. Minimum Off-Street Parking: The 135-room overnight accommodations use requires a minimum of 162 off-street parking spaces. A parking garage located on the first five levels of the building will provide 400 spaces, including 50 which are available for public use. This is consistent with the applicable Sections of the CDC. Landscaping: While a formal landscape plan is not required to be submitted for review at this time, the conceptual landscape areas depicted on the site plan show that adequate spaces for foundation landscaping will be provided along all street frontages. Since no perimeter landscape buffers are required in the Tourist (T) District, the proposed landscape areas meet or exceed what is required. It is noted, however, that flexibility may be requested/necessary as part of a Comprehensive Landscape Program which would be reviewed at time of formal site plan approval. Proposal’s Consistency with Beach by Design: Design Guidelines: A review of the provided architectural elevations and massing study was conducted and the proposed building does appear to be generally consistent with the applicable Design Guidelines established in Beach by Design. However, a more formal review of these Guidelines will need to be conducted as part of the final site plan approval process. Hotel Density Reserve: The project has been reviewed for compliance with those criteria established within Beach by Design concerning the allocation of hotel rooms from the Reserve. The project appears to be generally consistent with those criteria, including that the development complies with the Metropolitan Planning Organization’s (MPO) countywide approach to the application of traffic concurrency management for transportation facilities. The submitted Traffic Impact Study concludes that traffic operations at nearby intersections and on adjacent roadways would continue at acceptable levels of service. It is important to note that the south portion of the site has had all development potential transferred to other properties within the Beach by Design planning area. Beach by Design Section V.B.2 provides that “Those properties and/or developments that have had density transferred off to another property and/or development(s) through an approved Transfer of Development Rights (TDR) application by the City after December 31, 2007, are not eligible to have rooms allocated from the Reserve.” Staff believes that the intent of this provision is to prevent a property owner from selling off development potential and then requesting units from the Reserve thereby profiting from the Reserve. This portion of the site was not in common ownership at the time the 100 units were allocated to the original proposal, and the inclusion of the parcels will result in the overall site density (units per acre) decreasing; therefore, the project does not utilize these lots for development potential at all. The primary purpose of adding these parcels is to provide the opportunity to provide a more efficient parking garage layout which will allow for the provision of all required parking spaces as well as a minimum of 50 spaces for use by the public. In short, the proposal provides for a scenario that Staff believes was not considered at the time that Beach by Design was written. Staff believes that the proposal meets the intent of Beach by Design and approval of the request. Standards for Development Agreements: Page 4 City of Clearwater Printed on 1/14/2025 File Number: 25-01 CDC Section 4-606 sets forth the procedures and criteria for reviewing development agreements. Specifically, development agreements shall be consistent with Clearwater 2045, the city’s Comprehensive Plan. The proposal furthers the goals, objectives and policies of the Comprehensive Plan as provided below. Goal QP 3: Support the on-going transformation of the Downtown and Clearwater Beach Activity Centers as high intensity, walkable, and attractive regional centers for living, working, shopping, and entertainment. Objective QP 3.3: Continue to use Beach by Design: A Preliminary Design for Clearwater Beach and Design Guidelines (Beach by Design) to guide development, redevelopment, and placemaking on Clearwater Beach. Policy QP 3.3.4: Continue to utilize the Hotel Density Reserve allocation as established in Beach by Design to facilitate hotel development on Clearwater Beach. The proposal is in compliance with the standards for development agreements, is consistent with the Comprehensive Plan and furthers the vision of beach redevelopment set forth in Beach by Design. The proposed Development Agreement will be in effect for a period not to exceed ten years, meets the criteria for the allocation of rooms from the Hotel Density Reserve under Beach by Design and includes the following main provisions: ·Provides for no change in the number of units (100 units) allocated from the Hotel Density Reserve (previously approved as part of HDA2013-08006/Resolution No. 14-25 and HDA2013-08006A/ Resolution No. 22-01); ·Includes conceptual site plans, architectural drawings, elevations and perspectives in Exhibit B that appear to be generally consistent with the applicable Design Guidelines established in Beach by Design; ·Requires the developer to obtain site plan approval within one year of approval, commence vertical construction within four years from the date of site plan approval, and obtain a certificate of occupancy within six years from the date of site plan approval; ·Requires the return of any hotel unit obtained from the Hotel Density Reserve that is not constructed; ·Prohibits the conversion of any hotel unit allocated from the Hotel Density Reserve to a residential use and requires the recording of a covenant restricting use of such hotel units to overnight accommodations usage; and ·Requires a legally enforceable mandatory evacuation/closure covenant that the hotel will be closed as soon as practicable after a hurricane watch that includes Clearwater Beach is posted by the National Hurricane Center. Changes to Development Agreements: Pursuant to Section 4-606.I, CDC, a Development Agreement may be amended by mutual consent of the parties, provided the notice and public hearing requirements of Section 4-206 are followed. Revisions to conceptual site plans and/or architectural elevations attached as Page 5 City of Clearwater Printed on 1/14/2025 File Number: 25-01 exhibits to this Development Agreement shall be governed by the provisions of the CDC, Section 4-406. Minor revisions to such plans may be approved by the Community Development Coordinator. Other revisions not specified as minor shall require an amendment to this Development Agreement. Summary and Recommendation: The proposal appears to be generally consistent with applicable components of the Community Development Code and Beach by Design and the city’s Comprehensive Plan. Staff is supportive of the request. Page 6 City of Clearwater Printed on 1/14/2025 1 HOTEL DENSITY RESERVE DEVELOPMENT AGREEMENT THIS HOTEL DENSITY RESERVE DEVELOPMENT AGREEMENT (this “Agreement”) is made and entered into this ____ day of ___________________, 2025, by and between AP BEACH PROPERTIES LLC, a Florida limited liability company (the “Developer”), its successors and assigns, and THE CITY OF CLEARWATER, FLORIDA, a Florida municipal corporation (the “City” and together with the Developer the “Parties”). R E C I T A L S : WHEREAS, one of the major elements of the City’s revitalization effort is a special area plan for the revitalization of Clearwater Beach (the “Beach”) adopted under the provisions of the Florida Growth Management Act, Chapter 163, Part II, Florida Statutes, and titled Beach by Design; and WHEREAS, Sections 163.3220 – 163.3243, Florida Statutes, the Florida Local Government Development Agreement Act (the “Act”), authorizes the City to enter into binding development agreements with persons having a legal or equitable interest in real property located within the corporate limits of the City; and WHEREAS, pursuant to the Act the City has adopted Section 4-606 of the City of Clearwater Community Development Code (the “CDC”), establishing procedures and requirements for the City to consider when entering into development agreements; and WHEREAS, Beach by Design proposed the development of hotel units to equalize development opportunities on the Beach and to ensure the Beach remains a quality, family resort community, and further provided for a limited pool of additional hotel density reserve units (“Reserve Units”) to be made available for hotel projects with said pool being referred to as the Hotel Density Reserve (the “Reserve”); and WHEREAS, the Developer owns 1.759 acres of real property (the “Property”) in the corporate limits of the City, more particularly described in Exhibit “A” attached hereto and incorporated herein; and WHEREAS, the City and Mainstream Partners VIII, LLC previously entered into that certain development agreement dated October 2, 2014, as amended by that certain First Amendment to the Hotel Density Reserve Development Agreement between the Parties dated February 9, 2022, for the development of a one hundred sixty-six (166) overnight accommodation units hotel project on the Property which expired on October 8, 2024; and WHEREAS, the Parties now wish to enter into this Agreement to develop a hotel project on the Property consisting of 135 overnight accommodation units, approximately 20,000 square feet of retail space, an approximately 6,825 square foot restaurant, meeting space for guest use, a pool, a lobby, and an approximately 160,795 square foot parking garage containing a minimum of 2 162 parking spaces or 1.2 spaces/unit for the overnight accommodations use, a minimum of 50 spaces available to the general public, and 186 spaces to be allocated to permitted uses at the Developer’s discretion, generally conforming to the conceptual site plan and architectural elevations shown in Exhibit “B” (collectively the “Project”); and WHEREAS, the Property has not previously acquired density from the Destination Resort Density Pool; and WHEREAS, upon completion the Project will contain 135 overnight accommodations units, which includes 100 Reserve Units; and WHEREAS, the City has conducted such public hearings as are required by and in accordance with Section 163.3225, Florida Statutes, CDC Sections 4-206 and 4-606, and any other applicable law; and WHEREAS, the City has determined that, as of the date of this Agreement, the Project is consistent with the City’s Comprehensive Plan and the CDC; and WHEREAS, at a duly noticed and convened public meeting on ________________, 2025, the City Council approved this Agreement and authorized and directed its execution by the appropriate officials of the City; and WHEREAS, approval of this Agreement is in the best interests of the City in furtherance of the City’s goals of enhancing the viability of the resort community and in furtherance of the objectives of Beach by Design; and WHEREAS, the Developer has approved this Agreement and has duly authorized certain individuals to execute this Agreement on the Developer’s behalf. W I T N E S S E T H : NOW, THEREFORE, in consideration of and in reliance upon the premises, the mutual covenants contained herein, and other good and valuable consideration, the receipt and sufficiency of which are hereby acknowledged, the Parties hereto intending to be legally bound and in accordance with the Act and CDC, agree as follows: SECTION 1. Recitals. The above recitals are true and correct and are a part of this Agreement. SECTION 2. Incorporation of the Act. This Agreement is entered into in compliance with and under the authority of the CDC and the Act, the terms of which as of the date of this Agreement are incorporated herein by this reference and made a part of this Agreement. Words used in this Agreement without definition that are defined in the Act shall have the same meaning in this Agreement as in the Act. 3 SECTION 3. Property Subject to this Agreement. The Property described in Exhibit “A” is subject to this Agreement. A. The Property currently has a land use designation of Resort Facilities High (RFH) and is zoned Tourist (T). The permitted uses on the property shall include overnight accommodations, retail sales and services, restaurants, and any accessory uses commonly associated with a hotel as determined by the City’s community development coordinator. Such uses shall be developed in accordance with the Project’s conceptual site plan and architectural elevations attached hereto as Exhibit “B” (collectively the “Conceptual Site Plan”). B. The Property is owned in fee simple or under contract to be owned in fee simple by the Developer. C. The Property is generally located at 405 Coronado Drive, Clearwater, Florida 33767, as further described in Exhibit “A”. SECTION 4. Scope of Project. A. The Project shall consist of one hundred thirty-five (135) overnight accommodation units in total which includes one hundred (100) Reserve Units. Upon adoption of this Agreement, the Project shall receive the 100 Reserve Units. All Reserve Units not constructed in accordance with this Agreement shall be returned to the Reserve. The Project shall include a minimum of one hundred sixty-two (162) parking spaces (1.2 spaces per unit) dedicated to the overnight accommodation use, as defined in the Code. The Project shall also include a minimum of fifty (50) parking spaces which shall be made available to the general public for the life of the Project and an additional One Hundred Eighty-Six (186) parking spaces which shall be allocable to the permitted uses on the site at the Developer’s discretion. B. The City has determined that the Conceptual Site Plan is consistent with Beach by Design. C. The Project shall not exceed one hundred (100) feet in height. The building intensity shall include One Hundred Thirty-Five (135) overnight accommodation units, meeting space for guest use, a pool, a lobby, approximately Twenty Thousand (20,000) square feet of retail space, an approximately Six Thousand Eight Hundred Twenty-Five (6,825) square foot restaurant, and an approximately a One Hundred Sixty Thousand Seven Hundred Ninety- Five (160,795) square foot parking garage which shall contain the parking spaces referenced in Subsection A. above. 4 SECTION 5. Effective Date/Duration of this Agreement. D. This Agreement shall not be effective until this Agreement is properly recorded in the Public Records of Pinellas County, Florida, pursuant to Section 163.3239, Florida Statutes and CDC Section 4-606 (the “Effective Date”). E. Within fourteen (14) days after the City approves the execution of this Agreement, the City shall record the Agreement with the Clerk of the Circuit Court for Pinellas County. The Developer shall pay the cost of such recording. F. This Agreement shall continue in effect for ten (10) years commencing on the Effective Date (the “Term”) unless earlier terminated as set forth herein. SECTION 6. Obligations of the Developer. The obligations under this Agreement shall be binding upon and the benefits of this Agreement shall inure to the Developer, its successors in interests or assigns. To comply with this Agreement, the Developer must comply with the following: A. At the time of development of the Property, the Developer will submit such applications and documentation as are required by law and shall comply with the CDC provisions applicable at the time of building permit review. B. The Project shall be developed in substantial conformance with the Conceptual Site Plan and the provisions of this Agreement. Any modifications determined by the Community Development Coordinator as either inconsistent with the Conceptual Site Plan or constituting a substantial deviation from said eplan shall require an amendment to this Agreement in accordance with the procedures of the Act and the CDC, as necessary and applicable. Any and all such approved and adopted amendments shall be recorded in the Public Records of Pinellas County, Florida. C. The Developer shall obtain appropriate site plan approval pursuant to a Level One or Level Two development application within one (1) year from the Effective Date of this Agreement in accordance with the provisions of the CDC, commence vertical construction within four (4) years from the date of site plan approval, and obtain a certificate of occupancy within six (6) years from the date of site plan approval. For sake of clarity, “commence vertical construction” shall mean that the physical building encompassing the Project has begun being erected on the Property. D. Evacuation/Closure Covenant. Prior to the commencement of construction, the Developer shall execute and record a mandatory evacuation/closure covenant, substantially in the form of Exhibit “C”, providing certain use restrictions and stating that the overnight 5 accommodation component of the Project will close as soon as practicable after a hurricane watch that includes Clearwater Beach is posted by the National Hurricane Center. E. Covenant of Unified Use and Development. Prior to the issuance of the first building permit for the Project, the Developer shall execute and record a mandatory covenant of unified use and development, substantially in the form of Exhibit “D”. Such covenant shall provide that the Project shall be developed and used as a single project, provided, however, that nothing shall preclude the Developer from selling all or a portion of the Developer’s Property in the event that the Developer decides not to construct the Project. It is understood and agreed that, in the event that the Developer enters into the covenant of unified use and development and 1.) elects not to construct the Project and notifies the City of this election in writing, or 2.) as of the date of expiration, termination, or revocation of this Agreement, no rights of the Developer remain or will be exercised to incorporate the Reserve Units into the Project, the City shall execute and deliver to the Developer a termination of such covenant of unified use and development suitable for recording in the Public Records of Pinellas County, Florida. F. Transient Use. A reservation system shall be required as an integral part of the overnight accommodations use for the Project. There shall be a lobby/front desk area that must be operated as a typical lobby/front desk area for a hotel would be operated. Access to all units must be provided through a lobby and internal corridor. All units shall be available to the public for overnight transient hotel occupancy at all times through the required hotel reservation system. Occupancy in the hotel is limited to a term of less than one (1) month or thirty-one (31) consecutive days, whichever is less. No unit in the hotel shall be used as a primary or permanent residence. G. No Full Kitchens. No unit shall have a complete kitchen facility as that term is used in the definition of “dwelling unit” in the Code. Mini kitchens as defined in Beach by Design are permitted. H. Inspection of Records. The Developer shall make available for inspection to authorized representatives of the City its books and records pertaining to each Reserve Unit upon reasonable notice to confirm compliance with these regulations as allowed by general law. I. Compliance with Design Guidelines. The Developer agrees to comply with the applicable Design Guidelines as set forth in Beach by Design. J. Limitation on Amplified Music. The Developer agrees that there shall be no outdoor amplified music at the Project between the hours 11:00 p.m. to 7:00 a.m. on Sunday through Thursday, or between the hours of 12:00 a.m. to 7:00 a.m. on Friday and Saturday. 6 SECTION 7. Obligations of the City. A. The City shall promptly process site and construction plan applications for the Property that are consistent with the Comprehensive Plan, the Conceptual Site Plan, and the Code. B. The final effectiveness of the applications referenced in Section 7.(A.) are subject to: i. The provisions of Chapters 163 and 166, Florida Statutes, as they may govern such applications; and ii. The expiration of any appeal periods or, if an appeal is filed, at the conclusion of such appeal. SECTION 8. Public Facilities to Service Development. Subject to the City’s determination of sufficient capacity, the following public facilities are presently available to service the Property from the sources indicated below. A. Potable water is available from the City. The Developer shall be responsible for all necessary main extensions and applicable connection fees. B. Sewer service is currently provided by the City. The Developer shall be responsible for all necessary main extensions and applicable connection fees. C. Fire protection is available from the City. D. Drainage facilities for the Property will be provided by the Developer at the Developer’s sole expense. E. The Project shall comply with the Metropolitan Planning Organization’s (the “MPO”) or its successor’s countywide approach to the application of concurrency management for transportation facilities, and the transportation analysis conducted for the Project shall include the following: i. Recognition of standard data sources as established by the MPO; ii. Identification of level of service (“LOS”) standards for state and county roads as established by the MPO; iii. Utilization of proportional fair-share requirements consistent with Florida Statutes and the MPO model ordinance; iv. Utilization of the MPO Traffic Impact Study Methodology; and 7 v. Recognition of the MPO designation of “Constrained Facilities” as set forth in the most current MPO Annual Level of Service Report. Any and all improvements associated with the public facilities identified in this section shall be completed prior to the issuance of any certificate of occupancy. Concurrency requirements that were included in Article 4, Division 9 of the CDC have been repealed. The Developer agrees to provide a cashier’s check, a payment and performance bond, or letter of credit in the amount of one hundred fifteen percent (115%) of the estimated costs of the public facilities and services, to be deposited with the City to secure construction of any new public facilities and services required to be constructed by this Agreement. Such construction shall be completed prior to issuance of a certificate of occupancy for the Project. SECTION 9. Required Local Government Approvals. The required local government development approvals for development of the Property include, without limitation, the following: A. Site plan approval(s) and associated utility licenses, access, and right-of-way utilization permits; B. Building permit(s); and C. Certificate(s) of occupancy. SECTION 10. Finding of Consistency. The City finds that development of the Property is consistent with the terms of this Agreement and is consistent with the City’s Comprehensive Plan and the CDC. SECTION 11. Remedies Upon Default by Developer. If the Developer’s obligations are not fulfilled in accordance with Section 6 of this Agreement, as reasonably determined by the City Manager, then after thirty (30) days written notice and opportunity to cure such a default, the City of Clearwater City Council may, at a meeting noticed to Developer and provided in accordance with the CDC, elect to take any or all of the following actions: 1. Administratively suspend any and all existing permits or development approvals and deny issuance of any new permits or approvals until the Developer has fulfilled its obligations; 2. In the event of a failure to meet or fulfill the requirements of Section 6.(A.), (B.), (C.), or (I), terminate this Agreement in part or its entirety and revoke the Reserve Units granted hereunder. Reserve Units revoked hereunder shall be returned to the Reserve for use by future development projects; 3. Terminate this Agreement in part or its entirety; 8 4. Seek specific performance of the Developer’s obligation in a court of competent jurisdiction; or 5. Amend the Agreement to adjust the obligations of the Developer if such amendment does not violate Florida law, the City’s comprehensive plan, or the CDC. SECTION 12. Other Terms and Conditions. During the Term of this Agreement, the City may apply laws and policies adopted subsequently to the Effective Date of this Agreement if the City has held a public hearing and determined: (a) They are not in conflict with the laws and policies governing this Agreement and do not prevent development of the land uses, intensities, or densities in this Agreement; (b) They are essential to the public health, safety, or welfare, and expressly state that they shall apply to a development that is subject to a development agreement; (c) They are specifically anticipated and provided for in this Agreement; (d) The City demonstrates that substantial changes have occurred in pertinent conditions existing at the time of approval of this Agreement; or (e) This Agreement is based on substantially inaccurate information provided by the Developer. SECTION 13. Compliance with the Law. The failure of this Agreement to address any particular permit, condition, term or restriction shall not relieve the Developer from the necessity of complying with the law governing such permitting requirements, conditions, terms or restrictions. SECTION 14. Notices. All notices and communications required or desired to be given under this Agreement shall be given to the Parties by hand delivery, by nationally recognized overnight courier service such as Federal Express, or by certified mail, return receipt requested, addressed as follows (copies as provided below shall be required for proper notice to be given): If to Developer: AP BEACH PROPERTIES LLC 648 Poinsettia Avenue Clearwater, Florida 33767 With a copy to: MACFARLANE FERGUSON & MCMULLEN P.A. Attn: Brian J. Aungst, Jr., Esq. 625 Court Street, Suite 200 Clearwater, Florida 33756 9 If to City: CITY OF CLEARWATER Attn: City Manager P.O. Box 4748 Clearwater, Florida 33758 With a copy to: CITY OF CLEARWATER Attn: City Attorney P.O. Box 4748 Clearwater, Florida 33758 Properly addressed, postage prepaid, notices or communications shall be deemed delivered and received on the day of hand delivery, the next business day after deposit with an overnight courier service for next day delivery, or on the third (3rd) day following deposit in the United States mail, certified mail, return receipt requested. The Parties may change the addresses set forth above (including the addition of a mortgagee to receive copies of all notices), by notice in accordance with this Section. SECTION 15. Assignment by Developer. A. During the Term of this Agreement, the Developer may only sell, convey, assign, or otherwise dispose of any or all of its right, title, interest and obligations in and to the Project, or any part thereof, with the prior written notice to the City, provided that such party (hereinafter referred to as the “assignee”), to the extent of the sale, conveyance, assignment or other disposition by the Developer to the assignee, shall be bound by the terms of this Agreement the same as the Developer for such part of the Project as is subject to such sale, conveyance, assignment or other disposition. B. If the assignee of the Developer’s right, title, interest and obligations in and to the Project, or any part thereof assumes all of the Developer’s obligations hereunder for the Project, or that part subject to such sale, conveyance, assignment or other disposition, then the Developer shall be released from all such obligations hereunder which have been so assumed by the assignee, and the City agrees to execute an instrument evidencing such release, which shall be in recordable form. SECTION 16. Successors and Assigns. The terms herein contained shall bind and inure to the benefit of the City, and its successors and assigns, and the Developer, their personal representatives, trustees, heirs, successors and assigns, except as may otherwise be specifically provided herein. SECTION 17. Minor Non-Compliance. The Developer will not be deemed to have failed to comply with the terms of this Agreement in the event such noncompliance, in the judgment of the City of Clearwater City Manager or their designee is of a minor or inconsequential nature. 10 SECTION 18. Covenant of Cooperation. The Parties shall cooperate with and deal with each other in good faith and assist each other in the performance of the provisions of this Agreement and in achieving the completion of development of the Property. SECTION 19. Approvals. Whenever an approval or consent is required under or contemplated by this Agreement such approval or consent shall not be unreasonably withheld, delayed or conditioned. All such approvals and consents shall be requested and granted in writing. SECTION 20. Completion of Agreement. Upon the completion of performance of this Agreement or its revocation or termination, a statement evidencing such completion, revocation, or termination shall be signed by the Parties and recorded in the official records of the City. SECTION 21. Entire Agreement. This Agreement (including any and all exhibits attached hereto all of which are a part of this Agreement to the same extent as if such exhibits were set forth in full in the body of this Agreement), constitutes the entire agreement between the Parties hereto pertaining to the subject matter hereof. SECTION 22. Construction. The titles, captions and section numbers in this Agreement are inserted for convenient reference only and do not define or limit the scope or intent and should not be used in the interpretation of any section, subsection or provision of this Agreement. Whenever the context requires or permits, the singular shall include the plural, and plural shall include the singular and any reference in this Agreement to the Developer includes the Developer’s successors or assigns. This Agreement was the production of negotiations between representatives for the City and the Developer and the language of the Agreement should be given its plain and ordinary meaning and should not be strictly construed against any party hereto based upon draftsmanship. If any term or provision of this Agreement is susceptible to more than one interpretation, one or more of which render it valid and enforceable, and one or more of which would render it invalid or unenforceable, such term or provision shall be construed in a manner that would render it valid and enforceable. SECTION 23. Partial Invalidity. If any term or provision of this Agreement or the application thereof to any person or circumstance is declared invalid or unenforceable, the remainder of this Agreement, including any valid portion of the invalid term or provision and the application of such invalid term or provision to circumstances other than those as to which it is held invalid or unenforceable, shall not be affected thereby and shall with the remainder of this Agreement continue unmodified and in full force and effect. Notwithstanding the foregoing, if such responsibilities of any party hereto, to the extent that the purpose of this Agreement or the benefits sought to be received hereunder are frustrated, such party shall have the right to terminate this Agreement upon fifteen (15) days written notice to the other party. SECTION 24. Code Amendments. Subsequently adopted ordinances and codes of the City which are of general application not governing the development of land shall be applicable to the Property, and such modifications are specifically anticipated in this Agreement. 11 SECTION 25. Governing Law and Venue. This Agreement shall be governed by, and construed in accordance with the laws of the State of Florida. The exclusive venue for any proceeding or suit in law or equity arising from or relating to this Agreement will be in Pinellas County, Florida. SECTION 26. Counterparts. This Agreement may be executed in counterparts, all of which together shall continue one and the same instrument. SECTION 27. Amendment. This Agreement may be amended by mutual written consent of the City and the Developer so long as the amendment meets the requirements of the Act, the CDC, the City’s comprehensive plan, any other applicable City ordinances, and Florida law. [ Signature Page(s) to Follow ] [ Rest of Page Intentionally Left Blank ] 12 IN WITNESS WHEREOF, the Parties have hereto executed this Agreement the date and year first above written. (DEVELOPER SIGNATURE PAGE) In the Presence of: AP BEACH PROPERTIES, LLC, a Florida limited liability company. _________________________________ Print Name: _______________________ By: __________________________ Address: __________________________ TOMASZ CIESIELSKI __________________________________ Title: Manager__________________ Date: _________________________ _________________________________ Print Name: _______________________ Address: __________________________ __________________________________ “WITNESSSES AS TO THE DEVELOPER” STATE OF FLORIDA ) COUNTY OF PINELLAS ) This Agreement was acknowledged before by means of _____ physical presence or _____ online notarization me this ____ day of _______________, 2025, by TOMASZ CIESIELSKI, as Manager of AP BEACH PROPERTIES, LLC, a Florida limited liability company, on behalf of the entity. He is ____ personally known to me or has ____ produced ____________________ as identification. _________________________________ NOTARY PUBLIC Print Name: _______________________ My Commission Expires: ____________ 13 (CITY SIGNATURE PAGE) Countersigned: CITY OF CLEARWATER, FLORIDA, a Florida municipal corporation. ___________________________ By: __________________________ Bruce Rector Jennifer Poirrier Mayor City Manager Date: ______________________ Date: ___________________________ Approved as to form: Attest: ___________________________ ________________________________ Matthew J. Mytych, Esq. Rosemarie Call Assistant City Attorney City Clerk Date: ______________________ Date: ____________________________ 14 EXHIBIT “A” LEGAL DESCRIPTION OF PROPERTY LOTS 1, 2, 3, 4, 5, 6, 8, 9, 10, 11 AND 12, COLUMBIA SUBDIVISION NO. 4, ACCORDING TO THE MAP OR PLAT THEREOF, AS RECORDED IN PLAT BOOK 27, PAGE 50 OF THE PUBLIC RECORDS OF PINELLAS COUNTY, FLORIDA. AND BEGINNING AT THE INTERSECTION OF THE HIGH WATER MARK OF THE GULF OF MEXICO AND THE EAST AND WEST CENTER LINE OF SECTION 8, TOWNSHIP 29 SOUTH, RANGE 15 EAST; AND RUN THENCE EAST ALONG THE EAST AND WEST CENTER LINE OF SAID SECTION 8, 164.38 FEET; THENCE SOUTH 1573.94 FEET; THENCE SOUTH 77°25’30” EAST, 280 FEET FOR A POINT OF BEGINNING; THENCE SOUTH 77°25’30” EAST, 10 FEET; THENCE SOUTH 12°34’30” WEST, 50.87 FEET; THENCE NORTH 77°25’30” WEST, 10 FEET; THENCE NORTH 12°34’30” EAST, 50.87 FEET TO A POINT OF BEGINNING, OTHERWISE DESCRIBED AS LOT 1-A OF COLUMBIA SUBDIVISION NO. 5, ACCORDING TO THE MAP OR PLAT THEREOF AS RECORDED IN PLAT BOOK 31, PAGE 16, PUBLIC RECORDS OF PINELLAS COUNTY, FLORIDA. CONTAINING 1.759 ACRES, MORE OR LESS. 15 COLLECTIVELY TAX PARCEL IDENTIFICATION NO. 08-29-15-17622-000-0100 EXHIBIT “B” Conceptual Site Plan See attached. 16 EXHIBIT “C” MANDATORY EVACUATION/CLOSURE COVENANT PLEASE RETURN RECORDED DOCUMENT TO: __________________________________________ __________________________________________ __________________________________________ DECLARATION OF COVENANTS AND RESTRICTIONS THIS DECLARATION OF COVENANTS AND RESTRICTIONS (this “Declaration”) is made and entered into as of this ____ day of _________________, 202__, by AP BEACH PROPERTIES, LLC, a Florida limited liability company (the “Developer”). WHEREAS, the Developer is the fee simple owner of certain real property located at 405 Coronado Drive, Clearwater, Florida 33767 more particularly described in Schedule “1” attached hereto and made a part hereof (the “Property”); and WHEREAS, the City of Clearwater, Florida (the “City”), has amended its comprehensive plan to designate Clearwater Beach as a community redevelopment district pursuant to the Pinellas County Planning Council rules in order to implement the provisions of Beach by Design, a plan for the revitalization of Clearwater Beach; and WHEREAS, the designation of Clearwater Beach as a community redevelopment district (the “Designation”) provides for the allocation of hotel density reserve units (“Reserve Units”) as an incentive for the development of quality hotels. Pursuant to the Designation, the allocation of Reserve Units is subject to compliance with a series of performance standards, including a requirement that hotels developed with Reserve Units shall be closed and all guests evacuated from such hotels as soon as practicable after the National Hurricane Center posts a hurricane watch that includes Clearwater Beach. The purpose of such evacuation is to ensure that such a hotel is evacuated in advance of the period of time when a hurricane evacuation would be expected in advance of the approach of hurricane force winds; and WHEREAS, the City has granted, by City Council Resolution ____________, passed and approved on ___________, 2025, the Developer’s hotel density reserve development agreement (the “Development Agreement”) providing for the allocation of Reserve Units for the development of a hotel project as provided for in the Development Agreement (the “Project”) and pursuant to the Designation, subject to the Developer’s compliance with the requirements of the Designation. Developer desires for itself, and its successors and assigns, as owner, to establish certain rights, duties, obligations and responsibilities with respect to the use and operation of the Property in accordance with the terms and conditions of the allocation of the Reserve Units by the City, the Development Agreement, and the Designation, which rights, duties, obligations and 17 responsibilities shall be binding on any and all successors and assigns and will run with the title to the Property. NOW THEREFORE, in consideration of the covenants and restrictions herein set forth and to be observed and performed, and in further consideration of the allocation of the Reserve Units to the Developer, and other good and valuable consideration, the sufficiency of which is hereby acknowledged, the Developer hereby declares, covenants and agrees as follows: 1. Benefit and Enforcement. These covenants and restrictions are made for the benefit of the Developer, its successors and assigns, and the residents of the City and shall be enforceable by Developer, its successors and assigns, and by the City for the benefit of its residents. 2. Definitions. As used herein, the terms “transient occupancy”, “public lodging establishment”, “hotel”, and “operator” shall have the meaning given to such terms in Chapter 509, Part I, Florida Statutes. 3. Effective Date. This Declaration shall become effective upon issuance of all building permits required to build the Project and Developer’s commencement of construction of the Project as evidenced by a Notice of Commencement for the Project. This Declaration shall expire and terminate automatically if and when the allocation of Reserve Units to the Developer expires or is terminated. 4. Covenant of Development, Use, and Operation. The Developer hereby covenants and agrees to the development, use and operation of the Property in accordance with the provisions of this Declaration. The use of the Project on the Property is restricted as follows: A. 135 units, 100 of which are Reserve Units, shall be used solely for transient occupancy of one (1) month or thirty-one (31) consecutive days or less, must be licensed as a public lodging establishment and classified as a hotel, and must be operated by a single licensed operator. No unit shall be used as a primary or permanent residence. Access to the units must be provided through a lobby and internal corridor. A reservation system shall be required as an integral part of the hotel component of the Project and there shall be a lobby/front desk area that must be operated as a standard lobby/front desk area for a hotel would be operated. All units shall be required to be submitted to a rental program requiring the units to be available for members of the public as overnight hotel guests on a transient basis at all times. No unit shall have a complete kitchen facility as that term is used in the definition of “dwelling unit” in the City of Clearwater Community Development Code (the “CDC”). Mini kitchens as defined in Beach by Design are permitted. Developer shall make available for inspection to authorized representatives of the City its books and records pertaining to each unit upon reasonable notice to confirm compliance with these 18 regulations as allowed by general law. The Developer agrees to comply with the Design Guidelines as set forth in Section VII of Beach by Design. B. Public Parking. The Project shall include and maintain fifty (50) public parking spaces on site for the life of the Project. C. Closure of Improvements and Evacuation. The hotel component of the Project developed on the Property shall be closed as soon as practicable upon the issuance of a hurricane watch by the National Hurricane Center, which hurricane watch includes Clearwater Beach. All Hotel guests, visitors, and employees other than emergency and security personnel required to protect the hotel component of the Project, shall be evacuated from the hotel as soon as practicable following the issuance of said hurricane watch. In the event that the National Hurricane Center shall modify the terminology employed to warn of the approach of hurricane force winds, the closure and evacuation provisions of this Declaration shall be governed by the level of warning employed by the National Hurricane Center which precedes the issuance of a forecast of probable landfall in order to ensure that the guests, visitors, and employees will be evacuated in advance of the issuance of a forecast of probable landfall. 5. Governing Law and Venue. This Declaration shall be governed by and construed in accordance with the laws of the State of Florida. The exclusive venue for any proceeding or suit in law or equity arising from or relating to this Agreement will be in Pinellas County, Florida. 6. Recording. This Declaration shall be recorded in Public Records of Pinellas County, Florida. 7. Attorneys’ Fees. The Developer shall reimburse the City for any expenses, including reasonable attorneys’ fees, which are incurred by the City in the event that the City determines that it is necessary and appropriate to seek judicial enforcement of this Declaration and the City obtains relief, whether by agreement of the parties or through order of a court of competent jurisdiction. 8. Severability. If any provision, or part thereof, of this Declaration or the application of this Declaration to any person or circumstance will be or is declared to any extent to be invalid or unenforceable, the remainder of this Declaration, or the application of such provision or portion thereof to any person or circumstance, shall not be affected thereby, and each and every other provision of this Declaration shall be valid and enforceable to the fullest extent permitted by law. [ Signature Page(s) to Follow ] [ Rest of Page Intentionally Left Blank] 19 IN WITNESS WHEREOF, the parties have hereto executed this Declaration on the date and year first above written. (DECLARATION—DEVELOPER SIGNATURE PAGE) In the Presence of: AP BEACH PROPERTIES, LLC, a Florida limited liability company _________________________________ Print Name: _______________________ By: __________________________ Address: __________________________ Tomasz Ciesielski, Manager _________________________________ Date: _________________________ _________________________________ Print Name: _______________________ Address: __________________________ __________________________________ “AS TO DEVELOPER” STATE OF FLORIDA ) COUNTY OF PINELLAS ) The foregoing declaration was acknowledged before by means of _____ physical presence or _____ online notarization me this ____ day of _______________, 2025, by TOMASZ CIESIELSKI, as Manager of AP BEACH PROPERTIES, LLC, a Florida limited liability company, on behalf of the entity. He is ____ personally known to me or has ____ produced ____________________ as identification. _________________________________ NOTARY PUBLIC Print Name: _______________________ My Commission Expires: ____________ 20 (DECLARATION—CITY SIGNATURE PAGE) Countersigned: CITY OF CLEARWATER, FLORIDA, a Florida municipal corporation. ___________________________ By: __________________________ Bruce Rector Jennifer Poirrier Mayor City Manager Date: ______________________ Date: ___________________________ Approved as to form: Attest: ___________________________ ________________________________ Matthew J. Mytych, Esq. Rosemarie Call Assistant City Attorney City Clerk Date: ______________________ Date: ____________________________ 21 SCHEDULE “1” TO DECLARATION Legal Description LOTS 1, 2, 3, 4, 5, 6, 8, 9, 10, 11 AND 12, COLUMBIA SUBDIVISION NO. 4, ACCORDING TO THE MAP OR PLAT THEREOF, AS RECORDED IN PLAT BOOK 27, PAGE 50 OF THE PUBLIC RECORDS OF PINELLAS COUNTY, FLORIDA. AND BEGINNING AT THE INTERSECTION OF THE HIGH WATER MARK OF THE GULF OF MEXICO AND THE EAST AND WEST CENTER LINE OF SECTION 8, TOWNSHIP 29 SOUTH, RANGE 15 EAST; AND RUN THENCE EAST ALONG THE EAST AND WEST CENTER LINE OF SAID SECTION 8, 164.38 FEET; THENCE SOUTH 1573.94 FEET; THENCE SOUTH 77°25’30” EAST, 280 FEET FOR A POINT OF BEGINNING; THENCE SOUTH 77°25’30” EAST, 10 FEET; THENCE SOUTH 12°34’30” WEST, 50.87 FEET; THENCE NORTH 77°25’30” WEST, 10 FEET; THENCE NORTH 12°34’30” EAST, 50.87 FEET TO A POINT OF BEGINNING, OTHERWISE DESCRIBED AS LOT 1-A OF COLUMBIA SUBDIVISION NO. 5, ACCORDING TO THE MAP OR PLAT THEREOF AS RECORDED IN PLAT BOOK 31, PAGE 16, PUBLIC RECORDS OF PINELLAS COUNTY, FLORIDA. CONTAINING 1.759 ACRES, MORE OR LESS. COLLECTIVELY TAX PARCEL IDENTIFICATION NO. 08-29-15-17622-000-0100 22 EXHIBIT “D” COVENANT OF UNIFIED USE PLEASE RETURN RECORDED DOCUMENT TO: __________________________________________ __________________________________________ __________________________________________ COVENANT OF UNIFIED USE THIS COVENANT OF UNIFIED USE (this “Covenant”) is executed this ____ day of _____________, 20__, by (the “Developer”). W I T N E S S E T H : WHEREAS, the Developer is the owner of the real property located at 405 Coronado Drive, Clearwater, Florida 33767 more particularly described on Schedule “1” attached hereto and incorporated herein by reference (the “Property”); and WHEREAS, the Developer and the City of Clearwater, Florida (the “City”) are parties to that certain Hotel Density Reserve Development Agreement dated the ____ day of ____________, 20__ (the “Agreement”), pursuant to which the City has agreed that Developer may develop and construct upon the Real Property a hotel project as described in the Agreement (the “Project”); and WHEREAS, Developer intends to develop and operate the Property for a unified use, as more particularly described in this Covenant. NOW, THEREFORE, in consideration of the sum of Ten Dollars ($10.00) and other good and valuable consideration, the receipt and sufficiency of which are hereby acknowledged, Developer does hereby agree that, effective as of the date on which Developer receives all permits required to construct the Project and Developer commences construction thereof, as evidenced by a Notice of Commencement for the Project, the Real Property shall be developed and operated as a hotel project, as described in the Agreement. The restrictions set forth in the preceding sentence shall expire automatically when and if the Developer’s allocation of additional hotel density reserve units (as defined in the Agreement) expires or is terminated. Nothing in this Covenant shall require Developer to develop the Project or restrict Developer’s ability to sell, assign, transfer or otherwise convey its right in and to the Real Property or any portion or portions thereof to unrelated third-parties. Developer agrees that the City shall have the right to enforce the terms and conditions of this Covenant. IN WITNESS WHEREOF, the parties have hereto executed this Covenant the date and year first above written. 23 (COVENANT—DEVELOPER SIGNATURE PAGE) In the Presence of: AP BEACH PROPERTIES, LLC, a Florida limited liability company _________________________________ Print Name: _______________________ By: __________________________ Address:__________________________ Tomasz Ciesielski, Manager _________________________________ Date: _________________________ _________________________________ Print Name: _______________________ Address:__________________________ _________________________________ STATE OF FLORIDA ) COUNTY OF PINELLAS ) The foregoing declaration was acknowledged before by means of _____ physical presence or _____ online notarization me this ____ day of _______________, 2025, by TOMASZ CIESIELSKI, as Manager of AP BEACH PROPERTIES, LLC, a Florida limited liability company, on behalf of the entity. He is ____ personally known to me or has ____ produced ____________________ as identification. _________________________________ NOTARY PUBLIC Print Name: _______________________ My Commission Expires: ____________ 24 (COVENANT—CITY SIGNATURE PAGE) Countersigned: CITY OF CLEARWATER, FLORIDA, a Florida municipal corporation. ___________________________ By: __________________________ Bruce Rector Jennifer Poirrier Mayor City Manager Date: ______________________ Date: ___________________________ Approved as to form: Attest: ___________________________ ________________________________ Matthew J. Mytych, Esq. Rosemarie Call Assistant City Attorney City Clerk Date: ______________________ Date: ____________________________ 25 SCHEDULE “1” TO COVENANT Legal Description LOTS 1, 2, 3, 4, 5, 6, 8, 9, 10, 11 AND 12, COLUMBIA SUBDIVISION NO. 4, ACCORDING TO THE MAP OR PLAT THEREOF, AS RECORDED IN PLAT BOOK 27, PAGE 50 OF THE PUBLIC RECORDS OF PINELLAS COUNTY, FLORIDA. AND BEGINNING AT THE INTERSECTION OF THE HIGH WATER MARK OF THE GULF OF MEXICO AND THE EAST AND WEST CENTER LINE OF SECTION 8, TOWNSHIP 29 SOUTH, RANGE 15 EAST; AND RUN THENCE EAST ALONG THE EAST AND WEST CENTER LINE OF SAID SECTION 8, 164.38 FEET; THENCE SOUTH 1573.94 FEET; THENCE SOUTH 77°25’30” EAST, 280 FEET FOR A POINT OF BEGINNING; THENCE SOUTH 77°25’30” EAST, 10 FEET; THENCE SOUTH 12°34’30” WEST, 50.87 FEET; THENCE NORTH 77°25’30” WEST, 10 FEET; THENCE NORTH 12°34’30” EAST, 50.87 FEET TO A POINT OF BEGINNING, OTHERWISE DESCRIBED AS LOT 1-A OF COLUMBIA SUBDIVISION NO. 5, ACCORDING TO THE MAP OR PLAT THEREOF AS RECORDED IN PLAT BOOK 31, PAGE 16, PUBLIC RECORDS OF PINELLAS COUNTY, FLORIDA. CONTAINING 1.759 ACRES, MORE OR LESS. COLLECTIVELY TAX PARCEL IDENTIFICATION NO. 08-29-15-17622-000-0100 Cover Memo City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 File Number: ID#24-1489 Agenda Date: 1/16/2025 Status: Public HearingVersion: 1 File Type: Action ItemIn Control: Public Works Agenda Number: 7.2 SUBJECT/RECOMMENDATION: Authorize a Guaranteed Maximum Price (GMP) proposal from Creative Contractors, Inc., of Clearwater, FL, for the Long Center Renovation project (21-0026-PR) in the amount of $14,504,354.00 increasing the purchase order total to $14,590,729.00; authorize an increase to Wannemacher Jensen Architects (WJA) of St Petersburg, FL for supplemental work order 2 in the amount of $298,380.00, increasing the purchase order to $1,117,296.00 pursuant to RFQ 08-23, and authorize the appropriate officials to execute same. SUMMARY: The Long Center was issued a certificate of occupancy in 1990 and was operated by the Long Center Foundation until the City took ownership and responsibility for its operation in 2003. The Long Center is unique as it is one of the few indoor climate controlled competitive Olympic sized pools and therapy pools in Florida. The natatorium’s existing heating ventilation and air conditioning (HVAC) system is unable to adequately handle the latent and sensible heat load caused by the indoor pool environment along with the natatorium’s hollow structural steel (HSS) and non-insulated glass wall building envelope, resulting in corrosion of the structural framing members. On August 3, 2023, City Council approved Wannemacher Jensen Architects (WJA) for design services pursuant to Request for Qualification (RFQ) 08-23 and approved a work order in the amount of $203,951.00 for development of two schematic level design options for the pool renovation. On March 7, 2024, City Council approved WJA to complete Construction Documents based on the chosen schematic level design option and supplemental one work order in the amount of $614,965.00 increasing the purchase order amount to $818,916.00. Additionally, City Council approved a preconstruction proposal from Creative Contractors in the amount of $86,375.00 pursuant to RFQ 07-24. Supplemental two work order provides for construction administration and inspection, subsurface soil exploration, and design of relocating the stormwater system and potable water mains which will be affected by the addition of an enclosed Sun Deck. The GMP is for the construction of a renovated natatorium building including weld repairs of the corroded structural framing, replacement of the single pane window system with an insulated glass curtain wall rated for wind and large missile impact, a new reflective TPO membrane roof complete with a Solar PV array (25 KW AC), a new roof top HVAC / dehumidification system, replacement of pool room equipment for treating the pool water and the construction a 1700 sq ft air-conditioned “Sun Deck” addition. GMP development included value engineering (VE) related to elimination of the resurfacing of the pool deck, replacement of gutter drains, elimination of Roof Top HVAC visual screening, phasing of the solar PV array, and elimination of the saltwater pool system option. This VE exercise resulted in savings totaling over $1 million. All costs associated with the solar array (conduit, panels, inverters, labor, etc.) are eligible for a 30% cash back reimbursement through the Inflation Reduction Act (IRA) elective pay program, with Page 1 City of Clearwater Printed on 1/14/2025 File Number: ID#24-1489 this project’s credit estimated at $49,000.00. The construction duration was reduced by 80 days with anticipated general conditions savings. Renovation of the Long Center Natatorium is expected to commence in February of 2025, with a substantial completion occurring spring of 2026. Total project costs, including design, construction, and FFE are estimated at $17.3 million. This also includes HVAC replacement at the Aging Well Center which will come back as a future agenda item. This project is funded with $5 million of Penny revenue and $12.5 million of General Fund revenue. APPROPRIATION CODE AND AMOUNT: 3157572-561100-C2202 $ 298,380.00 3157572-563600-C2202 $14,504,354.00 Funds are available in capital improvement project 315-C2202, Long Center Major Renovation, to fund this contract. This is funded by General Fund and Penny for Pinellas Revenues. STRATEGIC PRIORITY: Maintain public infrastructure, mobility systems, natural lands, environmental resources, and historic features through systematic management efforts. The Long Center’s natatorium needs structural repairs and replacement of the building envelope and air-conditioning system to prevent further deterioration of the structure. Adopt renewable resource usage and waste reduction practices to ensure a vibrant City for current and future generations. Lower the carbon footprint of the facility by incorporating a solar photovoltaic array on top of a new energy efficient natatorium building envelope. Support neighborhood identity through services and programs that empower community pride and belonging. Enhance employee health and productivity through a holistic approach to workplace wellness and benefit resources. Improve the indoor air quality of the natatorium by providing appropriate air conditioning and fresh air quantities. Page 2 City of Clearwater Printed on 1/14/2025 Long Center Natatorium Renovation Guaranteed Maximum Price (GMP) Report November 26, 2024 Table of Contents 1 Cost Summary 2 Cost Comparison 3 Detailed Estimate 4 General Requirements 5 General Conditions 6 Allowance Log 7 Project Schedule 8 RFI Log 9 Qualifications, Clarifications, and Assumptions 10 Drawing Log Tab 1 COST SUMMARY DESCRIPTION COSTSF $/SFCONSTRUCTION COST OF THE WORK SUMMARY27,350 1Building Modifications9,009,587$ 2Swimming Pool Equipment Replacement- Completive Pool UV Filter, Inlet/out Replacement Valves 1,441,958$ 3Sundeck Alternate 4Photovoltaics163,479$ Option #35 Escalation 0.00% -$ - -$ 6Design Evolution Contingency / Permit Comments 3.00%318,451$ - SUBTOTAL COST OF THE WORK (COW):10,933,475$ 399.76$ SDI 1.25%136,668$ GENERAL COSTS SUMMARYGeneral Conditions 622,951$ General Requirements324,886$ SUBTOTAL COW & GENERAL COSTS: 12,017,980$ SUBTOTAL COSTS: 12,017,980$ Builders Risk Insurance 0.35% 42,063$ AllowanceLiability Insurance 0.62% 74,511$ Pollution Liability By OwnerTeam Contingency 3% owner 3% CMAR 6.00% 721,079$ SUBTOTAL:12,855,633$ Construction Management Fee 5.00% 642,782$ Payment & Performance Bond 0.72% 97,189$ TOTAL GMP AMOUNT13,595,604$ 497.10$ Alternates1 Sundeck 908,750$ Accepted Total with the Sun Deck Alternate14,504,354$ 2Remove Painting of the deck from the base bid(560,500)$ Allowance CREATIVE CONTRACTORS, INC.Long CenterNovember 26, 2024Guaranteed Maximum Price PROJECT COST SUMMARY1 of 1 Tab 1-A COST SUMMARY-SUNDECK DESCRIPTION COSTSF $/SFCONSTRUCTION COST OF THE WORK SUMMARY1,500 1Building Modifications535,312$ 2Site Work (Allowance) 175,000$ 3 Design Evolution Contingency / Permit Comments 2.50% 17,758$ - SUBTOTAL COST OF THE WORK (COW): 728,070$ 485.38$ SDI 1.25%9,101$ GENERAL COSTS SUMMARYGeneral Conditions 45,560$ General Requirements23,206$ SUBTOTAL COW & GENERAL COSTS: 805,937$ SUBTOTAL COSTS PLUS FEE: 805,937$ Builders Risk Insurance By OwnerLiability Insurance 0.62% 4,997$ Pollution Liability By OwnerTeam Contingency 3% owner 3% CMAR 6.00% 48,356$ SUBTOTAL: 859,290$ Construction Management Fee 5.00% 42,964$ Payment & Performance Bond 0.72% 6,496$ TOTAL GUARANTEED MAXIMUM PRICE908,750$ 605.83$ CREATIVE CONTRACTORS, INC.Long CenterNovember 26, 2024Guaranteed Maximum Price PROJECT COST SUMMARY SUNDECK ALTERNATE1 of 1 Tab 2 COST COMPARISON Division Description Costs $/SF Costs $/SF Delta9/5/2024 27350 11/26/2024 27,35031 00 00Demolition-$ 269,490$ 9.85$ 269,490.00$ 32 00 00Landscaping & Irrigation70,000$ 2.56$ 60,000$ 2.19$ (10,000.00)$ 03 00 00Concrete54,770$ 2.00$ 182,852$ 6.69$ 128,082.00$ 04 20 00Masonry-$ -$ 50,725$ 1.85$ 50,725.00$ 05 12 00Structural & Misc. Steel1,457,965$ 53.31$ 585,539$ 21.41$ (872,426.00)$ 06 10 00Rough Carpentry13,675$ 0.50$ 92,961$ 3.40$ 79,285.75$ 07 54 00Roofing-$ -$ 548,884$ 20.07$ 548,884.00$ 07 92 00Firestopping & Joint Sealants96,503$ 3.53$ 131,868$ 4.82$ 35,365.00$ 08 11 00Doors, Frames & Hdwre-$ -$ 9,000$ 0.33$ 9,000.00$ 08 80 00Glass 1,294,625$ 47.34$ 1,024,960$ 37.48$ (269,665.00)$ 09 21 16Drywall & Metal Framing / Stucco553,025$ 20.22$ 863,545$ 31.57$ 310,520.00$ 09 51 00Acoustical Ceilings-$ 40,320$ 1.47$ 40,320.00$ 09 60 00Flooring / Sills-$ 25,150$ 0.92$ 25,150.00$ 09 90 00Painting1,194,903$ 43.69$ 1,135,205$ 41.51$ (59,697.43)$ 10 00 00Specialties / Signage105,000$ 3.84$ 82,000$ 3.00$ (23,000.00)$ 11 49 00Photovoltaics-$ 163,479$ 5.98$ 163,479.00$ 13 10 00Pool Equipment180,000$ 6.58$ 1,442,861$ 52.76$ 1,262,861.00$ 21 00 00Fire Protection 68,375$ 2.50$ -$ -$ (68,375.00)$ 22 00 00Plumbing-$ 97,250$ 3.56$ 97,250.00$ 23 00 00HVAC2,641,000$ 96.56$ 3,044,300$ 111.31$ 403,300.00$ 26 00 00Electrical 683,750$ 25.00$ 508,812$ 18.60$ (174,938.00)$ 01 00 00Surveying & Material Testing-$ 20,000$ 0.73$ 20,000.30$ 01 00 00Permits & Insurance-$ -$ By Owner-$ -$ 01 00 00Temporary Construction87,982$ 3.22$ 235,823$ 8.62$ 147,841.48$ 00 00 00Design Evolution Contingency / Permit Comments471,412$ 17.24$ 318,451$ 11.64$ (152,961.45)$ 00 00 00SUBTOTAL CONSTRUCTION COSTS8,972,984$ 10,933,475$ 399.76$ 1,960,490.65$ 00 00 00SDI Insurance112,162$ 4.10$ 136,668$ 5.00$ 24,506.13$ 00 00 00Total General Conditions536,011$ 19.60$ 622,951$ 22.78$ 86,939.35$ 00 00 00Total General Requirements247,509$ 9.05$ 324,886$ 11.88$ 77,377.58$ 00 00 00Professional / Pollution Liability-$ -$ 00 00 00Builders Risk Insurance-$ -$ 42,063$ 42,063$ Long Center NatatoriumCost Comparison11/21/2024DD GMPPage 1 Division Description Costs $/SF Costs $/SF DeltaLong Center NatatoriumCost Comparison11/21/2024DD GMP00 00 00Liability Insurance 74,607$ 2.73$ 74,511$ 2.72$ (95.64)$ 00 00 00Owner / CMAR Contingency621,726$ 22.73$ 721,079$ 26.36$ 99,352.82$ 00 00 00Construction Management Fee493,433$ 18.04$ 642,782$ 23.50$ 149,348.35$ 00 00 00 Payment & Performance Bond79,621$ 2.91$ 97,189$ 3.55$ 17,567.87$ 00 00 00SUBTOTAL GENERAL COSTS2,165,069$ 2,662,129$ 97.34$ 497,059.39$ Total GMP 11,138,054$ 407.24$ 13,595,604$ 497.10$ 2,457,550.04$ AlternatesSundeck648,730$ 908,750$ incl site allowance260,020.39$ 1 Roofing 878,539$ included 2 Hydraulic Bifold Doors 264,344 $ included 3 Photovoltaic -$ included 4 Pool Equipment Replacement 1,707,901 $ included5 On Deck Pumps / Chemical for pool during Renovation152,057$ included Total With Accepted Alternates14,789,625$ 540.75$ 14,504,354$ 530.32$ (285,270.57)$ Page 2 Tab 3 DETAILED ESTIMATE JOB TITLE:DATE:JOB LOCATION:SQFT:ESTIMATE TITLE:DURATION:420.0days6/3/2024============================================= ======== ========= ========= ========== ========== ========== ============ =========== ================ ========== ==========UNIT TTL UNIT TTL UNIT TOTALDESCRIPTION QUAN UNT LAB LAB MAT'L MAT'L SUB SUB TOTAL $/SF % TTL====== ===================================================== ========= ========= ========== ========== ========== ============ =========== ================ ========== ==========DemolitionDemolition 1 lsum - - 238,740.00 238,740 238,740 $8.73 2.2%Mobilization 1 each - - included - - $0.00 0.0%Additional mobilization 7 mobs - - 1250 8,750 8,750 $0.32 0.1%Cutting of deck 1 lsum - - included - - $0.00 0.0%Removal of roof curbs 11 each - - included - - $0.00 0.0%Removal of changing rooms 1 lsum - - 2000 2,000 2,000 $0.07 0.0%Removal of shade structure 1 lsum - - 5000 5,000 5,000 $0.18 0.0%Patch and repair mechanical yard slab 1 lsum - - 5000 5,000 5,000 $0.18 0.0%Existing glazing system 1 lsum - - included - - $0.00 0.0%Removal and reinstall scoreboards 2 each - - 5000 10,000 10,000 $0.37 0.1%Mechanical Demo 1 lsum - - included - - $0.00 0.0%CMU Demo 1 lsum - - included - - $0.00 0.0%Demolition Subtotal269,490 $9.852.5%Concrete03300 Concrete for Mechanical Chases 1 lsum - - 98,644.00 98,644 98,644 $3.61 0.9%03300 Termite Treatment 200 sqft - - 0.35 70 70 $0.00 0.0%03300 Surge Tank 1 sqft - - included - - $0.00 0.0%03300 Slab Curb @ Interior Drywall 496 lnft - - 50 24,800 24,800 $0.91 0.2%03300 House Keeping Pads @ Pool Equipment 1 lsum - - 7500 7,500 7,500 $0.27 0.1%03300 Thickened Curbs 12 cy - - 850 10,200 10,200 $0.37 0.1%03300 Dewater at surge tank 2 mo - - 9500 19,000 19,000 $0.69 0.2%03300 Misc Patching/Sidewalk repair 2,058 allowance - - 11 22,638 22,638 $0.83 0.2%Concrete Subtotal182,852 $6.691.7%Masonry 04220 Masonry Trade Subcontractor 1 lsum - - in sundeck - - $0.00 0.0%04220 8" CMU 1 sqft - - Included - - $0.00 0.0%04220 12" CMU 1 sqft - - Included - - $0.00 0.0%04220 Block @ Balcony 72 sqft - - 150 10,800 10,800 $0.39 0.1%04220 Repair and repoint CMU knee wall 503 allowance - - 75 37,725 37,725 $1.38 0.4%04220 Misc. Concrete / Masonry 1 lsum - - 2,200 2,200 2,200 $0.08 0.0%Masonry Subtotal50,725 $1.850.5%Structural Steel05400Structural Steel 1 lsum - - 363,639 363,639 363,639 $13.30 3.4%05400Steel Mechanical Chase 2 each - - included - - $0.00 0.0%05400 North Side/east/west Steel Modifications and Demo1 allowance - - 132,600 132,600 132,600 $4.85 1.2%05400 Steel repair and paint 4,200 allowance - - included - - $0.00 0.0%05400 Roof Ladder from Low to High Roof 1 each - - 12,500 12,500 12,500 $0.46 0.1%05400 SS Eye Bolts for Banners 48 each - - 250 12,000 12,000 $0.44 0.1%05400 RTU Platforms 1,560 sqft - - included - - $0.00 0.0%05400 Patching of existing RTU curbs 11 each - - 600 6,600 6,600 $0.24 0.1%05400 Steel anchors @ Sills 470 lnft - - 60 28,200 28,200 $1.03 0.3%05400 Touch up Steel 1 allowance - - 20,000 20,000 20,000 $0.73 0.2%05400 Misc. Metals 1 lsum - - 10,000 10,000 10,000 Structural Steel Subtotal585,539 $21.415.5%Rough Carpentry06100 Plywood Backboards 2 each - - N/A - - $0.00 0.0%06101 Misc Blocking and carpentry 27,350 sqft - 0.50 13,675 0.75 20,513 34,188 $1.25 0.3%06102 Roof Blocking 3,212 lnft - - 18.00 57,816 57,816 $2.11 0.5%Rough Carpentry Subtotal92,004 $3.360.9%Roofing07500 TPO 1 lsum - - 521884.00 521,884 521,884 $19.08 4.9%07500 Demo Existing 28,500 sqft included - - $0.00 0.0%07500 Polyiso Insulation spec'd at R-25 1 lsum - - included - - $0.00 0.0%07500 Metal Roofing 10 each - - included - - $0.00 0.0%07500 Coping/Cap-Flashing & Trim - .050 Kynar 1 lsum - - included- - $0.00 0.0%07500 Demo Existing 28,500 sqft included - - $0.00 0.0%07500 Chemical Enclosure 1 allowance 25000.00 25,000 25,000 $0.91 0.2%07500 PV Anchors 216 each - - N/A - - $0.00 0.0%07500 Photovoltaic Panels 1 lsum - - 163479.00 163,479 163,479 $5.98 1.5%07500 Photovoltaic Panels Extend to 20 year Warranty1 lsum - - 2000.00 2,000 2,000 $0.07 0.0%07500 Photovoltaic Roof Clasps 216 each - - Surface Mount - - $0.00 0.0%Roofing Subtotal712,363 $26.056.7%Wtr Pr-Firestopping & Joint Sealants07900 Waterproofing @ Decorative Elements 7,240 sqft - - 6.50 47,060 47,060 $1.72 0.4%07900 Misc Waterproofing / Damproofing 27,350 sqft - - 1.00 27,350 27,350 $1.00 0.3%07900 Cementitious waterproofing at knee wall 3 sqft - - 7.50 23 23 $0.00 0.0%07900 Peel and Stick Air Barrier 1 lsum - - in drywall - - $0.00 0.0%07900 Point/patching 27,350 allowance - - 0.95 25,983 25,983 $0.95 0.2%07900 Joint Sealants 27,350 sqft - 1.15 31,453 31,453 $1.15 0.3%131,868 $4.821.2%Doors, Frames & Hdwre08111 Door & Hardware Supplier 1 lsum - - In Glass - - $0.00 0.0%08111 Door Labor 1 lsum - - In Glass - - $0.00 0.0%08111 Access Doors 6 each - - 1500.00 9,000 9,000 $0.33 0.1%08111 Finish Hardware 1 lsum - - In Glass - - $0.00 0.0%Doors, Frames & Hdwre Subtotal9,000 $0.330.1%Glass08800 Exterior Aluminum Curtainwall & Interior Glazing 1 lsum - - 778,439 778,439 778,439 $28.46 7.3%08800 Demo of the Existing System sqft - - in demo - - $0.00 0.0%08800 Storefront Doors w/ Hardware each - - included - - $0.00 0.0%08800 Hydraulic Bifold Doors 2 each - - 112,010.50 224,021 224,021 $8.19 2.1%88000 Curtainwall / Glass Water Testing 3 allowance 7,500 22,500 22,500 $0.82 0.2%Glass Subtotal1,024,960 $37.489.7%Wtr Pr-Firestopping & Joint Sealants SubtotalLong Center11/26/24Clearwater27,350 GMPPage 1 of 3 JOB TITLE:DATE:JOB LOCATION:SQFT:ESTIMATE TITLE:DURATION:420.0days6/3/2024============================================= ======== ========= ========= ========== ========== ========== ============ =========== ================ ========== ==========UNIT TTL UNIT TTL UNIT TOTALDESCRIPTION QUAN UNT LAB LAB MAT'L MAT'L SUB SUB TOTAL $/SF % TTL====== ===================================================== ========= ========= ========== ========== ========== ============ =========== ================ ========== ==========Long Center11/26/24Clearwater27,350 GMPDrywall & Metal Framing09100 Drywall & Mtl Stud Trade Subcontractor 1 lsum - - 643,795.00 643,795 643,795 $23.54 6.1%09100 Exterior Framing @ Chases / Sheathing 1,850 sqft - - included - - $0.00 0.0%09100 Exterior Framing @ Decorative Elements 5,800 sqft - - included - - $0.00 0.0%09100 Gypsum Ceilings 1 sqft - - n/a - - $0.00 0.0%09222 Insulation 1 lsum - - included - - $0.00 0.0%Drywall & Metal Framing Subtotal643,795 $23.546.1%Stucco09222 Stucco 1 lsum - - 209750.00 209,750 209,750 $7.67 2.0%09222 Stucco @ Shafts 1,850 sqft - - included - - $0.00 0.0%09222 Stucco @ Decorative elements 5,800 sqft - - included - - $0.00 0.0%09222 Misc. Stucco 1 lsum - - 10000.00 10,000 10,000 $0.37 0.1%09222 Scaffolding 1 lsum - - included - - $0.00 0.0%Stucco Subtotal219,750 $8.032.1%Ceramic & Porcelain Tile09649 Tile Trade Subcontractor sqft - - N/A - - $0.00 0.0%09649 Ceramic Floor & Wall Tile sqft - - N/A - - $0.00 0.0%09649 Solid Surface Sills 1,006 sqft - - 25.00 25,150 25,150 $0.92 0.2%Ceramic & Porcelain Tile Subtotal25,150 $0.920.2%Acoustical Ceilings09500 Acoustical Ceilings Trade Subcontractor 27,350 sqft - - N/A - - $0.00 0.0%09500 Tectum Panels 2,016 sqft - - 20.00 40,320 40,320 $1.47 0.4%09500 Baffles 18 each - - N/A - - $0.00 0.0%Acoustical Ceiling Sub Total40,320 $1.470.4%Flooring09651 Floor Protection 27,350 sqft - - n/a - - $0.00 0.0%09651 Deck Coating 8,602 sqft - - n/a - - $0.00 0.0%09651 Floor Prep Allowance 1 sqft - - n/a - - $0.00 0.0%Flooring Subtotal- $0.000.0%Painting09900 Painting 1 lsum - - 291,971.00 291,971 291,971 $10.68 2.8%09900 Interior Painting 30,000 sqft - - included - - $0.00 0.0%09900 Exterior Painting @ Shafts 1,850 sqft - - included - - $0.00 0.0%09900 Exterior Painting @ Decorative Elements 5,800 sqft - - included - - $0.00 0.0%09900 Interior Painting Deck 27,350 sqft - - included - - $0.00 0.0%09900 Paint @ work platforms/railings on roof 1 lsum - - included - - $0.00 0.0%09900 Sand Blast Deck 1 lsum - - n/a - - $0.00 0.0%09900 Scissor Lifts 1 lsum - - included - - $0.00 0.0%Scaffolding - - - - $0.00 0.0%09901 Erection, dismantle, freight 1 months - 242129.46 242,129 - 242,129 $8.85 2.3%09901 Daily Rental 121 days - 1489.54 180,234 - 180,234 $6.59 1.7%09901 Ventilation 6 months 1600 9,600 8000 48,000 - 57,600 $2.11 0.5%09901 Scaffolding stairs 1 lsum - included - - - $0.00 0.0%09900 Heavy Visqueen under scaffolding planks 22,500 sqft - 1 22,500 2.00 45,000 67,500 $2.47 0.6%09900 Tarps @ scaffolding planks 22,500 sqft - - 4.00 90,000 90,000 $3.29 0.8%09900 Heavy Visqueen covering for pool 11,000 sqft - 1 11,000 4.00 44,000 55,000 $2.01 0.5%09900 Relocate heavy visqueen 1/2 pool 11,000 sqft - - 1.50 16,500 16,500 $0.60 0.2%09900 Side enclosure tarps @ scaffoldings 2,520 sqft - - 8.00 20,160 20,160 $0.74 0.2%09900 Clean after painting 1 lsum - - 15000.00 15,000 15,000 $0.55 0.1%09900 Relocate side enclosure tarps 5 each - - 5000.00 25,000 25,000 $0.91 0.2%09901 Misc. Painting @ trusses 1 lsum - - 35,000 35,000 35,000 $1.28 0.3%Painting Subtotal1,096,095 $40.0810.3%Specialties10800 Louvers @ Decorative Elements 20 each - - 350 7,000 7,000 $0.26 0.1%10400 Fire Extinguishers and Cabinets 1 lsum - - Existing - - $0.00 0.0%10400 Knox Box 1 each - - Existing - - $0.00 0.0%Specialties Subtotal7,000 $0.260.1%Commercial Signage & Graphics10400 Monument Sign 1 lsum - - Existing - - $0.00 0.0%10400 Cast in aluminum backlit letters 1 allowance - - 75,000 75,000 75,000 $2.74 0.7%Commercial Signage & Graphics Subtotal75,000 $2.740.7%Pool Equipment13000 Replacement of Pool Equipment 1 lsum - - 1,242,989 1,242,989 1,242,989 $45.45 11.7%13000Pumps, DE filters Chemical Controllers, UV systems, Co2 systems 1 lsum - - included - - $0.00 0.0%10400 On deck pumps and chemicals for pool renovation 1 lsum - - 128,862 128,862 128,862 $4.71 1.2%10400 Catwalk / Ladder at Tank Fiberglass 1 lsum - 11500 11,500 10,000 10,000 21,500 $0.79 0.2%10400 Sump Grating 1 lsum - 1400 1,400 1,000 1,000 2,400 $0.09 0.0%10400 Demolition of existing pool equipment 1 lsum - - 46,207 46,207 46,207 $1.69 0.4%Pool Equipment Subtotal1,441,958 $52.7213.6%0.0%Fire Protection 15300 Fire Protection modifications 27,350 sqft - - n/a - - $0.00 0.0%15300 FDC 1 lsum - - existing - - $0.00 0.0%15300 Fire Pump 1 lsum - - existing - - $0.00 0.0%Fire Protection Subtotal- $0.000.0%Plumbing15400 Plumbing Trade Subcontractor 27,350 sqft - - in sundeck - - $0.00 0.0%15400 Misc. Plumbing 1 lsum - - 97250 97,250 97,250 $3.56 0.9%Plumbing Subtotal97,250 $3.560.9%HVAC15000 HVAC Trade Subcontractor 1 lsum - - 2,996,800.00 2,996,800 2,996,800 $109.57 28.2%15000 Equipment Fans VFD 1 lsum - - included - - $0.00 0.0%15000 Dehumidification (dessert air) 1 lsum - - included - - $0.00 0.0%15000 Wind Rated Curbs 1 lsum - - included - - $0.00 0.0%15000 DDC Controls 1 lsum - - included - - $0.00 0.0%15000 Insulation 1 lsum - - included - - $0.00 0.0%15000 Hoisting 1 lsum - - included - - $0.00 0.0%15000 Epoxy coated ductwork 1 lsum - - included - - $0.00 0.0%15000 Duct Sox @ Pool 1 lsum - - Included - - $0.00 0.0%Page 2 of 3 JOB TITLE:DATE:JOB LOCATION:SQFT:ESTIMATE TITLE:DURATION:420.0days6/3/2024============================================= ======== ========= ========= ========== ========== ========== ============ =========== ================ ========== ==========UNIT TTL UNIT TTL UNIT TOTALDESCRIPTION QUAN UNT LAB LAB MAT'L MAT'L SUB SUB TOTAL $/SF % TTL====== ===================================================== ========= ========= ========== ========== ========== ============ =========== ================ ========== ==========Long Center11/26/24Clearwater27,350 GMP15000 Mechanical louvers 1 lsum - - n/a - - $0.00 0.0%15000 Demo Existing AHU and Ductwork 1 lsum - - included - - $0.00 0.0%15000 Air Distribution Devices 1 lsum - - Included - - $0.00 0.0%15000 DDC Controls 1 lsum - - Included - - $0.00 0.0%15000 Vinyl wrapped units 2 allowance - - 20000 40,000 40,000 $1.46 0.4%15000 Big Ass Fans 7 ea - - included - - $0.00 0.0%15000 Demo of Steel Structure 1 lsum - - 7,500 7,500 7,500 $0.27 0.1%15000 Test & Balance 1 lsum - - included - - $0.00 0.0%15000 Commissioning assistance 1 lsum - - included - - $0.00 0.0%15000 Commissioning 1 lsum - - By Owner - - $0.00 0.0%HVAC Subtotal3,044,300 $111.3128.7%Electrical 16000 Electrical Trade Subcontractor 1 lsum - - 470,412 470,412 470,412 $17.20 4.4%16000 Exterior Lighting 1 lsum - - included - - $0.00 0.0%16000 Demo 1 lsum included - - $0.00 0.0%16000 Fire alarm devices 1 lsum by owner - - $0.00 0.0%16000 Connect new HVAC Equipment 1 lsum - - included - - $0.00 0.0%16000 Pool equipment room 1 lsum 30,900 30,900 30,900 $1.13 0.3%16000 Install of Receptacles and connections 1 lsum included - - $0.00 0.0%16000 Temporary lighting 1 lsum - - included - - $0.00 0.0%16000 Electrical Switchgear and feeders 1 lsum Existing - - $0.00 0.0%16000Remove & replace ceilings in MEP room for electrical run 1 lsum7500 7,500 7,500 $0.27 0.1%16000 Electrical - Lighting fixture package 1 lsum - - included - - $0.00 0.0%Electrical Subtotal- - 508,812 $18.604.8%Landscape32000 Landscape around perimeter/irrigation repairs 1 allowance - - 40000.00 40,000 40,000 $1.46 0.4%32000 Landscape Removal 1 allowance - - 5000.00 5,000 5,000 $0.18 0.0%32000 Tree Trimming 1 allowance - - 15000.00 15,000 15,000 $0.55 0.1%Landscape Subtotal60,000 $2.190.6%Surveying & Material Testing18500Threshold / Steel Inspection 1 lsum - n/a - - $0.00 0.0%18500Third Party Materials Testing 1 Allowance - 20,000.00 20,000 20,000 $0.73 0.2%18500Roofing Moisture Consultant 1 lsum - By Owner - - $0.00 0.0%Surveying & Material Testing Subtotal20,000 $0.730.2%Permits & Impact Fees18500Plans Exam Fees 1 lsum - By Owner - - $0.00 0.0%18500Building Permit Fees 1 lsum - By Owner - - $0.00 0.0%18500Certificate of Occupancy 1 lsum - By Owner - - $0.00 0.0%18500SWPPP Generic Permit 1 lsum - By Owner - - $0.00 0.0%18500Impact Fees1 lsum - By Owner - - $0.00 0.0%Permits & Insurance Subtotal- $0.000.0%Temporary Construction18500 Temporary Fencing - Add to Existing 500 lnft - - 5.50 2,750 2,750 $0.10 0.0%18500 Temporary Fence Screening 500 lnft - 3.00 1,500 - - 1,500 $0.05 0.0%18500 Temporary Fence Screening - Custom Print 250 lnft 14.00 3,500 - - 3,500 $0.13 0.0%18500 Temporary Gates 6 each - - 200.00 1,200 1,200 $0.04 0.0%18500 Foreman Site / Building 56 Weeks - - 2,056.80 115,181 115,181 $4.21 1.1%18501 Temporary dry-in of curtain wall 1 lsum 25,000.00 25,000 - 25,000 $0.91 0.2%18503 Relocate Plywood at pool 100 lf 40.00 4,000 - 4,000 $0.15 0.0%18502 Temporary Scaffold Stairs 22 weeks 560.00 12,124 - 12,124 $0.44 0.1%18502 Plywood partition at pool 100 lf 120.00 12,000 - 12,000 $0.44 0.1%18503 Misc Visqueen and Protection 1 lsum 7,000.00 7,000 - 7,000 $0.26 0.1%18503 Protect existing pool deck 8,200 sf 3.00 24,600 - 24,600 $0.90 0.2%18503 Clean pool deck when finished 8,200 sf 2.00 16,400 - 16,400 $0.60 0.2%18503 Roundabout protection from crane 2 mo 1,000.00 2,000 - 2,000 $0.07 0.0%18500Temp Fence Maintenance500 lnft - - 2.00 1,000 1,000 $0.04 0.0%Temporary Construction Subtotal228,255 $8.352.2%====== ===================================================== ========= ========= ========== ========== ========== ============ =========== ================ ========== ==========SUB TOTAL: 9,600 638,563 9,918,322 10,566,485 $386.34 99.5%TAX & BURDEN: 0.4 3,840 0.0744,699 N/A 48,539 $1.77 0.5%====== ===================================================== ========= ========= ========== ========== ========== ============ =========== ================ ========== ==========13,440 683,262 9,918,322 10,615,024 $388.12 100.0%0.0%10,615,024 $388.12 100.0%10,615,024$ $388.12 100.0%COST CHECK:Total Guaranteed Maximum PricePage 3 of 3 Tab 3-A DETAILED ESTIMATE-SUNDECK JOB TITLE:DATE:JOB LOCATION:SQFT:ESTIMATE TITLE:DURATION: days6/3/2024=========================================== ================= ========= ========== ========== ========== ============ =========== ================ ========== ==========UNIT TTL UNIT TTL UNIT TOTALDESCRIPTION QUAN UNT LAB LAB MAT'L MAT'L SUB SUB TOTAL $/SF % TTL====== =========================================== ======== ========= ========= ========== ========== ========== ============ =========== ================ ========== ==========Concrete03300 Concrete for Mechanical Chases 1 lsum - - 36,946.00 36,946 36,946 $24.63 6.9%03300 Termite Treatment 200 sqft - - 0.35 70 70 $0.05 0.0%Interior Slab-on-grade - 4" 1 sqft - - included - - $0.00 0.0%Slab Edge 60 lnft - - included - - $0.00 0.0%Foundations 1 lsum - - included - - $0.00 0.0%Misc Patching/Sidewalk repair 1 allowance - - 15000 15,000 15,000 $10.00 2.8%Concrete Subtotal52,016 $34.689.7%Masonry 04220 Masonry Trade Subcontractor 1 lsum - - 65,594 65,594 65,594 $43.73 12.3%04220 8" CMU 1 sqft - - Included - - $0.00 0.0%04220 12" CMU 1 sqft - - n/a - - $0.00 0.0%04220 Misc. Concrete / Masonry 1 lsum - - included - - $0.00 0.0%Masonry Subtotal65,594 $43.7312.3%Structural Steel05400Structural Steel 1 lsum - - 65,600 65,600 65,600 $43.73 12.3%05400Steel Mechanical Chase 2 each - - n/a - - $0.00 0.0%05400Railings 100 lnft - - 250 25,000 25,000 $16.67 4.7%05400 Misc. Metals 1 lsum - - included - - Structural Steel Subtotal90,600 $60.4016.9%Rough Carpentry06100 Plywood Backboards 2 each - - N/A - - $0.00 0.0%06101 Interior Wood Blocking 1,500 sqft - - 1.5 2,250 2,250 $1.50 0.4%06102 Roof Blocking 1 lsum - - in roofing - - $0.00 0.0%Rough Carpentry Subtotal2,250 $1.500.4%Roofing07500 TPO 1 lsum - - 45000.00 45,000 45,000 $30.00 8.4%07500 Demo Existing 28,500 sqft included - - $0.00 0.0%07500 Polyiso Insulation spec'd at R-25 1 lsum - - included - - $0.00 0.0%07500 Mechanical Wall Screens 2 each - - n/a - - $0.00 0.0%07500 Coping/Cap-Flashing & Trim - .050 Kynar 1 lsum - - included- - $0.00 0.0%07500 PV Anchors 1 each - - n/a - - $0.00 0.0%Roofing Subtotal45,000 $30.008.4%Wtr Pr-Firestopping & Joint Sealants07900 Waterproofing @ Decorative Elements 5,800 sqft - - n/a - - $0.00 0.0%07900 Misc Waterproofing / Damproofing 1,500 sqft - - 1.00 1,500 1,500 $1.00 0.3%07900 Joint Sealants 1,500 sqft - 1.15 1,725 1,725 $1.15 0.3%3,225 $2.150.6%Doors, Frames & Hdwre08111 Door & Hardware Supplier 1 lsum - - In Glass - - $0.00 0.0%08111 Storefront 1 lsum - - In Glass - - $0.00 0.0%08111 Door Labor 1 lsum - - In Glass - - $0.00 0.0%08111 Finish Hardware 1 lsum - - In Glass - - $0.00 0.0%Doors, Frames & Hdwre Subtotal- $0.000.0%Glass08800 Exterior Aluminum Curtainwall & Interior Glazing 1 lsum - - 11,546 11,546 11,546 $7.70 2.2%08800 Demo of the Existing System sqft - - included - - $0.00 0.0%08800 Storefront Doors w/ Hardware each - - included - - $0.00 0.0%08800 Hydraulic Bifold Doors 2 each - - n/a - - $0.00 0.0%88000 Curtainwall / Glass Water Testing 1 days 7,500 7,500 7,500 $5.00 1.4%Glass Subtotal19,046 $12.703.6%Drywall & Metal Framing09100 Drywall & Mtl Stud Trade Subcontractor 1 lsum - - 89,580.0089,580 89,580 $59.72 16.7%09100 Exterior Framing 1,850 sqft - - included - - $0.00 0.0%09222 Insulation 1 lsum - - included - - $0.00 0.0%Drywall & Metal Framing Subtotal89,580 $59.7216.7%Stucco09222 Stucco 1,850 sqft - - in drywall - - $0.00 0.0%09222 Stucco @ Decorative elements 5,800 sqft - - n/a - - $0.00 0.0%09222 Scaffolding 1 lsum - - included - - $0.00 0.0%Stucco Subtotal- $0.000.0%Acoustical Ceilings09500 Acoustical Ceilings Trade Subcontractor 1,500 sqft - - 6.50 9,750 9,750 $6.50 1.8%09500 Baffles 18 each - - N/A - - $0.00 0.0%Acoustical Ceiling Sub Total9,750 $6.501.8%Flooring09651 Floor Urethane 1,500 sqft - - n/a - - $0.00 0.0%09651 Deck Coating 8,602 sqft - - n/a - - $0.00 0.0%09651 Floor Prep Allowance 1 sqft - - n/a - - $0.00 0.0%Flooring Subtotal- $0.000.0%Painting09900 Painting 1 sqft - - 10,500.00 10,500 10,500 $7.00 2.0%09900 Interior Painting sqft - - - - $0.00 0.0%09900 Exterior Stucco 5,800 sqft - - - - $0.00 0.0%09901 Misc. Painting 1 lsum - - 1,000 1,000 1,000 $0.67 0.2%Painting Subtotal11,500 $7.672.1%0.0%Fire Protection 15300 Fire Protection modifications 1,500 sqft - - n/a - - $0.00 0.0%15300 FDC 1 lsum - - existing - - $0.00 0.0%15300 Fire Pump 1 lsum - - existing - - $0.00 0.0%Fire Protection Subtotal- $0.000.0%Wtr Pr-Firestopping & Joint Sealants SubtotalLong CenterNovember 26, 2024Clearwater1,500 GMP SUNDECK ALTPage 1 of 2 JOB TITLE:DATE:JOB LOCATION:SQFT:ESTIMATE TITLE:DURATION: days6/3/2024=========================================== ================= ========= ========== ========== ========== ============ =========== ================ ========== ==========UNIT TTL UNIT TTL UNIT TOTALDESCRIPTION QUAN UNT LAB LAB MAT'L MAT'L SUB SUB TOTAL $/SF % TTL====== =========================================== ======== ========= ========= ========== ========== ========== ============ =========== ================ ========== ==========Long CenterNovember 26, 2024Clearwater1,500 GMP SUNDECK ALTPlumbing15400 Plumbing Trade Subcontractor 1,500 sqft - - no work - - $0.00 0.0%15400 Misc. Plumbing 1 lsum - - n/a - - $0.00 0.0%Plumbing Subtotal- $0.000.0%HVAC15000 HVAC Trade Subcontractor 1 lsum - - 84,200.00 84,200 84,200 $56.13 15.7%15000 DDC Controls 1 lsum - - included - - $0.00 0.0%15000 Wraps 1 lsum - - 5000 5,000 5,000 $3.33 0.9%15000 Air Distribution Devices 1 lsum - - Included - - $0.00 0.0%15000 DDC Controls 1 lsum - - Included - - $0.00 0.0%15000 Test & Balance 1 lsum - - 2,500 2,500 2,500 $1.67 0.5%15000 Commissioning 1 lsum - - By Owner - - $0.00 0.0%HVAC Subtotal91,700 $61.1317.1%Electrical 16000 Electrical Trade Subcontractor 1 lsum - - 26,921 26,921 26,921 $17.95 5.0%16000 Fire alarm devices 1 lsum by owner - - $0.00 0.0%16000 Connect new HVAC Equipment 1 lsum - - included - - $0.00 0.0%16000 Install of Receptacles and connections 1 lsum included - - $0.00 0.0%16000 Temporary lighting 1 lsum - - included - - $0.00 0.0%16000 Electrical Switchgear and feeders 1 lsum Existing - - $0.00 0.0%16000 Electrical - Lighting fixture package 1 lsum - - included - - $0.00 0.0%Electrical Subtotal- - 26,921 $17.955.0%Temporary Construction18500 Demolition of Concrete / Steel 1 lsum - 18,500.00 18,500 18,500 $12.33 3.5%18500 Temporary Gates each - - - - $0.00 0.0%18501 Temporary dry-in of curtain wall 1 lsum 5,000.00 5,000 - 5,000 $3.33 0.9%18503 Misc Visqueen and Protection 1 lsum 2,500.00 2,500 - 2,500 $1.67 0.5%18503 Protect existing pool deck 1 lsum 1,500.00 1,500 - 1,500 $1.00 0.3%Temporary Construction Subtotal27,500 $18.335.1%====== =========================================== ======== ========= ========= ========== ========== ========== ============ =========== ================ ========== ==========SUB TOTAL: - 9,000 525,682 534,682 $356.45 99.9%TAX & BURDEN: 0.3873 - 0.07630 N/A 630 $0.42 0.1%====== =========================================== ======== ========= ========= ========== ========== ========== ============ =========== ================ ========== ==========- 9,630 525,682 535,312 $356.87 100.0%0.0%535,312 $356.87 100.0%535,312$ $356.87 100.0%COST CHECK:Total Guaranteed Maximum PricePage 2 of 2 Tab 4 GENERAL REQUIREMENTS JOB TITLE:DATE:11/26/24JOB LOCATION:SQFT:27,350 27,350 DURATION:14MONTHS====== ================================ ======= ======= ========== ========== ========== ========== ==================== =========== ==========UNIT TTL UNIT TTL UNIT TOTAL TOTAL DESCRIPTION QUAN UNT LAB LAB MAT'L MAT'L SUB SUB TOTAL $/SF====== ================================ ======= ======= ========== ========== ========== ========== ==================== =========== ==========Misc. Project Costs 18500 Lull / Forklift/ Street Sweeper mnth - 2250 - - - $0.0018500 Small Tools & Equip. 14 mnth - 1500 21,000 - 21,000 $0.7718500 Misc. Equipment / Fuel mnth - 325 - - - $0.0018500 Field Toilets (8) 14 mnth - 760 10,640 - 10,640 $0.3918500 Temporary Water Set Up (Field/Trailer) 1 lsum - - 2500 2,500 2,500 $0.0918500 Temporary Water Consumption 14 months - 350 4,900 - 4,900 $0.1818500 Temporary Electric Trailer 14 mnth - 400 5,600 - 5,600 $0.2018500Temporary Electric Consumption 14 mnth - By Owner - - - $0.0018500Permanent Power14 mnth - By Owner - - - $0.0018500Field Phone / Install 1 lsum - in gc - - - $0.0018500 Field Phone 14 mnth - in gc - - - $0.0018500 Cell Phone 14 mnth - in gc - - - $0.0018500 DSL Set-up 1 lsum - in gc - - - $0.0018500 DSL MiFi Service 14 mnth - in gc - - - $0.0018500 Field Trailer rental - 14 mnth - 3200 44,800 - 44,800 $1.6418500 Field Trailer Set-up / Take-Down 1 each - 9000 9,000 - 9,000 $0.3318500 Ramp for Trailer 1 each - 1500 1,500 - 1,500 $0.0518500 Stairs 14 mnth - 130 1,820 - 1,820 $0.0718500 Holding Tank (2) 14 mnth - 800 11,200 - 11,200 $0.4118500 Storage Trailer (2) 14 mnth - 300 4,200 - 4,200 $0.1518500 Copier Rental 14 mnth - 650 9,100 - 9,100 $0.3318500 Contract Cleaning 1 sqft - incl in est - - - $0.0018500 Trailer Cleaning 14 months - 230 3,220 - 3,220 $0.1218500 Safety Rails 0 lnft - incl in est - - - $0.0018500 Construction Signage 14 months - 185 2,590 - 2,590 $0.0918500 Trash Hauling 40 pulls - 425 17,000 - 17,000 $0.6218500 Scaffold Stair Assembly (2) 0 mnth - 3800 - - - $0.0018500 Casual Labor - Site and Flagman 22 weeks - 1250 27,500 - 27,500 $1.0118500 Casual Labor - Structure 60 weeks - 1850 111,000 - 111,000 $4.0618500 Casual Labor - Finishes 0 weeks - 1500 - - - $0.0018500 Drinking Water 14 mnth - 85 1,190 - 1,190 $0.0418500 Dust Control 14 months - 500 7,000 - 7,000 $0.2618500 Safety 14 mnth - 125 1,750 - 1,750 $0.0618500 Security (Pro-Vigil - 2 cameras) 0 mnth - - 3500 - - $0.0018500 Postage 18 mnth - in gc - - - $0.0018500Office Supplies18mnth- in gc- - - $0.0018500 Computers 1 lsum - in gc - - - $0.0018500 Admin. Computer 1 lsum - in gc - - - $0.0018500 Legal Advertising 0 months - 750 - - - $0.0018500 Hand Washing 14 months - 500 7,000 - 7,000 $0.2618500 Project Sign 2 each - 350 700 - 700 $0.0318500 CPM Schedule 17 mnth - - - - $0.0018500 As-Built / CAD 1 allowance - - - - $0.00Misc. Project Costs Subtotal305,210 $11.16====== ================================ ======= ======= ========== ========== ========== ========== ==================== =========== ==========SUB TOTAL: - 302,710 2,500 305,210 $11.16TAX & BURDEN: 0.4 - 0.06519,676 N/A 19,676 $0.72====== ================================ ======= ======= ========== ========== ========== ========== ==================== =========== ==========- 322,386 2,500 324,886 $11.88COST CHECK: 324,886 $11.88=========== ===================== ==========324,886$ $11.8823206Long CenterClearwaterGeneral RequirementsGENERAL REQUIREMENTS TOTAL: Tab 5 GENERAL CONDITIONS Duration Time(Weeks)Available (%)Josh BomsteinProj Exec65 2600 240 $84.13 9% $20,191 35.98% $7,264.79 $27,455.990 0 $0.00 $0 0.00% $0.00 $0.000 0 $0.00 $0 0.00% $0.00 $0.000 0 $0.00 $0 0.00% $0.00 $0.000 0 $0.00 $0.00 0.00% $0.00 $0.00Sr. Pm64 2560 2560 $60.10 100% $153,856.00 35.98% $55,357.39 $209,213.39Supt60 2400 2400 $56.49 100% $135,576.00 44.19% $59,911.03 $195,487.03Assist Supt 0 0 0 $45.67 #DIV/0! $0.00 44.19% $0.00 $0.00APM64 2560 1660 $45.67 65% $75,812.20 35.98% $27,277.23 $103,089.43Admin64 2560 1280 $28.84 50% $36,915.20 32.00% $11,812.86 $48,728.06Safety Mgr56 2240 180 $50.48 8% $9,086.40 44.19% $4,015.28 $13,101.68Amount Total Cost15 $11,250.0015 $12,000.000 $0.007.5 $2,625.000 $0.000 $0.000 $0.000 $0.000 $0.00$0.00$0.00$0.00$0.00$0.00$0.00$0.00$0.00$0.00$0.00$0.00$622,950.59$44,496.47 per month$0.00$0.00Total Cost of Construction Services $0.00$0.00$0.00$0.00$0.00$0.00$0.00$0.00$0.00Misc Fuel$433.00Postage$150.00Office / Janitorial supplies$450.00 Computers, Phones line, Internet, Software, & Technology fees per month$1,175.00Cell Phones$585.00Superintendent Vehicle & Fuel Per Month$800.00Assist Supt Vehicle & Fuel Per Month$450.00Assist Supt Vehicle & Fuel Per Month$350.00MISCELLANEOUS CHARGESSr. PM Vehicle & Fuel Per Month$750.00Item & Unit of MeasureCostOFF-SITE STAFFON-SITE STAFFEXHIBIT ACONSTRUCTION MANAGER'S PERSONNELPART B CONSTRUCTION SERVICES Personnel TitleTotal project HoursBillable HoursHourly Rate Total Labor Cost Burden Rate Burden Amount Total Compensation Tab 6 ALLOWANCE LOG # Allowance Description Value 1Sidewalk Repair This allowance is intended to cover any costs associated with damages occurring as a result of the construction process $ 22,638 2Repair and repoint CMU knee wall This allowance is intended to cover any costs associated with damages occurring as a result of the construction process $ 37,725 3North Side/east/west Steel Modifications and Demo/ Repair and paint This allowance is intended to cover any costs associated with damages occurring as a result of the construction process $ 132,600 4Touch up SteelThis allowance is intended to cover any costs associated with damages occurring as a result of the construction process $ 20,000 5Chemical EnclosurePer the owner's request, this allowance is intended to fund any costs associated with putting a cover over the chemical enclosure. $ 25,000 6Cast in aluminum backlit letters this allowance is intended to fund any costs associated with covering the costs of the aluminum backlit letters. $ 75,000 7Vinyl wrapped unitsThis allowance is intended to cover any costs associated with the vinyl wrapped units. $ 40,000 8LandscapingIncludes Trim Trimming and Plant Removal/repair of existing landscape as required $ 60,000 9Third Party Materials TestingPer specification section 012100 allowances, this allowance is associated with any costs for materials testing. $ 20,000 10Curtainwall / Glass Water TestingThis allowance is intended to cover any costs associated with any glass water testing. $ 22,500 11Remove Deck PaintingDue to the time restraints for GMP submission, If this VE is accepted we will validate the cost to provide an exact credit $ (560,500)12Builders Risk InsuranceDue to the time restraints for GMP submission, We will reconcile this allowance with our insurance carrier which take 1 to 2 weeks $ 42,063 13Point and PatchingThis allowance is intended to cover any costs associated with any point and patching. $ 25,983 Creative ContractorsLong CenterNovember 26, 2024Schedule of Allowances Tab 7 PROJECT SCHEDULE Activity ID Activity Name Orig Dur Activ % Compl Start Finish Long Center RenovationsLong Center RenovationsLong Center RenovationsLong Center RenovationsLong Center RenovationsLong Center Renovations PreconstructionPreconstructionPreconstructionPreconstructionPreconstructionPreconstruction ST00030 CM Contract Issued 1 100%12-Jan-24 A 12-Jan-24 A ST00040 DD Development Budget & Review 1 100%08-Apr-24 A 19-Apr-24 A ST00050 50% Documents Budget & Review 1 100%06-May-24 A 24-May-24 A ST00055 Subcontractor Bids Due 10 91.13%24-Oct-24 A 06-Nov-24 ST00057 GMP Submission 8 0%07-Nov-24 18-Nov-24 ST00060 Demo Permit Submission 20 0%19-Nov-24 16-Dec-24 ST00058 Council Meeting/GMP Approval 40 0%19-Nov-24 15-Jan-25 ST00080 Building Permit Submission 50 0%19-Nov-24 29-Jan-25 ST00070 Demo Permit Issued 5 0%17-Dec-24 23-Dec-24 ST00059 NTP 1 0%16-Jan-25 16-Jan-25 ST00090 Building Permit Issued 5 0%30-Jan-25 05-Feb-25 ConstructionConstructionConstructionConstructionConstructionConstruction ProcurementProcurementProcurementProcurementProcurementProcurement Curtainwall/Glazing ProcurementCurtainwall/Glazing ProcurementCurtainwall/Glazing ProcurementCurtainwall/Glazing ProcurementCurtainwall/Glazing ProcurementCurtainwall/Glazing Procurement ST00180 Curtainwall Shop Drawings/Approval 30 0%17-Jan-25 27-Feb-25 ST00190 Curtainwall/Glazing Procurement/Onsite 120 0%28-Feb-25 15-Aug-25 Roofing ProcurementRoofing ProcurementRoofing ProcurementRoofing ProcurementRoofing ProcurementRoofing Procurement ST00247 Roofing Submittals/Approval 20 0%17-Jan-25 13-Feb-25 ST00248 Roofing Materials Procurement/Onsite 20 0%14-Feb-25 13-Mar-25 Structural Steel ProcurementStructural Steel ProcurementStructural Steel ProcurementStructural Steel ProcurementStructural Steel ProcurementStructural Steel Procurement ST00252 Steel Repair Process Submittals/Approval 20 0%17-Jan-25 13-Feb-25 ST00200 Structural Steel Shop Drawings/Approval 40 0%17-Jan-25 13-Mar-25 ST00210 Structural Steel Fabrication/Onsite 40 0%14-Mar-25 08-May-25 HVAC Equipment ProcurementHVAC Equipment ProcurementHVAC Equipment ProcurementHVAC Equipment ProcurementHVAC Equipment ProcurementHVAC Equipment Procurement ST00250 HVAC Equipment Submittals/Approval 20 0%17-Jan-25 13-Feb-25 ST00770 Dehumidification Eqpt Procurement/Onsite 0 0%13-Feb-25 ST00780 RTU Procurement/Onsite 100 0%14-Feb-25 03-Jul-25 Electrical Equipment ProcurementElectrical Equipment ProcurementElectrical Equipment ProcurementElectrical Equipment ProcurementElectrical Equipment ProcurementElectrical Equipment Procurement N D Jan F M Apr M Jun Jul A S Oct N D Jan F M 2025 2026 DD Development Budget & Review 50% Documents Budget & Review Subcontractor Bids Due GMP Submission Demo Permit Submission Council Meeting/GMP Approval Building Permit Submission Demo Permit Issued NTP Building Permit Issued Curtainwall Shop Drawings/Approval Curtainwall/Glazing Procurement/Onsite Roofing Submittals/Approval Roofing Materials Procurement/Onsite Steel Repair Process Submittals/Approval Structural Steel Shop Drawings/Approval Structural Steel Fabrication/Onsite HVAC Equipment Submittals/Approval Dehumidification Eqpt Procurement/Onsite RTU Procurement/Onsite Layout: Org by Phase TASK filter: All Activities Long Center Renovations CREATIVE CONTRACTORS, INC. Report Date:21-Nov-24 Page 1 of 5 Data Date: 06-Nov-24 Start Date: 12-Jan-24 Finish Date: 26-Mar-26 Project ID: synchroProject-6R1 Actual Level of Effort Actual Work Remaining Work Critical Remaining Work Milestone "PRELIMINARY" - FOR IN HOUSE REVIEW AND COMMENT INCORP J. SIMINSKI 11/21/24 E-MAIL REVIEW COMMENTS Activity ID Activity Name Orig Dur Activ % Compl Start Finish ST00240 Electrical Equipment Submittals/Approval 30 0%17-Jan-25 27-Feb-25 ST00245 Electrical Equipment Procurement/Onsite 120 0%28-Feb-25 15-Aug-25 Pool Equipment ProcurementPool Equipment ProcurementPool Equipment ProcurementPool Equipment ProcurementPool Equipment ProcurementPool Equipment Procurement ST00220 Pool Equipment Submittals/Approval 40 0%17-Jan-25 13-Mar-25 ST00230 Pool Equipment Procurement/Onsite 120 0%14-Mar-25 29-Aug-25 Framing/Plastering ProcurementFraming/Plastering ProcurementFraming/Plastering ProcurementFraming/Plastering ProcurementFraming/Plastering ProcurementFraming/Plastering Procurement ST00251 Framing/Plaster Submittal/Approval 20 0%17-Jan-25 13-Feb-25 Concrete & Rebar ProcurementConcrete & Rebar ProcurementConcrete & Rebar ProcurementConcrete & Rebar ProcurementConcrete & Rebar ProcurementConcrete & Rebar Procurement ST00249 Concrete Materials Submittal/Approval 20 0%17-Jan-25 13-Feb-25 Mobilization and Set UpMobilization and Set UpMobilization and Set UpMobilization and Set UpMobilization and Set UpMobilization and Set Up ST00125 Long Center Activites Conclude 1 0%24-Jan-25*24-Jan-25 ST00120 Office Mobilization/Laydown Set 10 0%10-Feb-25*21-Feb-25 ST00130 Long Center Staff Move Out & Eqpt Removed 1 0%05-Mar-25 05-Mar-25 ST00127 Mobilize Construction Activities 0 0%06-Mar-25 ST00140 Water Level Tarp/Pool Protection Placed 10 0%06-Mar-25 19-Mar-25 ST00150 Pool Perimeter Fencing/Fall Protection 5 0%20-Mar-25 26-Mar-25 ST00160 Pool Deck Flooring Protection 5 0%27-Mar-25 02-Apr-25 ConstructionConstructionConstructionConstructionConstructionConstruction Exterior EnvelopeExterior EnvelopeExterior EnvelopeExterior EnvelopeExterior EnvelopeExterior Envelope West ElevationWest ElevationWest ElevationWest ElevationWest ElevationWest Elevation ST00292 West Concrete Demo at Roll Up Doors 5 0%24-Feb-25 28-Feb-25 ST00290 West Window Demolition 15 0%18-Aug-25 05-Sep-25 ST00295 West Steel Angle Install/Window Head 10 0%08-Sep-25 19-Sep-25 ST00297 West Install Steel Columns/Roll Up Doors 10 0%08-Sep-25 19-Sep-25 ST00300 West Steel Repair/Prep/Painting 15 0%08-Sep-25 26-Sep-25 ST00298 West FRP Concrete Slab at Roll Up 5 0%22-Sep-25 26-Sep-25 ST00310 West Framing/Sheathing/Stucco 15 0%29-Sep-25 17-Oct-25 ST00320 West Curtainwall Installation 10 0%20-Oct-25 31-Oct-25 ST00330 West Stucco Sealants/Painting 20 0%03-Nov-25 28-Nov-25 East ElevationEast ElevationEast ElevationEast ElevationEast ElevationEast Elevation ST00550 East Window Demolition 10 0%08-Sep-25 19-Sep-25 N D Jan F M Apr M Jun Jul A S Oct N D Jan F M 2025 2026 Electrical Equipment Submittals/Approval Electrical Equipment Procurement/Onsite Pool Equipment Submittals/Approval Pool Equipment Procurement/Onsite Framing/Plaster Submittal/Approval Concrete Materials Submittal/Approval Long Center Activites Conclude Office Mobilization/Laydown Set Long Center Staff Move Out & Eqpt Removed Mobilize Construction Activities Water Level Tarp/Pool Protection Placed Pool Perimeter Fencing/Fall Protection Pool Deck Flooring Protection West Concrete Demo at Roll Up Doors West Window Demolition West Steel Angle Install/Window Head West Install Steel Columns/Roll Up Doors West Steel Repair/Prep/Painting West FRP Concrete Slab at Roll Up West Framing/Sheathing/Stucco West Curtainwall Installation West Stucco Sealants/Painting East Window Demolition Layout: Org by Phase TASK filter: All Activities Long Center Renovations CREATIVE CONTRACTORS, INC. Report Date:21-Nov-24 Page 2 of 5 Data Date: 06-Nov-24 Start Date: 12-Jan-24 Finish Date: 26-Mar-26 Project ID: synchroProject-6R1 Actual Level of Effort Actual Work Remaining Work Critical Remaining Work Milestone "PRELIMINARY" - FOR IN HOUSE REVIEW AND COMMENT INCORP J. SIMINSKI 11/21/24 E-MAIL REVIEW COMMENTS Activity ID Activity Name Orig Dur Activ % Compl Start Finish ST00560 East Steel Angle Install/Window Head 10 0%22-Sep-25 03-Oct-25 ST00570 East Steel Repair/Prep/Painting 15 0%06-Oct-25 24-Oct-25 ST00580 East Framing/Sheathing/Stucco 15 0%27-Oct-25 14-Nov-25 ST00585 East Framed Enclosures at Ductwork 20 0%27-Oct-25 21-Nov-25 ST00590 East Curtainwall Installation 10 0%17-Nov-25 28-Nov-25 ST00690 East Stucco Sealants/Painting 20 0%01-Dec-25 29-Dec-25 North ElevationNorth ElevationNorth ElevationNorth ElevationNorth ElevationNorth Elevation ST00600 North Window Demolition 25 0%22-Sep-25 24-Oct-25 ST00610 North Steel Angle Install/Window Head 20 0%06-Oct-25 31-Oct-25 ST00620 North Steel Repair/Prep/Painting 30 0%27-Oct-25 05-Dec-25 ST00630 North Framing/Sheathing/Stucco 40 0%03-Nov-25 29-Dec-25 ST00640 North Curtainwall Installation 40 0%24-Nov-25 20-Jan-26 ST00700 North Stucco Sealants/Painting 20 0%07-Jan-26 03-Feb-26 Roof Level ExteriorRoof Level ExteriorRoof Level ExteriorRoof Level ExteriorRoof Level ExteriorRoof Level Exterior ST00370 Demo/Replace Existing Roof Drains 5 0%06-Feb-25 12-Feb-25 ST00350 Demo Exisitng Mechanical 10 0%06-Feb-25 19-Feb-25 ST00360 Demo Existing Gas Piping 10 0%06-Feb-25 19-Feb-25 ST00380 New Roof Drain Installation 10 0%13-Feb-25 26-Feb-25 ST00377 Demo Existing Roof Curbs 5 0%24-Feb-25 28-Feb-25 ST00375 Selective Demo at Framing Modifications 10 0%24-Feb-25 07-Mar-25 ST00710 Structural Steel Modifications-East Roof 20 0%09-May-25 05-Jun-25 ST00810 Solar Support Stands 40 0%06-Jun-25 01-Aug-25 ST00790 Re-Roof Natatorium 60 0%06-Jun-25 29-Aug-25 ST00760 RTU Installation/Startup 5 0%07-Jul-25 11-Jul-25 ST00720 Walkway Structures Installation 20 0%07-Jul-25 01-Aug-25 ST00750 Dehumidification Ductwork Installation 40 0%13-Oct-25 05-Dec-25 ST00730 Dehumidification Unit Installation 5 0%08-Dec-25 12-Dec-25 ST00740 Dehumidification Connections/Startup 15 0%15-Dec-25 06-Jan-26 ST00800 HVAC Balancing and Cx 15 0%07-Jan-26 27-Jan-26 Roof Deck InteriorRoof Deck InteriorRoof Deck InteriorRoof Deck InteriorRoof Deck InteriorRoof Deck Interior ST00400 Mobilize/Setup Scaffolding to Deck 20 0%03-Apr-25 30-Apr-25 N D Jan F M Apr M Jun Jul A S Oct N D Jan F M 2025 2026 East Steel Angle Install/Window Head East Steel Repair/Prep/Painting East Framing/Sheathing/Stucco East Framed Enclosures at Ductwork East Curtainwall Installation East Stucco Sealants/Painting North Window Demolition North Steel Angle Install/Window Head North Steel Repair/Prep/Painting North Framing/Sheathing/Stucco North Curtainwall Installation North Stucco Sealants/Painting Demo/Replace Existing Roof Drains Demo Exisitng Mechanical Demo Existing Gas Piping New Roof Drain Installation Demo Existing Roof Curbs Selective Demo at Framing Modifications Structural Steel Modifications-East Roof Solar Support Stands Re-Roof Natatorium RTU Installation/Startup Walkway Structures Installation Dehumidification Ductwork Installation Dehumidification Unit Installation Dehumidification Connections/Startup HVAC Balancing and Cx Mobilize/Setup Scaffolding to Deck Layout: Org by Phase TASK filter: All Activities Long Center Renovations CREATIVE CONTRACTORS, INC. Report Date:21-Nov-24 Page 3 of 5 Data Date: 06-Nov-24 Start Date: 12-Jan-24 Finish Date: 26-Mar-26 Project ID: synchroProject-6R1 Actual Level of Effort Actual Work Remaining Work Critical Remaining Work Milestone "PRELIMINARY" - FOR IN HOUSE REVIEW AND COMMENT INCORP J. SIMINSKI 11/21/24 E-MAIL REVIEW COMMENTS Activity ID Activity Name Orig Dur Activ % Compl Start Finish ST00430 Electrical Demo Interior Deck 10 0%01-May-25 14-May-25 ST00420 Prep/Paint Roof Decking 100 0%01-May-25 18-Sep-25 ST00425 Electrical Rough In- Fans 15 0%15-May-25 04-Jun-25 ST00422 Fan Installation 10 0%05-Jun-25 18-Jun-25 ST00440 Duct Sox Installation 20 0%19-Sep-25 16-Oct-25 ST00410 Demobilize/Dismantle Scaffolding to Deck 15 0%17-Oct-25 06-Nov-25 ST00450 Remove Pool Protection Tarps 10 0%07-Nov-25 20-Nov-25 Pool EquipmentPool EquipmentPool EquipmentPool EquipmentPool EquipmentPool Equipment ST00470 Pre-Demo Preparation (Prior to Valve Removal)5 0%24-Feb-25 28-Feb-25 ST00480 Set Up Temporary Pool Pump/Electrical 10 0%03-Mar-25 14-Mar-25 ST00490 Demo Electrical Equipment 10 0%17-Mar-25 28-Mar-25 ST00500 Demo Pool Equipment (Pumps, Pipe, Sanitation)20 0%17-Mar-25 11-Apr-25 ST00510 FRP Surge Tank Complete 25 0%14-Apr-25 16-May-25 ST00517 Piping Rough In 40 0%19-May-25 14-Jul-25 ST00519 Electrical Equipment Rough In 20 0%18-Aug-25 12-Sep-25 ST00515 New Pool Equipment Set 15 0%01-Sep-25 19-Sep-25 ST00521 Electrical Equipment Connections/Trim 10 0%15-Sep-25 26-Sep-25 ST00518 Piping/Equipment Connections and Trim 15 0%22-Sep-25 10-Oct-25 ST00522 Pool Equipment Startup 10 0%13-Oct-25 24-Oct-25 ST00525 Temporary Pool Equipment Demobilization 3 0%27-Oct-25 29-Oct-25 ST00523 Pool Equipment Programming 10 0%27-Oct-25 07-Nov-25 ST00524 Pool Complete for Health Dept Inspection 10 0%04-Feb-26 17-Feb-26 Critical Dates/MilestonesCritical Dates/MilestonesCritical Dates/MilestonesCritical Dates/MilestonesCritical Dates/MilestonesCritical Dates/Milestones ST00540 Dehumidification Equipment Onsite 0 0%13-Feb-25 ST00650 Pool Startup 0 0%27-Oct-25 ST00670 Completion Certificate Issued 0 0%03-Feb-26 CommissioningCommissioningCommissioningCommissioningCommissioningCommissioning Substantial CompletionSubstantial CompletionSubstantial CompletionSubstantial CompletionSubstantial CompletionSubstantial Completion ST00660 Subtantial Completion 5 0%18-Feb-26 24-Feb-26 Punch List, Corrections & ReinspectionPunch List, Corrections & ReinspectionPunch List, Corrections & ReinspectionPunch List, Corrections & ReinspectionPunch List, Corrections & ReinspectionPunch List, Corrections & Reinspection A1000 Prepare & Issue Punch List 1 0%25-Feb-26 25-Feb-26 N D Jan F M Apr M Jun Jul A S Oct N D Jan F M 2025 2026 Electrical Demo Interior Deck Prep/Paint Roof Decking Electrical Rough In- Fans Fan Installation Duct Sox Installation Demobilize/Dismantle Scaffolding to Deck Remove Pool Protection Tarps Pre-Demo Preparation (Prior to Valve Removal) Set Up Temporary Pool Pump/Electrical Demo Electrical Equipment Demo Pool Equipment (Pumps, Pipe, Sanitation) FRP Surge Tank Complete Piping Rough In Electrical Equipment Rough In New Pool Equipment Set Electrical Equipment Connections/Trim Piping/Equipment Connections and Trim Pool Equipment Startup Temporary Pool Equipment Demobilization Pool Equipment Programming Pool Complete for Health Dept Inspection Dehumidification Equipment Onsite Pool Startup Completion Certificate Issued Subtantial Completion Prepare & Issue Punch List Layout: Org by Phase TASK filter: All Activities Long Center Renovations CREATIVE CONTRACTORS, INC. Report Date:21-Nov-24 Page 4 of 5 Data Date: 06-Nov-24 Start Date: 12-Jan-24 Finish Date: 26-Mar-26 Project ID: synchroProject-6R1 Actual Level of Effort Actual Work Remaining Work Critical Remaining Work Milestone "PRELIMINARY" - FOR IN HOUSE REVIEW AND COMMENT INCORP J. SIMINSKI 11/21/24 E-MAIL REVIEW COMMENTS Activity ID Activity Name Orig Dur Activ % Compl Start Finish A1010 Punch List Corrections 20 0%26-Feb-26 25-Mar-26 A1020 Punch LIst Reinspection 1 0%26-Mar-26 26-Mar-26 Warranties, Guarantees & TrainingWarranties, Guarantees & TrainingWarranties, Guarantees & TrainingWarranties, Guarantees & TrainingWarranties, Guarantees & TrainingWarranties, Guarantees & Training A1030 Prepare & Issue As-Builts, Guarantees & Warranties 15 0%25-Feb-26 17-Mar-26 A1040 Owner Training 15 0%25-Feb-26 17-Mar-26 Final CompletionFinal CompletionFinal CompletionFinal CompletionFinal CompletionFinal Completion A1050 Final Completion 1 0%26-Mar-26 26-Mar-26 N D Jan F M Apr M Jun Jul A S Oct N D Jan F M 2025 2026 Layout: Org by Phase TASK filter: All Activities Long Center Renovations CREATIVE CONTRACTORS, INC. Report Date:21-Nov-24 Page 5 of 5 Data Date: 06-Nov-24 Start Date: 12-Jan-24 Finish Date: 26-Mar-26 Project ID: synchroProject-6R1 Actual Level of Effort Actual Work Remaining Work Critical Remaining Work Milestone "PRELIMINARY" - FOR IN HOUSE REVIEW AND COMMENT INCORP J. SIMINSKI 11/21/24 E-MAIL REVIEW COMMENTS Tab 7-A PROJECT SCHEDULE-SUNDECK Activity ID Activity Name Orig Dur Activ % Compl Start Finish Long Center Renovations & Sun Deck AlternateLong Center Renovations & Sun Deck AlternateLong Center Renovations & Sun Deck AlternateLong Center Renovations & Sun Deck AlternateLong Center Renovations & Sun Deck AlternateLong Center Renovations & Sun Deck Alternate PreconstructionPreconstructionPreconstructionPreconstructionPreconstructionPreconstruction ST00030 CM Contract Issued 1 100%12-Jan-24 A 12-Jan-24 A ST00040 DD Development Budget & Review 1 100%08-Apr-24 A 19-Apr-24 A ST00050 50% Documents Budget & Review 1 100%06-May-24 A 24-May-24 A ST00055 Subcontractor Bids Due 10 91.13%24-Oct-24 A 06-Nov-24 ST00057 GMP Submission 8 0%07-Nov-24 18-Nov-24 ST00060 Demo Permit Submission 20 0%19-Nov-24 16-Dec-24 ST00058 Council Meeting/GMP Approval 40 0%19-Nov-24 15-Jan-25 ST00080 Building Permit Submission 50 0%19-Nov-24 29-Jan-25 ST00070 Demo Permit Issued 5 0%17-Dec-24 23-Dec-24 ST00059 NTP 1 0%16-Jan-25 16-Jan-25 ST00090 Building Permit Issued 5 0%30-Jan-25 05-Feb-25 ConstructionConstructionConstructionConstructionConstructionConstruction ProcurementProcurementProcurementProcurementProcurementProcurement Curtainwall/Glazing ProcurementCurtainwall/Glazing ProcurementCurtainwall/Glazing ProcurementCurtainwall/Glazing ProcurementCurtainwall/Glazing ProcurementCurtainwall/Glazing Procurement ST00180 Curtainwall Shop Drawings/Approval 30 0%17-Jan-25 27-Feb-25 ST00190 Curtainwall/Glazing Procurement/Onsite 120 0%28-Feb-25 15-Aug-25 Roofing ProcurementRoofing ProcurementRoofing ProcurementRoofing ProcurementRoofing ProcurementRoofing Procurement ST00247 Roofing Submittals/Approval 20 0%17-Jan-25 13-Feb-25 ST00248 Roofing Materials Procurement/Onsite 20 0%14-Feb-25 13-Mar-25 Structural Steel ProcurementStructural Steel ProcurementStructural Steel ProcurementStructural Steel ProcurementStructural Steel ProcurementStructural Steel Procurement ST00252 Steel Repair Process Submittals/Approval 20 0%17-Jan-25 13-Feb-25 ST00200 Structural Steel Shop Drawings/Approval 40 0%17-Jan-25 13-Mar-25 ST00210 Structural Steel Fabrication/Onsite 40 0%14-Mar-25 08-May-25 HVAC Equipment ProcurementHVAC Equipment ProcurementHVAC Equipment ProcurementHVAC Equipment ProcurementHVAC Equipment ProcurementHVAC Equipment Procurement ST00250 HVAC Equipment Submittals/Approval 20 0%17-Jan-25 13-Feb-25 ST00770 Dehumidification Eqpt Procurement/Onsite 0 0%13-Feb-25 ST00780 RTU Procurement/Onsite 100 0%14-Feb-25 03-Jul-25 Electrical Equipment ProcurementElectrical Equipment ProcurementElectrical Equipment ProcurementElectrical Equipment ProcurementElectrical Equipment ProcurementElectrical Equipment Procurement N D J F M A M J Jul A S O N D J F M A M 2025 2026 DD Development Budget & Review 50% Documents Budget & Review Subcontractor Bids Due GMP Submission Demo Permit Submission Council Meeting/GMP Approval Building Permit Submission Demo Permit Issued NTP Building Permit Issued Curtainwall Shop Drawings/Approval Curtainwall/Glazing Procurement/Onsite Roofing Submittals/Approval Roofing Materials Procurement/Onsite Steel Repair Process Submittals/Approval Structural Steel Shop Drawings/Approval Structural Steel Fabrication/Onsite HVAC Equipment Submittals/Approval Dehumidification Eqpt Procurement/Onsite RTU Procurement/Onsite Layout: Org by Phase TASK filter: All Activities Long Center Renovations Sun Deck Alternate CREATIVE CONTRACTORS, INC. Report Date:21-Nov-24 Page 1 of 5 Data Date: 06-Nov-24 Start Date: 12-Jan-24 Finish Date: 26-May-26 Project ID: synchroProject-6R1SD Actual Level of Effort Actual Work Remaining Work Critical Remaining Work Milestone "PRELIMINARY" - FOR IN HOUSE REVIEW AND COMMENT INCORP J. SIMINSKI 11/21/24 E-MAIL REVIEW COMMENTS Activity ID Activity Name Orig Dur Activ % Compl Start Finish ST00240 Electrical Equipment Submittals/Approval 30 0%17-Jan-25 27-Feb-25 ST00245 Electrical Equipment Procurement/Onsite 120 0%28-Feb-25 15-Aug-25 Pool Equipment ProcurementPool Equipment ProcurementPool Equipment ProcurementPool Equipment ProcurementPool Equipment ProcurementPool Equipment Procurement ST00220 Pool Equipment Submittals/Approval 40 0%17-Jan-25 13-Mar-25 ST00230 Pool Equipment Procurement/Onsite 120 0%14-Mar-25 29-Aug-25 Framing/Plastering ProcurementFraming/Plastering ProcurementFraming/Plastering ProcurementFraming/Plastering ProcurementFraming/Plastering ProcurementFraming/Plastering Procurement ST00251 Framing/Plaster Submittal/Approval 20 0%17-Jan-25 13-Feb-25 Concrete & Rebar ProcurementConcrete & Rebar ProcurementConcrete & Rebar ProcurementConcrete & Rebar ProcurementConcrete & Rebar ProcurementConcrete & Rebar Procurement ST00249 Concrete Materials Submittal/Approval 20 0%17-Jan-25 13-Feb-25 Mobilization and Set UpMobilization and Set UpMobilization and Set UpMobilization and Set UpMobilization and Set UpMobilization and Set Up ST00125 Long Center Activites Conclude 1 0%24-Jan-25*24-Jan-25 ST00120 Office Mobilization/Laydown Set 10 0%10-Feb-25*21-Feb-25 ST00130 Long Center Staff Move Out & Eqpt Removed 1 0%05-Mar-25 05-Mar-25 ST00127 Mobilize Construction Activities 0 0%06-Mar-25 ST00140 Water Level Tarp/Pool Protection Placed 10 0%06-Mar-25 19-Mar-25 ST00150 Pool Perimeter Fencing/Fall Protection 5 0%20-Mar-25 26-Mar-25 ST00160 Pool Deck Flooring Protection 5 0%27-Mar-25 02-Apr-25 ConstructionConstructionConstructionConstructionConstructionConstruction Exterior EnvelopeExterior EnvelopeExterior EnvelopeExterior EnvelopeExterior EnvelopeExterior Envelope West ElevationWest ElevationWest ElevationWest ElevationWest ElevationWest Elevation ST00292 West Concrete Demo at Roll Up Doors 5 0%24-Feb-25 28-Feb-25 ST00290 West Window Demolition 15 0%18-Aug-25 05-Sep-25 ST00295 West Steel Angle Install/Window Head 10 0%08-Sep-25 19-Sep-25 ST00297 West Install Steel Columns/Roll Up Doors 10 0%08-Sep-25 19-Sep-25 ST00300 West Steel Repair/Prep/Painting 15 0%08-Sep-25 26-Sep-25 ST00298 West FRP Concrete Slab at Roll Up 5 0%22-Sep-25 26-Sep-25 ST00310 West Framing/Sheathing/Stucco 15 0%29-Sep-25 17-Oct-25 ST00320 West Curtainwall Installation 10 0%20-Oct-25 31-Oct-25 ST00330 West Stucco Sealants/Painting 20 0%03-Nov-25 28-Nov-25 East ElevationEast ElevationEast ElevationEast ElevationEast ElevationEast Elevation ST00550 East Window Demolition 10 0%08-Sep-25 19-Sep-25 N D J F M A M J Jul A S O N D J F M A M 2025 2026 Electrical Equipment Submittals/Approval Electrical Equipment Procurement/Onsite Pool Equipment Submittals/Approval Pool Equipment Procurement/Onsite Framing/Plaster Submittal/Approval Concrete Materials Submittal/Approval Long Center Activites Conclude Office Mobilization/Laydown Set Long Center Staff Move Out & Eqpt Removed Mobilize Construction Activities Water Level Tarp/Pool Protection Placed Pool Perimeter Fencing/Fall Protection Pool Deck Flooring Protection West Concrete Demo at Roll Up Doors West Window Demolition West Steel Angle Install/Window Head West Install Steel Columns/Roll Up Doors West Steel Repair/Prep/Painting West FRP Concrete Slab at Roll Up West Framing/Sheathing/Stucco West Curtainwall Installation West Stucco Sealants/Painting East Window Demolition Layout: Org by Phase TASK filter: All Activities Long Center Renovations Sun Deck Alternate CREATIVE CONTRACTORS, INC. Report Date:21-Nov-24 Page 2 of 5 Data Date: 06-Nov-24 Start Date: 12-Jan-24 Finish Date: 26-May-26 Project ID: synchroProject-6R1SD Actual Level of Effort Actual Work Remaining Work Critical Remaining Work Milestone "PRELIMINARY" - FOR IN HOUSE REVIEW AND COMMENT INCORP J. SIMINSKI 11/21/24 E-MAIL REVIEW COMMENTS Activity ID Activity Name Orig Dur Activ % Compl Start Finish ST00560 East Steel Angle Install/Window Head 10 0%22-Sep-25 03-Oct-25 ST00570 East Steel Repair/Prep/Painting 15 0%06-Oct-25 24-Oct-25 ST00580 East Framing/Sheathing/Stucco 15 0%27-Oct-25 14-Nov-25 ST00585 East Framed Enclosures at Ductwork 20 0%27-Oct-25 21-Nov-25 ST00590 East Curtainwall Installation 10 0%17-Nov-25 28-Nov-25 ST00690 East Stucco Sealants/Painting 20 0%01-Dec-25 29-Dec-25 North ElevationNorth ElevationNorth ElevationNorth ElevationNorth ElevationNorth Elevation ST00600 North Window Demolition 25 0%22-Sep-25 24-Oct-25 ST00610 North Steel Angle Install/Window Head 20 0%06-Oct-25 31-Oct-25 ST00620 North Steel Repair/Prep/Painting 30 0%27-Oct-25 05-Dec-25 ST00630 North Framing/Sheathing/Stucco 40 0%03-Nov-25 29-Dec-25 ST00640 North Curtainwall Installation 40 0%24-Nov-25 20-Jan-26 ST00700 North Stucco Sealants/Painting 20 0%07-Jan-26 03-Feb-26 Roof Level ExteriorRoof Level ExteriorRoof Level ExteriorRoof Level ExteriorRoof Level ExteriorRoof Level Exterior ST00370 Demo/Replace Existing Roof Drains 5 0%06-Feb-25 12-Feb-25 ST00350 Demo Exisitng Mechanical 10 0%06-Feb-25 19-Feb-25 ST00360 Demo Existing Gas Piping 10 0%06-Feb-25 19-Feb-25 ST00380 New Roof Drain Installation 10 0%13-Feb-25 26-Feb-25 ST00377 Demo Existing Roof Curbs 5 0%24-Feb-25 28-Feb-25 ST00375 Selective Demo at Framing Modifications 10 0%24-Feb-25 07-Mar-25 ST00710 Structural Steel Modifications-East Roof 20 0%09-May-25 05-Jun-25 ST00810 Solar Support Stands 40 0%06-Jun-25 01-Aug-25 ST00790 Re-Roof Natatorium 60 0%06-Jun-25 29-Aug-25 ST00760 RTU Installation/Startup 5 0%07-Jul-25 11-Jul-25 ST00720 Walkway Structures Installation 20 0%07-Jul-25 01-Aug-25 ST00750 Dehumidification Ductwork Installation 40 0%13-Oct-25 05-Dec-25 ST00730 Dehumidification Unit Installation 5 0%08-Dec-25 12-Dec-25 ST00740 Dehumidification Connections/Startup 15 0%15-Dec-25 06-Jan-26 ST00800 HVAC Balancing and Cx 15 0%07-Jan-26 27-Jan-26 Roof Deck InteriorRoof Deck InteriorRoof Deck InteriorRoof Deck InteriorRoof Deck InteriorRoof Deck Interior ST00400 Mobilize/Setup Scaffolding to Deck 20 0%03-Apr-25 30-Apr-25 N D J F M A M J Jul A S O N D J F M A M 2025 2026 East Steel Angle Install/Window Head East Steel Repair/Prep/Painting East Framing/Sheathing/Stucco East Framed Enclosures at Ductwork East Curtainwall Installation East Stucco Sealants/Painting North Window Demolition North Steel Angle Install/Window Head North Steel Repair/Prep/Painting North Framing/Sheathing/Stucco North Curtainwall Installation North Stucco Sealants/Painting Demo/Replace Existing Roof Drains Demo Exisitng Mechanical Demo Existing Gas Piping New Roof Drain Installation Demo Existing Roof Curbs Selective Demo at Framing Modifications Structural Steel Modifications-East Roof Solar Support Stands Re-Roof Natatorium RTU Installation/Startup Walkway Structures Installation Dehumidification Ductwork Installation Dehumidification Unit Installation Dehumidification Connections/Startup HVAC Balancing and Cx Mobilize/Setup Scaffolding to Deck Layout: Org by Phase TASK filter: All Activities Long Center Renovations Sun Deck Alternate CREATIVE CONTRACTORS, INC. Report Date:21-Nov-24 Page 3 of 5 Data Date: 06-Nov-24 Start Date: 12-Jan-24 Finish Date: 26-May-26 Project ID: synchroProject-6R1SD Actual Level of Effort Actual Work Remaining Work Critical Remaining Work Milestone "PRELIMINARY" - FOR IN HOUSE REVIEW AND COMMENT INCORP J. SIMINSKI 11/21/24 E-MAIL REVIEW COMMENTS Activity ID Activity Name Orig Dur Activ % Compl Start Finish ST00430 Electrical Demo Interior Deck 10 0%01-May-25 14-May-25 ST00420 Prep/Paint Roof Decking 100 0%01-May-25 18-Sep-25 ST00425 Electrical Rough In- Fans 15 0%15-May-25 04-Jun-25 ST00422 Fan Installation 10 0%05-Jun-25 18-Jun-25 ST00440 Duct Sox Installation 20 0%19-Sep-25 16-Oct-25 ST00410 Demobilize/Dismantle Scaffolding to Deck 15 0%17-Oct-25 06-Nov-25 ST00450 Remove Pool Protection Tarps 10 0%07-Nov-25 20-Nov-25 Pool EquipmentPool EquipmentPool EquipmentPool EquipmentPool EquipmentPool Equipment ST00470 Pre-Demo Preparation (Prior to Valve Removal)5 0%24-Feb-25 28-Feb-25 ST00480 Set Up Temporary Pool Pump/Electrical 10 0%03-Mar-25 14-Mar-25 ST00490 Demo Electrical Equipment 10 0%17-Mar-25 28-Mar-25 ST00500 Demo Pool Equipment (Pumps, Pipe, Sanitation)20 0%17-Mar-25 11-Apr-25 ST00510 FRP Surge Tank Complete 25 0%14-Apr-25 16-May-25 ST00517 Piping Rough In 40 0%19-May-25 14-Jul-25 ST00519 Electrical Equipment Rough In 20 0%18-Aug-25 12-Sep-25 ST00515 New Pool Equipment Set 15 0%01-Sep-25 19-Sep-25 ST00521 Electrical Equipment Connections/Trim 10 0%15-Sep-25 26-Sep-25 ST00518 Piping/Equipment Connections and Trim 15 0%22-Sep-25 10-Oct-25 ST00522 Pool Equipment Startup 10 0%13-Oct-25 24-Oct-25 ST00525 Temporary Pool Equipment Demobilization 3 0%27-Oct-25 29-Oct-25 ST00523 Pool Equipment Programming 10 0%27-Oct-25 07-Nov-25 ST00524 Pool Complete for Health Dept Inspection 10 0%04-Feb-26 17-Feb-26 Sun Deck AlternateSun Deck AlternateSun Deck AlternateSun Deck AlternateSun Deck AlternateSun Deck Alternate SD00002 Procure Structural Steel (Shopts, etc)60 0%17-Jan-25*10-Apr-25 SD00003 Procure Windows (Shops, etc)90 0%17-Jan-25*22-May-25 SD00004 Demolition Sun Deck fdns, slab, etc 7 0%22-Sep-25 30-Sep-25 SD00005 Demolish curtainwall - lower 2 sections 3 0%01-Oct-25 03-Oct-25 SD00006 Demolish Structural Steel & Knee Wall 5 0%06-Oct-25 10-Oct-25 SD00007 New Foundations 13 0%13-Oct-25 29-Oct-25 SD00008 New CMU Wall & Bond Beams 25 0%30-Oct-25 03-Dec-25 SD00012 Underground MEP 10 0%04-Dec-25 17-Dec-25 N D J F M A M J Jul A S O N D J F M A M 2025 2026 Electrical Demo Interior Deck Prep/Paint Roof Decking Electrical Rough In- Fans Fan Installation Duct Sox Installation Demobilize/Dismantle Scaffolding to Deck Remove Pool Protection Tarps Pre-Demo Preparation (Prior to Valve Removal) Set Up Temporary Pool Pump/Electrical Demo Electrical Equipment Demo Pool Equipment (Pumps, Pipe, Sanitation) FRP Surge Tank Complete Piping Rough In Electrical Equipment Rough In New Pool Equipment Set Electrical Equipment Connections/Trim Piping/Equipment Connections and Trim Pool Equipment Startup Temporary Pool Equipment Demobilization Pool Equipment Programming Pool Complete for Health Dept Inspection Procure Structural Steel (Shopts, etc) Procure Windows (Shops, etc) Demolition Sun Deck fdns, slab, etc Demolish curtainwall - lower 2 sections Demolish Structural Steel & Knee Wall New Foundations New CMU Wall & Bond Beams Underground MEP Layout: Org by Phase TASK filter: All Activities Long Center Renovations Sun Deck Alternate CREATIVE CONTRACTORS, INC. Report Date:21-Nov-24 Page 4 of 5 Data Date: 06-Nov-24 Start Date: 12-Jan-24 Finish Date: 26-May-26 Project ID: synchroProject-6R1SD Actual Level of Effort Actual Work Remaining Work Critical Remaining Work Milestone "PRELIMINARY" - FOR IN HOUSE REVIEW AND COMMENT INCORP J. SIMINSKI 11/21/24 E-MAIL REVIEW COMMENTS Activity ID Activity Name Orig Dur Activ % Compl Start Finish SD00009 Slab on Grade 7 0%18-Dec-25 29-Dec-25 SD00010 New Structural Steel & Roof Deck 18 0%30-Dec-25 23-Jan-26 SD00011 Roofing 7 0%26-Jan-26 03-Feb-26 SD0015 Above Ceiling MEP Rough-in 15 0%04-Feb-26 24-Feb-26 SD00013 Exterior Stucco 20 0%04-Feb-26 03-Mar-26 SD00016 Plaster Soffit 12 0%25-Feb-26 12-Mar-26 SD00018 Paint Exterior 6 0%04-Mar-26 11-Mar-26 SD00014 Windows 7 0%04-Mar-26 12-Mar-26 SD00017 Interior Drywall 10 0%13-Mar-26 26-Mar-26 SD00019 Paint Interior 6 0%27-Mar-26 03-Apr-26 SD00020 Ceiling Grid & Tile 5 0%06-Apr-26 10-Apr-26 SD00021 Ceiling Electrical - Lights 5 0%13-Apr-26 17-Apr-26 SD00022 Urethane Floor Coating 7 0%20-Apr-26 28-Apr-26 SD00023 MEP Trim 5 0%29-Apr-26 05-May-26 SD00024 Inspections - Punchlist - Completion 5 0%06-May-26 12-May-26 Critical Dates/MilestonesCritical Dates/MilestonesCritical Dates/MilestonesCritical Dates/MilestonesCritical Dates/MilestonesCritical Dates/Milestones ST00540 Dehumidification Equipment Onsite 0 0%13-Feb-25 ST00650 Pool Startup 0 0%27-Oct-25 ST00670 Completion Certificate Issued 0 0%03-Feb-26 CommissioningCommissioningCommissioningCommissioningCommissioningCommissioning Substantial CompletionSubstantial CompletionSubstantial CompletionSubstantial CompletionSubstantial CompletionSubstantial Completion ST00660 Subtantial Completion 5 0%13-May-26 19-May-26 Punch List CorrectionsPunch List CorrectionsPunch List CorrectionsPunch List CorrectionsPunch List CorrectionsPunch List Corrections A1010 Punch List Corrections 15 0%18-Feb-26 10-Mar-26 Warranties, Guarantees & TrainingWarranties, Guarantees & TrainingWarranties, Guarantees & TrainingWarranties, Guarantees & TrainingWarranties, Guarantees & TrainingWarranties, Guarantees & Training A1040 Owner Training 10 0%18-Feb-26 03-Mar-26 A1030 Prepare & Issue As-Builts, Guarantees & Warranties 5 0%20-May-26 26-May-26 N D J F M A M J Jul A S O N D J F M A M 2025 2026 Slab on Grade New Structural Steel & Roof Deck Roofing Above Ceiling MEP Rough-in Exterior Stucco Plaster Soffit Paint Exterior Windows Interior Drywall Paint Interior Ceiling Grid & Tile Ceiling Electrical - Lights Urethane Floor Coating MEP Trim Inspections - Punchlist - Completion Dehumidification Equipment Onsite Pool Startup Completion Certificate Issued Punch List Corrections Owner Training Layout: Org by Phase TASK filter: All Activities Long Center Renovations Sun Deck Alternate CREATIVE CONTRACTORS, INC. Report Date:21-Nov-24 Page 5 of 5 Data Date: 06-Nov-24 Start Date: 12-Jan-24 Finish Date: 26-May-26 Project ID: synchroProject-6R1SD Actual Level of Effort Actual Work Remaining Work Critical Remaining Work Milestone "PRELIMINARY" - FOR IN HOUSE REVIEW AND COMMENT INCORP J. SIMINSKI 11/21/24 E-MAIL REVIEW COMMENTS Tab 8 RFI LOG REQUEST FOR INFORMATION LOGLONG CENTER - GMP PHASECLEARWATER, FLORIDA11/21/2024 9:06RFI Question No.RFI DateBid PackageSubjectRFI Question from CCIResponse from A/ERFI Response Date1 10/23/2024 Plumbing Please provide the manufacturer and model numbers of the sump pumps (SP-1 and SP-2).Select pump per performance standards chlorine rating. 2 10/23/2024 SignageSheet A301 on the esat elevation shows a wall sign but does not have any detail as far as specs or sizes. Same for sheet A302, show a sign on the west façade and noites A313 and A309 to reference for sign details but these pages are not in the docs. Can you provide sign details?Information for aluminum signage is located on sheet A406. Installation design, is by delegated engineer. Installation must meet hurricane wind rating for the area. 3 10/28/2024 GlazingSpecifications 08 41 13 and 08 44 13 do not clarify the Aluminum Finish Intent. Clear Anodized, Black Anodized, and Painted are all shown/listed. Please confirm a Finish Intent. Anodized (what color) or PaintedCurtain wall finish is Black Anodized. 4 10/28/2024 GlazingPlease confirm if Glazier is to include Onsite Water Testing or if this will be by the CM/Contractor. 5 10/28/2024 GlazingDrawing Details on Shee A-811 indicate Curtain Wall attachment to the Crown Door Assembly. This cannot be done, yet Crown has the Glass within its system. Confirm all glass at the Crown Doors is to be provided by the Crown Door Installer/Vendor and no the Glazier. That's correct. Curtain wall attaches to crown door frame, this was confirmed with Crown door. Glass at Crown door is to be provided by Curtain wall contractor.6 10/28/2024 GlazingConfirm all demolition and haul away of the existing glazing system is to be by a demo company and not included in the Glaziers package. 7 10/28/2024 GlazingConfirm that installation will be performed in one phase and not broken out in multiple phases based on occupancy of the buildingYes, installation will only be a single phase. 8 10/28/2024 Electrical Dwg. E-202: Floor Plan, Keynote No. 4 indicates Alternate Bid; All home runs are shown with Key Note No. 4. Am I to assume all home runs are an alternate bid?Only homeruns with keynote 4 will be part of add alternate bid. Coordinate with Aquatic plan and verify intent between Base bid and Alternate bid items associated with pool equipments. Alternates include:Pool Equipment Upgrades & Sundeck Addition9 10/28/2024 Electrical Dwg. E-302: Keynote No. 2; Please identify “Bafcon” and manufacturer.Refer to Mechanical plan sheet M-610 for fan specifications. Bafcon controller is associted with "Big Ass fan" being specified. 10 10/28/2024 Electrical Dwg. E-304/E-701: Lighting fixtures on Sundeck identified as Type A; Schedule indicates Type A1?type A and A1 are same same fixure. 11 10/28/2024 Electrical Dwg. E-701: Panel B indicates 600A Main Circuit Breaker; 150A bus?Provide 150A main with 150A bus. 12 10/28/2024 Electrical Dwg. E-701: Location of Type X1 and X2 fixtures?Disregard Type X1 and X2 fixtures. Not used.13 11/4/2024 Electrical The exisiting fire alarm system in Bosch and Maher is who currently services it. My question ois do I have to use them or can I use someone else?Please stay with the existing system for pricing. 14 11/4/2024 Electrical Do I need to carry monies for a coordination study since we are adding new electical panels to an exisiting service?To be determined by contractor15 11/4/2024 Electrical Mr. Walker mentioned a brand of VFD's I am to purchase and install, what is the brand name?Review project specifications16 11/4/2024 Electrical What are the hours we are able to work?Refer to Clearwater web page. 17 11/4/2024 Electrical For the new panels and transformer, we are to install on page E-202 shows an enlarged electrical room that has 2 doors the we saw today off the gym only had one door and no room for any additional equipment? Main electrical room is in existing building and has space available for additional panels. Please get familiar with main electrical room for the building. 18 11/7/2024 Roofing In Section 075423 in 2.2 b3 says insulation is R-30 but according to drawing page A720 roof details calls for R-20. Please clarify which is correct.Construction documents dated 10.28.24 show R-25 on sheet A7201920 Tab 9 QUALIFICATIONS, CLARIFICATIONS, AND ASSUMPTIONS Creative Contractors, Inc. Pinellas Long Center Natatorium Guaranteed Maximum Price Qualifications, Assumptions & Clarifications November 26, 2024 1 of 5 The following qualifications are submitted as an attachment to the GMP proposal and shall be incorporated into any agreement between the Owner and Creative Contractors, Inc. Where conflicts exist between language in this qualifications, assumptions and clarifications document, the Agreement (and Addendums), and the Contract Documents, this qualifications, assumptions, and clarifications document shall govern. Section 01 – General Qualifications 1-1. Basis of Guaranteed Maximum Price a) 100% CD drawings received on 10/4/2024. These drawings are prepared by Wannemacher Jensen Architects, Inc., dated September 2024, and titled “Long Center Natatorium Renovation”. b) 100% CD drawings received on 10/4/2024. These drawings are prepared by Wannemacher Jensen Architects, Inc., dated September 2024, and titled “Long Center Natatorium Renovation Alternate”. c) 100% CD specifications received on 10/4/2024. These drawings are prepared by Wannemacher Jensen Architects, Inc., and titled “Long Center Natatorium”. d) We received “Addendum 1” on 10/28/2024. It is incorporated into the GMP. e) We received “Addendum 2” on 11/7/2024. It is incorporated into the GMP. f) We received a post bid “Addendum 1” on 11/19/2024. It is incorporated into the GMP. g) We received RFI responses to 16 out of 18 pre-construction RFIs. These are included in the GMP h) A Drawings and Documents List is included in this 100% CD Pricing Report. i) Substitutions have been included in pricing this scope of work and are further detailed by these qualifications. j) The Owner and Architect shall provide electronic files to the CM upon request and execution of the proper release at no additional cost to the CM. k) The CM will provide red-line As-Builts for Final Record Documents to the Owner/Architect in .pdf format. We do not include any electronic, CAD, or Revit As-Builts as part of our work scope. l) Creative Contractors assumes a mutually agreed upon contract and terms, along with all mutually agreed insurance requirements and terms. 1-2. Insurance and Bonds a) A Performance and Payment bond has been included. b) All Risk or Builder’s Risk is included as an allowance. The allowance will be reconciled with our insurance carrier, which takes 1-2 weeks. i. All deductibles to be paid by the Owner. c) General Liability, Excess General Liability, Workmen’s Compensation and Automobile Liability Insurance is included in the estimate. d) Professional liability and pollution liability insurance is not included. 1-3. Building Permit Application and fees: a) Application and review fees are by Owner. b) Permit fees are by Owner. c) Stormwater Plan (SWFWMD) Permit and fees by Owner. d) Utility Deposits and meter/connection fees are by Owner. e) Inspection fees are by Owner. Creative Contractors, Inc. Pinellas Long Center Natatorium Guaranteed Maximum Price Qualifications, Assumptions & Clarifications November 26, 2024 2 of 5 f) Threshold Inspections are by Owner. g) Any other fees required by the local and/or state health department, or any other regulatory agency or AHJ are by Owner. 1-4. Project Schedule a) We have included 420 days of construction duration fr om construction start of February 17th, 2025, to reach substantial completion for this project on April 13, 2026. i. The Owner shall execute a Notice to Proceed for Procurement Operations separately from the NTP for construction. The actual construction start date shall be identified in our detailed project schedule, revised accordingly to reflect material lead times. The construction start date, and not the start of procurement operations, shall be the basis of the project “start”. In any case, construction operations shall not commence any earlier than receipt of all required permits, executed contract, and Owner’s written Notice to Proceed for construction. ii. Our scheduled duration is based on a continuous, uninterrupted performance of the work, unless noted in our schedule for procurement of material and equipment. iii. The Project Schedule assumes no force majeure delays, materials shortages, schedule impacts, work stoppages, or COVID pandemic related delays or stoppages. b) 5-day work weeks are included in this GMP. Working hours are scheduled as Monday thru Friday, 7:00 a.m. to 3:30 p.m. c) We do not include a cost-loaded schedule or cost correlation timeline. d) We have included (10) working days total processing time for most submittals needing review by either architect, architect’s consultant, or both. 1-5. Hazardous Materials: a) Removal of any hazardous materials encountered during work and/or not identified by the Contract Documents is specifically excluded from this estimate. 1-6. Temporary Utilities and Facilities: a) Power i. Creative Contractors, Inc. assumes adequate power for construction is available from owner’s existing service or on nearby pole mounted transformer. ii. Consumption costs shall be by Owner. b) Water i. Creative Contractors, Inc. assumes adequate water for construction is available from owner’s existing service or at nearby fire hydrant. ii. Water consumption costs shall be by the Owner. iii. Any new service deposits, meter fees, etc. shall be by the Owner. iv. Water for any dust control systems shall be sourced from the Owner’s existing water supply. Consumption costs shall be by the Owner. Creative Contractors, Inc. Pinellas Long Center Natatorium Guaranteed Maximum Price Qualifications, Assumptions & Clarifications November 26, 2024 3 of 5 1-7. Existing Utilities and Location Confirmation: a) We include uncovering and documenting locations of existing utilities only as required to install our new work. We do not include utility confirmation, record drawings, or as-builts of all existing to remain utilities on the site. 1-8. Testing, Inspection, and Monitoring: a) We do not include any City of Clearwater, municipality, or third-party inspection service fees, to include any associated overtime, premium time, or weekend inspection fees. These fees shall be paid directly by the Owner. b) All materials testing shall be funded by Contractor via allowance #9. c) All Threshold inspection services shall be by the Owner. d) All monitoring and observation services shall be by the Owner to include any associated overtime, premium time, or weekend inspection fees. 1-9. Costs for changes to the work, if necessary, associated with Permit Review, Owner, or other Authorities Having Jurisdiction (AHJ) comments and/or changes shall be funded by the Owner via change order to the contract. 1-10. Delegated Design: a) This estimate assumes all work depicted in the Contract Documents complies with all codes, ordinances, and regulations per all Authorities Having Jurisdiction (AHJ) and does not include any provisions for corrective work to the Contract Documents. Any corrective work required as a result of non-compliant design will result in an appropriate change in the contract amount and time of the Contract. b) Where delegated design is noted in the Contract Documents, it is assumed the Owner’s Design Professional(s) have performed and incorporated any necessary design into the Contract Documents. 1-11. Domestic Manufacture: a) All materials shall be procured from sources common to their specific trade. Where materials are specified by acceptable manufacturer, source of materials shall be as commonly provided by that manufacturer and/or supplier. We do not include domestic origin for all products, materials, and/or assemblies. 1-12. We acknowledge the Owner’s desire to participate in a Direct Order Purchase (DPO) program to realize sales tax savings due to the Owner’s tax-exempt status. DPO’s will be processed on single vendor material amounts $5,000.00 and greater only. Note: Not all vendors participate in DPO programs, specifically, but not limited to site contractors (earthwork and paving materials), elevators, joists manufacturers (steel and concrete), casework or custom wood fabricators, etc. 1-13. Mitigation / Abatement Measures: We are not in receipt of any specific mitigation / abatement measures, environmental surveys, or assessments, and have not included costs for such mitigation / abatement in this estimate. Creative Contractors, Inc. Pinellas Long Center Natatorium Guaranteed Maximum Price Qualifications, Assumptions & Clarifications November 26, 2024 4 of 5 1-14. Where references to allowances are made, please refer to the Schedule of Allowances for dollar amounts and descriptions. Section 02 – Work Scope Clarifications 04-1 Steel: a. We have included an allowance for touch up and repairs as noted on the structural drawings. 07-1. Roofing: a. Removal of the entire roofing system down to the roof deck. b. Roof curbs to be remain in place and reroofed. Grilles to remain under deck as is. c. Insulation with an R-Value of 25 07-2. Waterproofing / Joint Sealants: a. Knee wall has cementitious waterproofing as detailed. 08-1. Doors, Frames, and Hardware: a. Caring two (2) hydraulically operated STT-II Bifold Steel Doors, by Crown Doors 09-1. Finishes/flooring: a. Refinishing of the pool deck is excluded b. included the sills shown on Detail 8/A822 c. Urethane floor coating is not included. 09-2. Paint: a. Assuming painting deck only, no trusses b. Paint used as specified: Sherwin Williams c. Chemical or wire brush removal of existing paint flakes at ceiling deck in lieu of sandblast. d. Only painting existing steel behind new windows where the paint has been removed for repairs and/or the paint is flaking off/damaged. 09-2. Drywall / Stucco: a. 8” studs used at Mechanical Chases. Assumed 6” studs for all other locations. 10-1. Signage: a. Murals are excluded. Building letters and logo are included as allowance. 13-1. Pools: a. We have included chlorination and circulation of existing pool while replacing the pool equipment. 22-1. Plumbing: a. Replace (10) and add (2) roof drains with new Z-100 Drains. b. Install new SCH-40 Black steel gas piping with mega press fittings. Creative Contractors, Inc. Pinellas Long Center Natatorium Guaranteed Maximum Price Qualifications, Assumptions & Clarifications November 26, 2024 5 of 5 23-1. Mechanical: a. Vinyl wrapping of DH-1 and DH-2 to be performed in field and is included as an allowance. 26-1. Electrical: a. Removal and replacement of MEP room ceilings for conduit runs is included. b. Maire Company Fire alarm is to be furnished and installed by the owner. 33-1 Site: a. Miscellaneous Patching/Sidewalk Repair, if required, is included as an allowance. 33-2 Landscaping: a. An allowance is included for: Replacement of shrubs, flowers, plants, etc. if damaged by construction. 48-1 Photovoltaic: a. We are carrying Option #3 of AGT proposal which includes: I. Furnish and install 54 Q Cells Q.Tron XL-G2.3/BFG 625 watt solar modules. A total of 33,210 Watts DC to be installed. II. Furnish and Install 54 APsmart RDS-S-PLC rapid shutdown devices per final design. III. Furnish and install 1 CPS America 25 kW 480-volt inverte rs per final design. A total of 25,000 Watts AC to be installed with a system output of 31 Amps. Tab 10 DRAWING LOG Drawing No. Drawing Title Drawing Date Received Date REVISION NAMEG-000Cover10/28/202410/28/2024Construction Documents/PermitG-101Drawing Legend and Data Building10/28/202410/28/2024Construction Documents/PermitG-102Sheet Index10/28/202410/28/2024Construction Documents/PermitG-103Code Analysis10/28/202410/28/2024Construction Documents/PermitG-104Mounting Heights10/28/202410/28/2024Construction Documents/PermitB-101Level 1- Life Safety Plan 10/28/202410/28/2024Construction Documents/PermitB-102Mezzanine - Life Safety Plan 10/28/202410/28/2024Construction Documents/PermitAD-100Demo Site Plan10/28/202410/28/2024Construction Documents/PermitAD-101Demo Floor Plan10/28/202410/28/2024Construction Documents/PermitAD-102Demo Roof Plan10/28/202411/19/2024Construction Documents/PermitAD-103Demo Reflected Ceiling Plan10/28/202410/28/2024Construction Documents/PermitAD-121Demo Exterior Elevations10/28/202410/28/2024Construction Documents/PermitAD-122Demo Exterior Elevations10/28/202410/28/2024Construction Documents/PermitA-001Site Plan10/28/202410/28/2024Construction Documents/PermitA-101Level 1- Floor Plan10/28/202410/28/2024Construction Documents/PermitA-201Relected Ceiling Plan10/28/202410/28/2024Construction Documents/PermitA-301Exterior Elevations10/28/202410/28/2024Construction Documents/PermitA-302Exterior Elevations10/28/202410/28/2024Construction Documents/PermitA-310Building Sections10/28/202410/28/2024Construction Documents/PermitA-401Pool Filtration Room10/28/202410/28/2024Construction Documents/PermitA-406Enlarged Plan - Ventilation Towers10/28/202410/28/2024Construction Documents/PermitA-407Enlarged Plan - Exterior Truss10/28/202410/28/2024Construction Documents/PermitA-408Enlarged Plan- Exterior Truss South10/28/202410/28/2024Construction Documents/PermitA-511Interior Elevations10/28/202410/28/2024Construction Documents/PermitA-512Interior Elevations10/28/202410/28/2024Construction Documents/PermitA-701Wall Sections10/28/202410/28/2024Construction Documents/PermitA-720Roof Details10/28/202410/28/2024Construction Documents/PermitA-721Roof Details10/28/202410/28/2024Construction Documents/PermitA-722Enclosure Details 10/28/202410/28/2024Construction Documents/PermitA-723Photovoltaic Details10/28/202410/28/2024Construction Documents/PermitA-802Partition Types10/28/202410/28/2024Construction Documents/PermitA-810Door Schedules10/28/202410/28/2024Construction Documents/PermitA-811Door Details10/28/202410/28/2024Construction Documents/PermitA-820Curtain Wall Details 10/28/202410/28/2024Construction Documents/PermitA-822Curtain Wall Details 10/28/202410/28/2024Construction Documents/PermitB2-101Level 1- Life Safety Plan Sundeck10/28/202410/28/2024Construction Documents/PermitAD2-101Demo Floor Plan_Enclosed Sundeck10/28/202410/28/2024Construction Documents/PermitAD2-121Demo Exterior Elevations Sundeck10/28/202410/28/2024Construction Documents/PermitA2-101Level 1- Floor Plan Enclosed Sundeck10/28/202410/28/2024Construction Documents/PermitA2-201Relected Ceiling Plan- Enclosed Sundeck10/28/202410/28/2024Construction Documents/PermitA2-301Exterior Elevations- Enclosed Sundeck 10/28/202410/28/2024Construction Documents/PermitA2-310Section- Enclosed Sundeck10/28/202410/28/2024Construction Documents/PermitA2-410Interior Elevations- Enclosed Sundeck10/28/202410/28/2024Construction Documents/PermitLong Center Natatorium - RenovationDrawing Log A2-722Roof Details10/28/202410/28/2024Construction Documents/PermitA2-723Details10/28/202410/28/2024Construction Documents/PermitA2-820Curtail Wall & Store Front Elevations10/28/202410/28/2024Construction Documents/PermitID2-101Sundeck- Finish Plan 10/28/202410/28/2024Construction Documents/PermitS-001General Notes10/4/202410/28/2024Construction Documents/PermitS-002Design Loads, Design Criteria & Legand10/4/202410/28/2024Construction Documents/PermitS-100Foundation Plan10/4/202410/28/2024Construction Documents/PermitS-101Foundation Sections & Details10/4/202410/28/2024Construction Documents/PermitS-102Mech. HVAC Chase Foundation Plan, Sections & Details10/4/202410/28/2024Construction Documents/PermitS-200Roof Framing Plan, Sections & Details10/4/202411/19/2024Construction Documents/PermitS-201West Side Door & Misc. Framing Mods Sections & Details10/4/202410/28/2024Construction Documents/PermitS-202HVAC Chase Roof Framing Plan, Sections & Details 10/4/202410/28/2024Construction Documents/PermitS-203Dehumidifier Platform Framing Plan, Sections & Details10/4/202411/19/2024Construction Documents/PermitS-204Exist. Roof/Wall Framing Repair Mods Plan 10/4/202410/28/2024Construction Documents/PermitS-205Exist. Roof/Wall Framing Repair Mods Plan (SHT. 1 of 2)10/4/202410/28/2024Construction Documents/PermitS-206Exist. Roof/Wall Framing Repair Mods Plan (SHT. 2 of 2)10/4/202410/28/2024Construction Documents/PermitS-207Exist. Truss & Framing Repairs (SHT. 1 of 11)10/4/202410/28/2024Construction Documents/PermitS-208Exist. Truss & Framing Repairs (SHT. 2 of 11)10/4/202410/28/2024Construction Documents/PermitS-209Exist. Truss & Framing Repairs (SHT. 3 of 11)10/4/202410/28/2024Construction Documents/PermitS-210Exist. Truss & Framing Repairs (SHT. 4 of 11)10/4/202410/28/2024Construction Documents/PermitS-211Exist. Truss & Framing Repairs (SHT. 5 of 11)10/4/202410/28/2024Construction Documents/PermitS-212Exist. Truss & Framing Repairs (SHT. 6 of 11)10/4/202410/28/2024Construction Documents/PermitS-213Exist. Truss & Framing Repairs (SHT. 7 of 11)10/4/202410/28/2024Construction Documents/PermitS-214Exist. Truss & Framing Repairs (SHT. 8 of 11)10/4/202410/28/2024Construction Documents/PermitS-215Exist. Truss & Framing Repairs (SHT. 9 of 11)10/4/202410/28/2024Construction Documents/PermitS-216Exist. Truss & Framing Repairs (SHT. 10 of 11)10/4/202410/28/2024Construction Documents/PermitS-217Exist. Truss & Framing Repairs (SHT. 11 of 11)10/4/202410/28/2024Construction Documents/PermitS-101ASundeck Foundation Plan & Sections10/4/202410/28/2024Construction Documents/PermitS-102ASundeck Foundation Plan & Sections10/4/202410/28/2024Construction Documents/PermitS-201ASundeck Roof Framing Plan, Sections & Details 10/4/202410/28/2024Construction Documents/PermitM-001Mechanical Legends, and Abbreviations10/28/202410/28/2024Construction Documents/PermitM-101Demo Floor Plan- HVAC10/28/202410/28/2024Construction Documents/PermitM-102Demo Floor Plan- Mechanical Yard- HVAC10/28/202410/28/2024Construction Documents/PermitM-103Demo Roof Plan- HVAC10/28/202410/28/2024Construction Documents/PermitM-104Demo Floor Plan- Mechanical Yard- HVAC10/28/202410/28/2024Construction Documents/PermitM-201Level 1- Floor Plan - HVAC10/28/202410/28/2024Construction Documents/PermitM-202Level 2- Floor Plan- HVAC10/28/202410/28/2024Construction Documents/PermitM-203Roof Plan- HVAC10/28/202410/28/2024Construction Documents/PermitM-204Level 1 - Alternate Enclosed Sundeck- HVAC10/28/202410/28/2024Construction Documents/PermitM-510Details10/28/202410/28/2024Construction Documents/PermitM-520Details10/28/202410/28/2024Construction Documents/PermitM-610Schedules10/28/202410/28/2024Construction Documents/PermitM-620Schedules10/28/202410/28/2024Construction Documents/PermitP-000Plumbing Notes, Legends, and Abbreviations10/28/202410/28/2024Construction Documents/PermitP-101Demo Floor Plan- Plumbing10/28/202410/28/2024Construction Documents/PermitP-102Demo Floor Plan- Mechanical Yard- Plumbing10/28/202410/28/2024Construction Documents/PermitP-103Demo Roof Plan- Plumbing10/28/202410/28/2024Construction Documents/PermitP-201Level 1- Floor Plan - Plumbing10/28/202410/28/2024Construction Documents/PermitP-202Floor Plan- Mechanical Yard- Plumbing10/28/202410/28/2024Construction Documents/PermitP-203Roof Plan - Plumbing10/28/202410/28/2024Construction Documents/PermitP-204Level 1 - Alternate Enclosed Sundeck- Plumbing10/28/202410/28/2024Construction Documents/Permit P-510Plumbing Risers Diagrams10/28/202410/28/2024Construction Documents/PermitE-000Electrical Symbols and Abbreviations 10/28/202410/28/2024Construction Documents/PermitE-001 Site Plan- Electrical10/28/202410/28/2024Construction Documents/PermitE-101Electrical Demo - Floor Plans 10/28/202410/28/2024Construction Documents/PermitE-102Electrical Demo- Roof Plans 10/28/202410/28/2024Construction Documents/PermitE-202Pool Equipment & 2nd Fl Elec Rm Enlarged Plans 10/28/202410/28/2024Construction Documents/PermitE-301Level 1- Floor Plan- Power10/28/202410/28/2024Construction Documents/PermitE-3022nd Floor -Floor Plan- Electrical10/28/202410/28/2024Construction Documents/PermitE-303Roof Plan- Electrical10/28/202410/28/2024Construction Documents/PermitE-304Roof Plan - Future PV10/28/202410/28/2024Construction Documents/PermitE-305Sundeck Enlarged Plans- Electrical10/28/202410/28/2024Construction Documents/PermitE-501Electrical Details10/28/202410/28/2024Construction Documents/PermitE-601Electrical Riser Diagrams10/28/202410/28/2024Construction Documents/PermitE-701Electrical Schedules10/28/202410/28/2024Construction Documents/PermitAQ000Pool Reference Plan10/28/202410/28/2024Construction Documents/PermitAQ100Pool Mechancial Room Demolition (Base Bid)10/28/202411/19/2024Construction Documents/PermitAQ101Pool Mechancial Room Demolition (Alternate)10/28/202410/28/2024Construction Documents/PermitAQ102Pool Mechancial Room Demolition Photos (Base Bid)10/28/202411/19/2024Construction Documents/PermitAQ103Pool Mechancial Room Demolition Photos (Alternate)10/28/202410/28/2024Construction Documents/PermitAQ200Pool Mechaincal Room Renovation Notes & Schedules (Base Bid)10/28/202411/19/2024Construction Documents/PermitAQ201Pool Mechanical Room Renovation Plan (Base Bid)10/28/202411/19/2024Construction Documents/PermitAQ202Pool Mechanical Room Renovation Plan (Alternate)10/28/202411/19/2024Construction Documents/PermitAQ203Competition Pool Surge Tank Plans & Sections (Base Bid)10/28/202410/28/2024Construction Documents/PermitAQ204Pool Mechanical Details10/28/202411/19/2024Construction Documents/PermitAQ205Pool Mechanical Details10/28/202410/28/2024Construction Documents/PermitAQ206Pool Mechanical Details10/28/202410/28/2024Construction Documents/PermitAQ207Pool Mechanical Details10/28/202410/28/2024Construction Documents/PermitAQ300Competition Pool Systems Schematics10/28/202411/19/2024Construction Documents/PermitAQ301Training Pool Systems Schematics10/28/202411/19/2024Construction Documents/PermitAQ302Long Center Natatorium- Technical Specifications 10/28/202410/28/2024Construction Documents/Permit CMAR Contract Construction Manager at Risk RFQ 07-24 This CONTRACT made and entered into on this Vetdayof Aga.rGL. , 2014' by and between the City of Clearwater, Florida, a municipal corporation, hereinafter designated as the "City" or "Owner", and Creative Contractors Inc., authorized to do business in Pinellas County and State of Florida, hereinafter designated as the "Construction Manager". The contracting entities shall collectively be known as the "Parties." WITNESSETH: WHEREAS, the Clearwater City Council has approved using the Construction Manager at Risk approach on appropriate projects as determined by the City's Engineering Department; and WHEREAS, the City desires to engage the services of the Construction Manager to provide management of the necessary construction, design, and preconstruction services (collectively referred to as the "Services") subject to the terms and conditions set forth in this Contract and any agreement incorporated into this Contract by reference; and WHEREAS, the City selected the Construction Manager in accordance with the competitive selection process based on information and representations given by the Construction Manager in a response to Request for Qualifications 07-24. NOW, THEREFORE, IT IS AGREED BY AND BETWEEN THE PARTIES THAT THE ABOVE RECITALS AND REPRESENTATIONS ARE TRUE AND ACCURATE AND ARE INCORPORATED HEREIN BY REFERENCE AND THE PARTIES FURTHER AGREE AS FOLLOW: ARTICLE 1: SCOPE OF WORK, CONTRACT DOCUMENTS, AND TERM 1.1 The Construction Manager and its successors, assigns, executors or administrators, in consideration of the sums of money, as herein after set forth to be paid by the City to the Construction Manager, shall and will at its own cost and expense perform all labor, furnish all materials, tools and equipment for all individual projects assigned as a result of this Contract. 1.2 For each individual project assigned, in accordance with such proposal and technical supplemental specifications and such other special provisions and drawings, if any, which will be submitted by the City, together with any advertisement, instructions to bidders, general conditions, proposal and bond, which may be hereto attached, and any drawings, if any, which may be herein referred to, are hereby made a part of this Contract, and all of said work to be performed and completed by the contractor and its successors and assigns shall be fully completed in a good and workmanlike manner to the satisfaction of the City. 1.3 Unless otherwise specified in this Contract, all work shall be completed in accordance with Section III and Section IV of the City of Clearwater Contract Specifications (the Specifications"). For the purposes of this Contract, the term Contractor in Section III shall include the Construction Manager. The Specifications, as may be supplemented and changed, along with this Contract constitute the "Contract Documents." All terms and 1 conditions set forth in RFQ 07-24, Standard Terms and Conditions are incorporated by reference and attached hereto. Any inconsistency in documents relating to this Contract shall be resolved by giving precedence in the following order: (i) Proposals(s); (ii) this Contract and any amendments; (iii) Specifications; (iv) RFQ 07-24, Standard Terms and Conditions. 1.4 The term of this Contract shall commence upon execution of this Contract by the Parties and shall terminate after completion and acceptance of the Projects as provided herein and upon final payment in accordance with the Contract Documents. ARTICLE 2: CONSTRUCTION MANAGER'S DUTIES AND STATUS 2.1 The Construction Manager recognizes the relationship of trust and confidence established between it and the City by this Contract, and agrees with the City to furnish its best skill and judgment and the overall supervision of its executives; to furnish efficient business administration and superintendence; and to use every effort to keep upon the project site at all times an adequate supply of workforce and materials to secure its execution and completion in the most expeditious and economical manner. 2.2 The Construction Manager represents that it has made a thorough examination of the premises and is thoroughly familiar with the conditions under which it is to work. 2.3 The Construction Manager agrees to perform and complete the Services in accordance with laws, rules, and regulations of all governmental authorities and departmentsthereof. 2.4 The Construction Manager agrees to cooperate with the City, Architect -Engineer, or any other Design Professional in all respects, including, but not limited to, providing necessary preconstruction services, such as evaluation of methods, availability and costs of the various components of the Services while under design consideration; supervising the Services and the progress thereof; the coordination of the Services and suggesting changes in the Services; and supplying information as to costs and availability of materials and methods of construction in order, amongst other things, to reduce costs wherever the same may be practicably consistent with the quality of the Services presented in the Contract Documents. 2.5 The Construction Manager agrees to the following: a) In connection with the performance of work under this Contract, the Construction Manager agrees not to discriminate against any employee or applicant for employment because of race, sex, religion, color, national origin, or any other protected class under federal or state law. The aforesaid provision shall include, but not be limited to, the following employment: upgrading demotion or transfer recruitment or recruitment advertising lay-off or termination rates of pay or other forms of compensation; and 2 selection for training, including apprenticeship b) The Construction Manager agrees to post hereafter in conspicuous places, available for employees or applicants for employment, notices to be provided by the contracting officer setting forth the provisions of the non-discrimination clause. c) The Construction Manager further agrees to insert the foregoing provisions in all contracts hereunder, including contracts or agreements with labor unions and/or worker's representatives, except sub -contractors for standard commercial supplies or raw materials. ARTICLE 3: SCOPE OF THE SERVICES 3.1 The services that the Construction Manager shall provide include but are not limited to those described in the following sections. 3.2 Reporting. Written reports shall be provided with the monthly pay requests as follows: a) Monthly Executive Summary which provides an overview of current issues and pending decisions, future developments and expected achievements, and any problems or delays, including code violations found by any permitting agency. b) A Monthly Construction Progress Report that includes a cost narrative, a scheduling narrative and that summarizes the work of the various subcontractors. This report shall include information from the weekly job site meetings as applicable such as: general conditions long lead supplies current deliveries safety and labor relations programs permits construction problems and recommendations; and plans for the succeeding month 3.3 Scheduling a) Upon award of this Contract, the Construction Manager shall submit a master project schedule covering the planning and design approvals, construction, and Owner occupancy of the project. This schedule will serve as the framework for the subsequent development of all detailed schedules. The master project schedule shall be produced and updated monthly throughout the project. b) Within thirty (30) days after the date of the Owner's issuance of a Notice to Proceed, the Construction Manager shall prepare and submit to the Owner two copies of a Critical Path Method (CPM) construction schedule graphically depicting the activities contemplated to occur as a necessary incident to performance of the work required to complete the project, showing the sequence in which the Construction Manager proposes for each such activity to occur and duration (dates of commencement and completion, respectively) of each activity. 3 c) Following development and submittal of the construction schedule, the Construction Manager shall, at the end of each calendar month during the project, or at such earlier intervals as circumstances may require, update and/or revise the construction schedule to show the actual progress of the work performed and the occurrences of all events which have affected the progress of performance of work already performed or will affect the progress of the performance of the work yet to be performed in contrast with the planned progress of performance of such work, as depicted on the original construction schedule and all updates and/or revisions thereto as reflected in the updated and/or revised construction schedule last submitted prior to submittal of each such monthly update and revision. Each such update and/or revision to the construction schedule shall be submitted to the Owner in duplicate. d) The Construction Manager shall provide current scheduling information and provide direction and coordination regarding milestones, beginning and finishing dates, responsibilities for performance and the relationships of the Construction Manager's work to the work of his subcontractors and suppliers to enable them to perform their respective tasks so that the development of construction progresses in a smooth and efficient manner in conformance with the overall project schedule. The schedule shall include all phases of the construction work, material supplies, long lease procurement, approval of shop drawings, change orders in progress, schedules for change orders, and performance testing requirements. The Construction Manager shall advise the Owner, its representatives and the Architect -Engineer of their required participation in any meeting or inspection giving each at least one-week notice unless such notice is made impossible by conditions beyond his control. The Construction Manager shall hold job - site meetings at least once each month with the Construction Team and at least once each week with the subcontractors and the Architect -Engineer's Field Representative, or more frequently as required by work progress, to review progress, discuss problems and their solutions and coordinate future work with all subcontractors. e) Twice per month corresponding as closely as possible with progress review meetings, a "two week" look ahead report shall be prepared and submitted to Owner and Architect Engineer. 3.4 Design Review and Recommendations a) The Construction Manager shall familiarize himself thoroughly with the evolving architectural, civil, mechanical, plumbing, electrical and structural plans and specifications and shall follow the development of design through Contract Documents. The Construction Manager shall make recommendations with respect to the selection of systems and materials, and cost reducing alternatives including assistance to the Architect -Engineer and Owner in evaluating alternative comparisons versus long term cost effect. The evaluation shall speak to the benefits of the speed of erection and early completion of the project. The Construction Manager shall furnish pertinent information as to the availability of materials and labor that will be required. The Construction Manager shall submit to the Owner and Architect -Engineer such comments as may be appropriate concerning construction, feasibility, and practicality. The Construction Manager shall bring to the Owner and the Architect -Engineer's attention any apparent 4 defects in the design, drawing and specifications, or other documents. The Construction Manager shall prepare an estimate of the construction cost at appropriate milestones during the design and shall evaluate such estimate with the project budget. The Construction Manager shall recommend cost saving alternatives, as appropriate, at each design milestone. At each design milestone the Owner, Architect Engineer and Construction Manager shall conduct a value engineering review. b) After receiving the Construction Documents for each phase of the project, the Construction Manager shall perform a specific review thereof. Promptly after completion of the review, the Construction Manager shall submit to the Owner, with a duplicate to the Architect -Engineer, a written report covering suggestions or recommendations previously submitted, additional suggestions or recommendations as the Construction Manager may deem appropriate, and all actions taken by the Architect -Engineer with respect to same, any comments he may deem to be appropriate with respect to separating the work into separate contracts and/or alternative materials. c) At completion of the Construction Manager's review of the plans and specifications, except only as to specific matters as may be identified by appropriate comments pursuant to this section, the Construction Manager shall warrant, without assuming any architectural or engineering responsibility, that the plans and specifications are consistent, practical, feasible and constructible. The Construction Manager shall warrant that the work described in the plans and specifications for the various bidding packages is constructible within the scheduled construction time. d) The Construction Manager shall review the design for the purpose of identifying long lead procurement items (i.e. machinery, equipment, materials, and supplies). When each item is identified, the Construction Manager shall notify the subcontractors, the Owner, and the Architect -Engineer of the required procurement and schedule. Such information shall be included in the bid documents and made a part of all affected sub- contracts. As soon as the Architect -Engineer has completed drawings and technical specifications and the Construction Manager has obtained permitting approval, the Construction Manager shall prepare invitations for bids. The Construction Manager shall keep informed of the progress of the respective subcontractors or suppliers, manufacturing or fabricating such items and advise Project Director, Owner and Architect -Engineer of any problems or prospective delay in delivery. 3.5 Staffing. Key personnel assigned to City projects by the Construction Manager shall not be removed from the project until alternate personnel acceptable to the City are approved in writing by the City. 3.6 Soliciting Bids a) Without assuming responsibilities of the Architect -Engineer, and unless waived in writing by the Owner, the Construction Manager shall prepare invitations for bids, or requests for proposal when applicable, for all procurements of long lead items, materials and services, and for Subcontractor contracts. Such invitations for bids shall be prepared in accordance with the following guidelines: 5 i) Contracts totaling $1,000 but not exceeding $10,000 may be entered into by the Construction Manager with the firm which is qualified and submits the lowest verbal quotation. The Construction Manager shall obtain a minimum of two (2) verbal quotations. These quotations shall be entered on a bid tabulation sheet and a copy of such tabulation sent to the Owner, Architect -Engineer and to each firm. The successful quotation shall be confirmed by written contract or purchase order to the low bid firm defining the scope and quality of work to be provided. ii) Contracts totaling $10,000 but not exceeding $200,000 may be entered into by the Construction Manager with the firm who is qualified and submits the lowest responsive proposal. The Construction Manager shall request at least three (3) firms to submit sealed written proposals based on written drawings and/or specifications. The written proposals shall all be opened publicly at the location, date and time named by the Construction Manager in his request for proposal. A tabulation of the results shall be furnished to the Owner, Architect -Engineer and to each firm. iii) Contracts totaling $200,000 but not exceeding $500,000 may be entered into by the Construction Manager with the firm who is pre -qualified and submits the lowest responsive proposal. The Construction Manager shall advertise these projects at least once with the last advertisement appearing at least 21 calendar days prior to the established bid opening date. These proposals shall be based on approved plans and specifications. Bids shall be received and opened publicly at the location, date and time established in the bid advertisement. iv) Contracts totaling $500,000 or greater shall be treated the same as described under iii above except that the advertisement shall be run for at least 30 days prior to the established bid opening and at least 5 days prior to any scheduled pre-bid conference. v) Individual purchases of materials or rentals or leases of equipment of up to 999.99 each may be made without bids or quotes when reasonably necessary to expedite work on the project; however, the Construction Manager shall not divide or separate a procurement in order to avoid the requirements set forth above. vi) Site utilities may be acquired at market rates from the entity(ies) providing such in the franchise area. b) For each separate construction contract exceeding $35,000, the Construction Manager shall, unless waived by Owner, conduct a pre-bid conference with prospective bidders, the Architect -Engineer, and the Owner. In the event questions are raised which require an interpretation of the bidding documents or otherwise indicate a need for clarification or correction of the invitation, the Construction Manager shall transmit these to the Architect -Engineer and upon receiving clarification or correction in writing shall prepare an addendum to the bidding document, and issue same to all of the prospective bidders. 3.7 Quality Control. The Construction Manager shall develop and maintain a program, 6 acceptable to the Owner and Architect -Engineer that assures quality control of the construction. The Construction Manager shall supervise the work of all subcontractors providing instruction to each when their work does not conform to the requirements of the plans and specifications and shall continue to assert influence and control over each subcontractor to ensure that corrections are made in a timely manner so as to not affect the efficient progress of the work. Should disagreement occur between the Construction Manager, the Owner or the Architect -Engineer over acceptability of work and conformance with the requirements of the specifications and plans, the Owner shall be the final judge of performance and acceptability. 3.8 Subcontractor Interfacing. The Construction Manager shall be the single point of interface with all subcontractors for any work done under this Contract. The Construction Manager shall negotiate all change orders, field orders and request for proposals, with all affected subcontractors and shall review the costs of those proposals and advise the Owner and Architect -Engineer of their validity and reasonableness, acting in the Owner's best interest prior to requesting approval of each change order from the Owner. Before any work is begun on any change order, a written authorization from the Owner must be issued. When health and safety are threatened, however, the Construction Manager shall act immediately to remove such threat to health and safety. The Construction Manager shall also carefully review all shop drawings and then forward the same to the Architect -Engineer for review and actions. The Architect -Engineer will transmit them back to the Construction Manager who will then issue the shop drawings to the affected subcontractor for fabrication or revision. The Construction Manager shall maintain a record to promote expeditious handling. The Construction Manager shall request the Architect -Engineer to make interpretations of the drawings or specifications requested of him by the subcontractors and shall maintain a record to promote timely response. The Construction Manager shall advise the Owner and Architect -Engineer when timely response is not occurring on any of the above. The Construction Manager shall collect, review, and submit to the Owner, all project closeout documentation including operation, maintenance, and training manuals. ARTICLE 4: MAXIMUM PROJECT COST AND FEES FOR SERVICES 4.1 Guaranteed Maximum Price for Construction a) When the Construction Documents are sufficiently complete to establish the scope of work for the project or any portion thereof, the Construction Manager will establish and submit in writing to the Owner for his approval a Guaranteed Maximum Price (GMP) guaranteeing the maximum price to the Owner, for the construction cost of the project or designated part thereof. Such Guaranteed Maximum Price will be subject to modification for changes in the project as provided in article 4.1(e) below. Actual price paid for the work by the Owner, however, shall be the actual cost of all work subcontracts, supply contracts, direct labor costs, direct supervision costs and direct job costs, plus the Construction Manager's fees or the GMP, whichever is less when the work is complete. Invoicing shall occur monthly for completed work with 5% retainage withheld until final completion and acceptance of all work covered in the contract documents in accordance with the City's General Conditions. GMP Proposals will be incorporated by reference 7 and attached hereto as exhibits. b) At the time of submission of a Guaranteed Maximum Price, the Construction Manager will verify the time schedule for activities and work which were adopted and used to determine the Construction Manager's cost of work. In addition to the cost of work, a GMP will include an agreed upon sum as the construction contingency which is included for the purpose of defraying the expenses due to unforeseen circumstances relating to construction. The Construction Manager will be required to furnish documentation evidencing expenditures charged to the contingency prior to the release of funds by the Owner. If bids are received below the applicable line items in the GMP, the surplus will be added to the contingency. c) If bids are received above the applicable line item in the GMP, the deficiency will be taken from the contingency; however, such occurrence shall not be cause to increase the GMP. d) If bids are not received for a portion of the work at or below the applicable line item amount in the GMP, the Construction Manager reserves the right to perform that portion of the work as acknowledged by the Owner or negotiate for its performance for the specified line item lump sum amount or less. e) The increase or decrease in the Guaranteed Maximum Price resulting from a change in the project shall be determined in one or more of the following ways: i. By mutual acceptance of a lump sum properly itemized and supported by sufficient substantiating data to permit evaluation by the Architect -Engineer and Owner; ii. By unit prices stated in the agreement or subsequently agreed upon; iii. If none of the methods is agreed upon, the Construction Manager, provided it has received a signed written order by the Owner, shall promptly proceed with the work involved. The cost of such work shall then be determined on the basis of the reasonable expenditures and savings of those performing the work attributed to the change. In the event a change order is issued under these conditions, however, the Architect -Engineer will establish an estimated cost of the work and the Construction Manager shall not perform any work whose cost exceeds that estimate without prior written approval by the Owner. In such case, the Construction Manager shall keep and present, in such form as the Owner may prescribe, an itemized accounting together with appropriate supporting data of the increase in the cost of the project. The amount of decrease in the Guaranteed Maximum Price to be allowed by the Construction Manager to the Owner for any deletion or change which results in a net decrease in cost will be the amount of the actual net decrease; iv. The Architect -Engineer will have authority to order minor changes in the project not involving an adjustment in the Guaranteed Maximum Price or an extension of the Construction Completion Date and not inconsistent with the intent of the 8 Drawings and Specifications. Such changes shall be affected by written order. Documentation of changes shall be determined by the Architect -Engineer. Changes shall be approved by the Architect -Engineer. 4.2 Construction Manager's Fee. In consideration of the performance of the contract, the Owner agrees to pay the Construction Manager as compensation for his services, fees as set forth below: Preconstruction Phase Fee. This fee shall be based on design costs if applicable, constructability review, value engineering and fee determination of Guaranteed Maximum Price. The fee for this phase in the amount of $86,375 shall be paid at the negotiated price upon receipt of the Guaranteed Maximum Price. Preconstruction Service Proposals will be incorporated by reference and attached hereto as exhibits. Construction Phase Fee. Prior to commencement of the Construction Phase, the Owner will direct the Construction Manager in writing to proceed into the Construction Phase. The Construction Manager's compensation for work or service performed during the Construction Phase shall be a fee of $ TBD. The Construction Phase Fee shall be invoiced and paid in TBD months. Payments will be remitted monthly at the cost of $ TBD each and one final monthly payment of $ TBD. The first monthly payment shall become due thirty days following the issuance of the first Construction Authorization and the final monthly payment shall be paid only when construction of the project is completed and occupancy of the project accepted by the Owner. If construction is authorized only for a part of the project, the fee paid shall be proportionate to the amount of work authorized by the Owner. ARTICLE 5: TERMINATION AND TIME OF THE ESSENCE 5.1 If the Construction Manager is adjudged bankrupt or makes a general assignment for the benefit of creditors, or if a receiver is appointed on account of its insolvency, or if refuses or fails, except in cases for which an extension of time is provided, to supply enough properly skilled workmen or proper materials for the Services, or otherwise be guilty of a substantial violation of any provision of this Contract as determined by the certificate of the Architect, the Owner may, without prejudice and reserving any other right or remedy the Owner may have, after giving the Construction Manager seven (7) days' written notice, terminate this Contract with the Construction Manager and take possession of the premises and all materials, tools, and appliances thereon and finish the project in whatever manner the Owner may deem expedient. The City may also terminate this Contract pursuant to Article 15, Section III of the Contract Specifications. 5.2 It is mutually agreed between the Parties hereby that time is of the essence of this Contract, and in the event that the Substantial Completion Date is not achieved within the time stipulated herein, it is then further agreed that the City may deduct from such sums or compensation as may be due to the Construction Manager, the sum of $1.000.00 Der day for each day that the work to be performed by the Construction Manager remains incomplete beyond the time limit specified herein, which sum of $1.000.00 Der day shall only and solely represent damages which the City has sustained by reason of the failure of 9 the Construction Manager to complete the work within the time stipulated, it being further agreed that the sum is not to be construed as a penalty but is only to be construed as liquidated damages for failure of the Construction Manager to complete and perform all work within the time period as specified in this Contract. ARTICLE 6: INDEMNIFICATION 6.1 To the fullest extent permitted by law, Construction Manager agrees to defend, indemnify, and hold the City, its officers, agents, and employees, harmless from and against any and all liabilities, demands, claims, suits, losses, damages, causes of action, fines or judgments, including costs, attorneys', witnesses', and expert witnesses' fees, and expenses incident thereto, relating to, arising out of, or resulting from: (i) the services provided by the Construction Manager, its contractors, subcontractors, agents, employees, or personnel under this Contract; (ii) any negligent acts, errors, mistakes or omissions by Construction Manager, its contractors, subcontractors, agents, employees, or, personnel; and (iii) Construction Manager, its contractors, subcontractors, agents, employees, or personnel failure to comply with or fulfill the obligations established by this Contract. 6.2 The Construction Manager will update the City during the course of the litigation to timely notify the City of any issues that may involve the independent negligence of the City that is not covered by this indemnification. 6.3 The City assumes no liability for actions of Construction Manager and will not indemnify or hold Construction Manager or any third party harmless for claims based on this Contract or use of Construction Manager provided supplies or services. 6.4 Nothing contained herein shall be construed as a waiver of any immunity from or limitation of liability the City (Owner) may be entitled to under the doctrine of sovereign immunity or section 768.28, Florida Statutes. 6.5 This article shall survive the termination of this Contract. ARTICLE 7: TITLE TO THE PROJECT 7.1 The title of all work, completed portions of the project and in the course of construction, and of all materials on account of which payment has been made shall be in the Owner. ARTICLE 8: ASSIGNMENT 8.1 This Contract shall be binding upon and inure to the benefit of the Parties hereto and their respective successors and assigns, except that this Contract may not be assigned by either party without the prior written consent of the other party. Any assignment made without such prior written consent shall not vest rights in the assignee. ARTICLE 9: ADDITIONAL PROVISIONS 10 9.1 This Contract shall be governed by and construed in accordance with the laws of the State of Florida, and the venue for any dispute under this Contract shall be an appropriate court of competent jurisdiction in Pinellas County, Florida. 9.2 Any notice required to be given by the terms and provisions of this Contract or by any law or governmental regulation, either by the Owner or Construction Manager, shall be in writing unless otherwise required by such law or regulation and shall be deemed to have been served and given when deposited in either Registered or Certified Mail in United States Branch Post Office, addressed to the party hereto to whom directed, at the address specified in the Specifications. 9.3 The language in this Contract shall be construed according to its customary meaning within the Florida building industry. Whenever used, the singular shall include the plural, the plural the singular, and the use of any gender shall be applicable to all genders. 9.4 If any provision of the Contract Documents is invalid or unenforceable as against any person or party, the remainder of the Contract Documents and the applicability of such provision to other persons or parties shall not be affected thereby. 9.5 The Parties are acting herein solely as independent contractors. Nothing herein contained will create or be construed as creating a partnership, joint venture, or agency relationship between the Parties. Each Party acknowledges and agrees that it neither has nor will give the appearance or impression of having any legal authority to bind or commit the other Party in any way. Each Party will be solely responsible for all wages, income taxes, worker's compensation, and any other requirements for all personnel it supplies in connection with this Contract. 9.6 The City's performance and obligation to pay under this Contract is contingent upon an annual appropriation by the Clearwater City Council. 11 IN WITNESS WHEREOF, the parties hereto have made and executed this Contract on the date and year first above written. Corporate Seal) Countersigned: Bri.r - Aungs Mayor Approved as to form: Jerrod Simp Senior As tant City Attorney FIRM NAME By:1---- Print Name: Title: WITNESS: aSChlk C3oMSTis) CfOT By: Print Name: 4Lv ' , ,i ,'d x/ CITY OF CLEARWATER Jen ife oifrier City Manager ems ate. 01-4 Rosemarie CaII City Clerk 12 Wannemacher Jensen Architects, Inc. City of Clearwater Consultant Work Order Page 1 of 5 Revised: 11/28/2022 SUPPLEMENTAL WORK ORDER 2 Date: 10/31/2024 1. PROJECT INFORMATION: Project Title: Design Services – Clearwater Long Center Renovations – Construction Administration City Project Number: 21-0026-PR City Plan Set Number: 2022008 Consultant Project Number: 2317 2. SCOPE OF SERVICES: WJ architects and its consultants will perform construction phase services for the renovation of the Long Center Natatorium, and civil design services for the sundeck addition proposed on the west side of the natatorium. Construction phase services to include the following: I. CONSTRUCTION ADMINISTRATION PHASE: Task 1.1: Construction Administration The Architect’s Scope of Services will provide construction oversight to ensure the project is built according to the Construction Documents. We will assist the Contractor when conflicts or clarifications are needed. The Architect and Engineers will make periodic site visits to observe construction and follow the progress. We will: 1. Review of Contractor's pay application. 2. Attend meetings at the project site Once per month for up to 18 months 3. Provide review of and respond to the contractor’s submittals and shop drawings. 4. Provide telephone and email correspondence as necessary. 5. Respond to the contractor's questions and need for clarifications during construction periods. 6. Attend the Substantial Completion walk-through. 7. Review the punch list provided by the contractor for completion. 8. Attend the Final Completion Walk-Through. The scope and fee assume Construction Administration will be provided for a 12-month period. If the construction exceeds 12 months, an additional fee for construction administration will be required. CONSULTANT WORK ORDER Design Services – Clearwater Long Center Renovations Wannemacher Jensen Architects 21-0026-PR City of Clearwater Consultant Work Order Page 2 of 5 Revised: 11/28/2022 II. Civil Engineering: Task 2.1: Civil Design Construction Documents This phase includes completion of the following task: 1. Preliminary design documents identifying intent of relocating utilities. 2. Construction Documents for the relocation of water main and 30” storm pipe at west side of the natatorium to accommodate for a sundeck addition. 3. Specifications associated with design components and features in construction documents 4. Bidding/Permitting 5. Construction/ Post construction services. III. Geotechnical Investigation: Task 3.1: Geotechnical Investigation This phase includes completion of the following task: 1. Notify Sunshine 811 to locate and mark existing utilities. 2. Mobilize Personnel and equipment necessary. 3. Perform one hand auger boring in conjunction with static cone penetrometer soundings within the proposed addition footprint to a depth of 6 feet, or cave-in due to encountering the groundwater table, whichever occurs first, to evaluate the density of the shallow soils and estimate the seasonal high groundwater table. 4. Conduct visual classification of the recovered soil samples. 5. Based on the data collected in the above stages, we will provide a report of findings, recommendations and considerations for the proposed construction. 3. PROJECT GOALS: The goals for this project are as follows: 1. To assist the contractor in the pricing of the design. 2. To provide clarification for the construction manager and it’s team on design intent as it pertains to the design provided. 3. To support the City of Clearwater in its payment procedures by confirming pay applications submitted by the construction manager. 4. To Respond the RFIs and review submittals for construction components and systems. 5. To relocate utility and storm lines that allow for construction of the sundeck addition. CONSULTANT WORK ORDER Design Services – Clearwater Long Center Renovations Wannemacher Jensen Architects 21-0026-PR City of Clearwater Consultant Work Order Page 3 of 5 Revised: 11/28/2022 4. FEES: See Attachment “A” This price includes all labor and expenses anticipated to be incurred by Wannemacher Jensen Architects for the completion of these task in accordance with the Professional Services Method “B” – Lump Sum – Percentage of Completion by Task, for a fee not to exceed two hundred ninety eight thousand three hundred eighty dollars. ($298,380.00) 5. SCHEDULE: The project is to be completed in 12 months (365 days) from issuance of notice-to- proceed. The project deliverables are to be phased as follows: Construction Phase Services: [260] calendar days Civil Design (90% Documents) [45] calendar days Owner Review [10] calendar days Civil Design (100% Document) [15] calendar days 6. STAFF ASSIGNMENT: Wannemacher Jensen Architects Arturo Lopez, AIA, – Studio Director Chris Dunn, RA – Project Manager Giselle Vera, – Project Coordinator 7. CORRESPONDENCE/REPORTING PROCEDURES: Consultant’s project correspondence shall be directed to: Wannemacher Jensen Architects Chris Dunn, RA – Project manager Arturo Lopez, AIA - Project Architect All City project correspondence shall be directed to: Dept. of Public Works Jeff Walker, P.E., CBO, LEED AP, PMP – Sr. Professional Engineer Mike Lockwood, Assistant Director, Parks and Recreation Dept. Art Kader, Interim Director, Parks and Recreation Dept. 8. INVOICING/FUNDING PROCEDURES: City Invoicing Code: 3157572-562100-C2202 CONSULTANT WORK ORDER Design Services – Clearwater Long Center Renovations Wannemacher Jensen Architects 21-0026-PR City of Clearwater Consultant Work Order Page 4 of 5 Revised: 11/28/2022 For work performed, invoices shall be submitted monthly to: ATTENTION: JAMIE GAUBATZ, ACCOUNTANT II CITY OF CLEARWATER, PUBLIC WORKS DEPARTMENT/ENGINEERING PO BOX 4748 CLEARWATER, FLORIDA 33758-4748 Contingency services will be billed as incurred only after written authorization provided by the City to proceed with those services. 9. INVOICING PROCEDURES: At a minimum, in addition to the invoice amount(s) the following information shall be provided on all invoices submitted on the Work Order: 1. Purchase Order, Project and Invoice Numbers and Contract Amount. 2. The time period (begin and end date) covered by the invoice. 3. A short narrative summary of activities completed in the time period. 4. Contract billing method – Lump Sum or Hourly Rate. 5. If Lump Sum, the percent completion, amount due, previous amount earned and total earned to date for all tasks (direct costs, if any, shall be included in lump sum amount). 6. If Hourly Rate, hours, hourly rates, names of individuals being billed, amount due, previous amount earned, the percent completion, total earned to date for each task and other direct costs (receipts will be required for any single item with a cost of $50 or greater or cumulative monthly expenses greater than $100). 7. If the Work Order is funded by multiple funding codes, an itemization of tasks and invoice amounts by funding code. 10. CONSIDERATIONS: Consultant acknowledges the following: 1. The Consultant named above is required to comply with Section 119.0701, Florida Statutes, where applicable. 2. All City directives shall be provided by the City Project Manager. 3. “Alternate equals” shall not be approved until City Project Manager agrees. 4. All submittals must be accompanied by evidence each has been internally checked for QA/QC before providing to City. 5. Consultants/Contractors are not permitted to use City-owned equipment (i.e. sampling equipment, etc.). 6. Documents posted on City website must ADA accessible. 11. ADDITIONAL CONSIDERATIONS: All work orders should include considerations for the following: CONSULTANT WORK ORDER Design Services – Clearwater Long Center Renovations Wannemacher Jensen Architects 21-0026-PR City of Clearwater Consultant Work Order Page 5 of 5 Revised: 11/28/2022 1. Sea Level Rise and Flood Resilience, as applicable. 2. Submittal of a Critical Path Method (CPM) Schedule(s). 3. Submittal of a Project Catalog with the following items, as appropriate: a. Data requests, assumptions, critical correspondence, meeting agenda, sign-in sheets, meeting minutes, document comment-response log(s), technical memorandum/reports, addenda, progress reports, regulatory correspondence, and other project-related documents. b. At the conclusion of the project, ENGINEER will combine this information into a Project Catalog and submit to the City for review and comment. 12. SPECIAL CONSIDERATIONS: The City will need to provide access to Architect and its consultants as needed. Specifically, the natatorium will need to be accessible and clear of all people for the NDE testing and equipment. 13. SIGNATURES: PREPARED BY: APPROVED BY: Jason Jensen Tara Kivett, P.E. President City Engineer Wannemacher Jensen Architects City of Clearwater Date Date ATTACHMENT “A” CONSULTANT WORK ORDER – PROJECT FEES TABLE Design Services – Clearwater Long Center Renovations Wannemacher Jensen Architects 21-0026-PR City of Clearwater Consultant Work Order – Project Fees Table Page 1 of 1 Revised: 11/28/2022 CONSULTANT WORK ORDER PROJECT FEES TABLE Task Description Subconsultant Services Labor Total 1.0 Construction Administration Phase 1.1 Construction Administration $94,032 $165,708 $259,740 Construction Administration Total: $259,740 2.0 Civil Engineering 2.1 Civil Design Construction Documents $32,900 $4,935 $37,835 Civil Design Construction Documents Total: $37,835 3.0 Geotechnical Engineering 3.1 Subsurface Soil Exploration $700 $105 $805 Geotechnical Total: $805 SUBTOTAL, LABOR AND SUB-CONTRACTORS: $298,380 4.0 Other Direct Costs (prints, photocopies, postage, etc.) (Not applicable to lump sum Work Orders) N/A GRAND TOTAL: $298,380 ATTACHMENT “B” (Include if applicable) CONSULTANT WORK ORDER – CITY DELIVERABLES Design Services – Clearwater Long Center Renovations Wannemacher Jensen Architects 21-0026-PR City of Clearwater Consultant Work Order – City Deliverables Page 1 of 1 Revised: 11/28/2022 CONSULTANT WORK ORDER CITY DELIVERABLES 1. FORMAT: The design plans shall be compiled utilizing the following methods: 1. City of Clearwater CAD standards. 2. Datum: Horizontal and Vertical datum shall be referenced to North American Vertical Datum of 1988 (vertical) and North American Datum of 1983/90 (horizontal). The unit of measurement shall be the United States Foot. Any deviation from this datum will not be accepted unless reviewed by City of Clearwater Engineering/Geographic Technology Division. 2. DELIVERABLES: The design plans shall be produced on bond material, 24" x 36" at a scale of 1" = 20’ unless approved otherwise. Upon completion the consultant shall deliver all drawing files in digital format with all project data in Autodesk Civil 3D file format. NOTE: If approved deviation from Clearwater CAD standards is used, the Consultant shall include all necessary information to aid in manipulating the drawings including either PCP, CTB file or pen schedule for plotting. The drawing file shall include only authorized fonts, shapes, line types or other attributes contained in the standard release of Autodesk software. All block references and other references contained within the drawing file shall be included. Please address any questions regarding format to Mr. Thomas Mahony, at (727) 562-4762 or email address Thomas.Mahony@myClearwater.com. All electronic files (including CAD and Specification files) must be delivered upon completion of project or with 100% plan submittal to City of Clearwater. Procurement Division 100 S Myrtle Ave Clearwater FL 33756-5520 PO Box 4748, 33578-4748 727-562-4630 Tel REQUEST FOR QUALIFICATIONS #07-24 Construction Manager at Risk – Long Center Renovations November 29, 2023 NOTICE IS HEREBY GIVEN that sealed Statements of Qualifications will be received by the City of Clearwater (City) until 10:00 AM, Local Time, January 4, 2024 to provide Construction Management Services for Long Center Renovations. Brief Description: The City of Clearwater is seeking a Construction Manager at Risk firm to join the project team for the renovation of the Clearwater Long Center located at 1501 N. Belcher Road, Clearwater, Florida. Responses must be in accordance with the provisions, specifications and instructions set forth herein and will be received by the Procurement Division until the above noted time, when they will be publicly acknowledged and accepted. This Request for Qualifications, any attachments and addenda are available for download at https://www.myclearwater.com/business/rfp Please read the entire solicitation package and submit the response in accordance with the instructions. This document (less this invitation and the instructions) and any required documents, attachments, and submissions will constitute the response. General, Process, or Technical Questions concerning this solicitation should be directed, IN WRITING, to the Procurement Manager. This Request for Qualifications is issued by: Lori Vogel, CPPB Procurement Manager lori.vogel@myclearwater.com INSTRUCTIONS CMAR – Long Center Renovations 2 RFQ #07-24 i.1 VENDOR QUESTIONS: All questions regarding the contents of this solicitation, and solicitation process (including requests for ADA accommodations), shall be directed solely to the Contact listed on Page One (1). Questions should be submitted in writing via letter, fax or email. Questions received less than ten (10) calendar days prior to the due date and time may be answered at the discretion of the City. i.2 ADDENDA/CLARIFICATIONS: Any changes to the specifications will be in the form of an addendum. Addenda are posted on the City website no less than seven (7) days prior to the Due Date. Vendors are cautioned to check the Purchasing Website for addenda and clarifications prior to submitting their response. The City cannot be held responsible if a vendor fails to receive any addenda issued. The City shall not be responsible for any oral changes to these specifications made by any employees or officer of the City. Failure to acknowledge receipt of an addendum may result in disqualification of a response. i.3 DUE DATE & TIME FOR SUBMISSION AND OPENING: Date: January 4, 2024 Time: 10:00 AM (Local Time) The City will open all responses properly and timely submitted and will record the names and other information specified by law and rule. All responses become the property of the City and will not be returned except in the case of a late submission. Respondent names, as read at the opening, will be posted on the City website. Once a notice of intent to award is posted or 30 days from day of opening elapses, whichever occurs earlier, responses are available for inspection by contacting the Procurement Division. i.4 SUBMIT RESPONSES TO: It is recommended that responses are submitted electronically through our bids website at https://www.myclearwater.com/business/rfp Respondents may mail or hand-deliver responses to the address below. E-mail or fax submissions will not be accepted. Use label at the end of this solicitation package City of Clearwater Attn: Procurement Division 100 S Myrtle Ave, 3rd Fl, Clearwater FL 33756-5520 or PO Box 4748, Clearwater FL 33758-4748 Responses will be received at this address. Respondents may mail or hand-deliver proposals; e- mail or fax submissions will not be accepted. No responsibility will attach to the City of Clearwater, its employees or agents for premature opening of a response that is not properly addressed and identified. i.5 LATE RESPONSES. The respondent assumes responsibility for having the response delivered on time at the place specified. All responses received after the date and time specified shall not be considered and will be returned unopened to the respondent. The respondent assumes the risk of any delay in the mail or in handling of the mail by employees of the City of Clearwater, or any private courier, regardless whether sent by mail or by means of personal delivery. It shall not be sufficient to show that you mailed or commenced delivery before the due date and time. All times are Clearwater, Florida local times. The respondent agrees to accept the time stamp in the City’s Procurement Division as the official time. i.6 LOBBYING; LOBBYING NO-CONTACT PERIOD; QUESTIONS REGARDING SOLICITATION. From the time a competitive solicitation is posted until such time as the contract is awarded by the city or the solicitation is cancelled, all bidders, offerors, respondents, including their employees, representatives, and other individuals acting on their behalf, shall be prohibited from lobbying city officers, city employees, and evaluation committee members. INSTRUCTIONS CMAR – Long Center Renovations 3 RFQ #07-24 Violation of this section may result in rejection/disqualification from award of the contract arising out of the competitive solicitation. All questions regarding the competitive solicitation must be directed to the procurement manager or designee, who will respond in writing and post such response to ensure that all respondents receive the same information during the No-Contact Period. The penalty for violating the No-Contact Period may include suspension or debarment i.7 RESPONSIBILITY TO READ AND UNDERSTAND. Failure to read, examine and understand the solicitation will not excuse any failure to comply with the requirements of the solicitation or any resulting contract, nor shall such failure be a basis for claiming additional compensation. If a vendor suspects an error, omission or discrepancy in this solicitation, the vendor must immediately and in any case not later than seven (7) business days in advance of the due date notify the contact on page One (1). The City is not responsible for and will not pay any costs associated with the preparation and submission of the response. Respondents are cautioned to verify their responses before submission, as amendments to or withdrawal of responses submitted after time specified for opening of responses may not be considered. The City will not be responsible for any respondent errors or omissions. i.8 FORM AND CONTENT OF RESPONSES. Unless otherwise instructed or allowed, responses shall be submitted on the forms provided. An original and the designated number of copies of each response are required. Responses, including modifications, must be submitted in ink, typed, or printed form and signed by an authorized representative. Please line through and initial rather than erase changes. If the response is not properly signed or if any changes are not initialed, it may be considered non-responsive. The City may require that an electronic copy of the response be submitted. The response must provide all information requested and must address all points. The City does not encourage exceptions. The City is not required to grant exceptions and depending on the exception, the City may reject the response. i.9 DEBARMENT DISCLOSURE. If the respondent has been debarred, suspended, or otherwise lawfully precluded from participating in any public procurement activity, including being disapproved as a (sub)contractor with any federal, state, or local government, or if any such preclusion from participation from any public procurement activity is currently pending, the respondent shall include a letter with its response identifying the name and address of the governmental unit, the effective date of this suspension or debarment, the duration of the suspension or debarment, and the relevant circumstances relating to the suspension or debarment. If suspension or debarment is currently pending, a detailed description of all relevant circumstances including the details enumerated above must be provided. A response from a respondent who is currently debarred, suspended or otherwise lawfully prohibited from any public procurement activity may be rejected. i.10 RESERVATIONS. The City reserves the right to reject any or all responses or any part thereof; to reissue the solicitation; to reject non-responsive or non-responsible responses; to reject unbalanced responses; to reject responses where the terms and/or awards are conditioned upon another event; to reject individual responses for failure to meet any requirement; to award by part or portion, or total; to make multiple awards; to waive minor irregularities, defects, omissions, technicalities or form errors in any response. The City may seek clarification of the response from respondent at any time, and failure to respond is cause for rejection. Submission of a response confers on respondent no right to an award or to a subsequent contract. The City is responsible to make an award that is in the best interest of the City. All decisions on compliance, evaluation, terms and conditions shall be made solely at the City’s discretion and made to favor the City. No binding contract will exist between the respondent and the City until the City executes a written contract or purchase order. i.11 OFFICIAL SOLICITATION DOCUMENT. Changes to the solicitation document made by a respondent may not be acknowledged or accepted by the City. Award or execution of a contract does not constitute acceptance of a changed term, condition or specification unless specifically acknowledged and agreed to by the City. The copy maintained and published by the City shall be INSTRUCTIONS CMAR – Long Center Renovations 4 RFQ #07-24 the official solicitation document. i.12 ETHICS. It is the intention of the City to promote courtesy, fairness, impartiality, integrity, service, professionalism, economy, and government by law in the Procurement process. The responsibility for implementing this policy rests with each individual who participates in the procurement process, including respondents and contractors. To achieve the purpose of this Article, it is essential that respondents and contractors doing business with the City also observe the ethical standards prescribed herein. It shall be a breach of ethical standards to: a. Exert any effort to influence any City employee or agent to breach the standards of ethical conduct. b. Intentionally invoice any amount greater than provided in Contract or to invoice for Materials or Services not provided. c. Intentionally offer or provide sub-standard Materials or Services or to intentionally not comply with any term, condition, specification or other requirement of a City Contract. i.13 GIFTS. The City will accept no gifts, gratuities or advertising products from respondents or prospective respondents and affiliates. i.14 RIGHT TO PROTEST. Pursuant to Section 2.562(3), Clearwater Code of Ordinances, a bidder who submitted a response to a competitive solicitation and was not selected may appeal the decision through the bid protest procedures, a copy of which shall be available in the Procurement Division. A protesting bidder must include a fee of one percent of the amount of the bid or proposed contract to offset the City’s additional expenses related to the protest. This fee shall not exceed $5,000.00 nor be less than $50.00. Full refund will be provided should the protest be upheld. No partial refunds will be made. ADDRESS PROTESTS TO: City of Clearwater - Procurement Division 100 So Myrtle Ave, 3rd Fl Clearwater FL 33756-5520 or PO Box 4748 Clearwater FL 33758-4748 INSTRUCTIONS – EVALUATION CMAR – Long Center Renovations 5 RFQ #07-24 i.15 EVALUATION PROCESS. Responses will be reviewed by a screening committee comprised of City employees and/or authorized agents. The City staff may or may not initiate discussions with respondents for clarification purposes. Clarification is not an opportunity to change the response. Respondents shall not initiate discussions with any City employee or official. Respondent is hereby notified that Section 287.05701, Florida Statutes, requires that the City may not request documentation of or consider a vendor's social, political, or ideological interests when determining if the vendor is a responsible vendor. i.16 CRITERIA FOR EVALUATION AND AWARD. The City evaluates three (3) categories of information: responsiveness, responsibility, and the technical response. All responses must meet the following responsiveness and responsibility criteria. a) Responsiveness. The City will determine whether the response complies with the instructions for submitting responses including completeness of response which encompasses the inclusion of all required attachments and submissions. The City must reject any responses that are submitted late. Failure to meet other requirements may result in rejection. b) Responsibility. The City will determine whether the respondent is one with whom it can or should do business. Factors that the City may evaluate to determine "responsibility" include, but are not limited to: past performance, references (including those found outside the response), compliance with applicable laws, respondent's record of performance and integrity- e.g. has the respondent been delinquent or unfaithful to any contract with the City, whether the respondent is qualified legally to contract with the City, financial stability and the perceived ability to perform completely as specified. A respondent must at all times have financial resources sufficient, in the opinion of the City, to ensure performance of the contract and must provide proof upon request. City staff may also use Dun & Bradstreet and/or any generally available industry information. The City reserves the right to inspect and review respondent’s facilities, equipment and personnel and those of any identified subcontractors. The City will determine whether any failure to supply information, or the quality of the information, will result in rejection. c) Technical Response. The City will determine how well responses meet its requirements in terms of the response to the solicitation and how well the offer addresses the needs of the project. The City will rank offers using a point ranking system (unless otherwise specified) as an aid in conducting the evaluation. The criteria that will be evaluated and their relative weights are: Evaluation Criteria (pgs. 11-12) Points Qualifications, Experience, and References (Tab 2) 35 Project Approach (Tab 3) 30 Project Staff and Availability (Tab 4) 30 Safety Record (Tab 5) 5 i.17 SHORT-LISTING. The City at its sole discretion may create a short-list of the highest ranked proposals based on a preliminary evaluation against the evaluation criteria. Only those short-listed proposers would be invited to give presentations and/or interviews. The City will finalize ranking of the firms upon conclusion of presentations/interviews. i.18 PRESENTATIONS/INTERVIEWS. If requested, the respondent must provide a formal presentation and/or interview. The location for these presentations and/or interviews will be determined by the City and may be held virtually. i.19 CONTRACT NEGOTIATIONS AND ACCEPTANCE. Respondent must be prepared for the City to accept the response as submitted. If respondent fails to sign all documents necessary to INSTRUCTIONS – EVALUATION CMAR – Long Center Renovations 6 RFQ #07-24 successfully execute the final contract within a reasonable time as specified, or negotiations do not result in an acceptable agreement, the City may reject response or revoke the award, and may begin negotiations with another Respondent. Final contract terms must be approved or signed by the appropriately authorized City official(s). No binding contract will exist between the respondent and the City until the City executes a written contract or purchase order. i.20 NOTICE OF INTENT TO AWARD. Notices of the City’s intent to award a Contract are posted to Purchasing’s website. It is the respondent’s responsibility to check the City of Clearwater’s Purchasing website at https://www.myclearwater.com/business/rfp to view the Procurement Division’s Intent to Award postings. i.21 RFQ TIMELINE. All dates are tentative and subject to change. Release RFQ: 11/29/2023 Advertise Tampa Bay Times: 12/06/2023 Responses due: 01/04/2024 Review responses/presentations: 01/04/2024-01/26/2024 Award recommendation: 01/26/2024 Council authorization: February 2024 Contract begins: February 2024 DETAILED SPECIFICATIONS CMAR – Long Center Renovations 7 RFQ #07-24 1. PROJECT MISSION. The City of Clearwater (City) is dedicated to providing superior services to its customers in order to improve the quality of life for Clearwater residents, businesses, and visitors. The City is looking for consultants, contractors and vendors who share that dedication and will help the City meet that goal. 2. INTRODUCTION. The City of Clearwater is seeking a Construction Manager at Risk (CMAR) firm to renovate the Clearwater Long Center natatorium, located at 1501 N. Belcher Road, Clearwater, Florida. The CMAR will provide management of the preconstruction and construction phase services (collectively referred to as the Services) as described herein. 3. BACKGROUND. The Long Center was issued a certificate of occupancy in 1990. The natatorium’s heating ventilation and air conditioning (HVAC) system is unable to adequately handle the latent and sensible heat load caused by the indoor pool environment and the natatorium’s hollow structural steel (HSS) and non-insulated glass wall building envelope. In 2009, the pool’s HVAC system was revised to include a new central Dectron dehumidifier with the hope of better controlling the natatorium’s humidity levels. In 2018, the City commissioned an independent study of the operation and condition of the natatorium. The report identified several issues that the City wants addressed by a renovated natatorium. To this day, the natatorium continues to have high humidity which has resulted in areas of isolated corrosion of the natatorium’s HSS frame. In addition to the humidity problem, the natatorium is a pre-Florida Building Code design and thus does not meet current energy conservation goals or the fenestration large missile impact resistance requirement. 4. SCOPE OF SERVICES. The primary goal of the renovation is to resolve the natatorium’s high humidity and resulting frame corrosion. In conjunction with meeting these goals, it is expected that a new or renovated natatorium will produce a more energy efficient, sustainable (reference Clearwater Greenprint 2.0), and storm-resistant building. Scope of Services will include major renovation/replacement of natatorium building envelope including a reroof, roof top solar PV array, new natatorium HVAC system including ductwork, pool mechanical room equipment replacement and new lap pool perimeter gutter drains and deck coating. The CMAR is expected to join the project team shortly after the 30% design phase to provide preconstruction phase services to the City via a negotiated agreement. The renovation shall be constructed in single or multiple phases, depending on pool operational requirements. Construction is targeted to begin in the Spring of 2025 with an expected construction duration of approximately one (1) year. When the project value engineering is sufficiently complete to establish the scope of work for the project or any portion thereof, the CMAR will establish and submit in writing to the City for approval a Guaranteed Maximum Price (GMP) for the project. Once the GMP for construction of the project is agreed upon, the City staff may recommend to City Council to award the CMAR firm the Construction Manager at Risk contract. A CMAR Services Contract SAMPLE (Exhibit B) has been included with this solicitation. If a GMP cannot be agreed upon, the City may negotiate with the next highest ranked CMAR firm. The following documents are included with this RFQ: Exhibit A_Long Center Natatorium Renovation Map Exhibit B_SAMPLE CMAR Contract. Standard Construction Manager at Risk Services contract to be entered into upon successful negotiation. Applicable terms for City construction contracts referenced in Exhibit B are available at https://www.myclearwater.com/government/city- departments/engineering/documents-publications/contract-specifications Exhibit C_Forms. Truth in Negotiation, E-Verify and Scrutinized Companies forms required per Florida Statute. DETAILED SPECIFICATIONS CMAR – Long Center Renovations 8 RFQ #07-24 Exhibit D_Standard Terms and Conditions. Standard Terms and Conditions applicable to the Purchase Order for pre-construction and construction phase services. 5. INSURANCE REQUIREMENTS. The Contractor (respondent) shall, at its own cost and expense, acquire and maintain (and cause any subcontractors, representatives or agents to acquire and maintain) during the term with the City, sufficient insurance to adequately protect the respective interest of the parties. Coverage shall be obtained with a carrier having an AM Best Rating of A- VII or better. In addition, the City has the right to review the Contractor’s deductible or self-insured retention and to require that it be reduced or eliminated. Specifically the Contractor must carry the following minimum types and amounts of insurance on an occurrence basis or in the case of coverage that cannot be obtained on an occurrence basis, then coverage can be obtained on a claims-made basis with a minimum three (3) year tail following the termination or expiration of this Agreement. Specific work may require additional coverage on a case by case basis: a. Commercial General Liability Insurance coverage, including but not limited to, premises operations, products/completed operations, products liability, contractual liability, advertising injury, personal injury, death, and property damage in the minimum amount of $1,000,000 (one million dollars) per occurrence and $2,000,000 (two million dollars) general aggregate. b. Commercial Automobile Liability Insurance coverage for any owned, non-owned, hired or borrowed automobile is required in the minimum amount of $1,000,000 (one million dollars) combined single limit. c. Unless waived by the State of Florida and proof of waiver is provided to the City, statutory Workers’ Compensation Insurance coverage in accordance with the laws of the State of Florida, and Employer’s Liability Insurance in the minimum amount of $1,000,000 (one million dollars) each employee each accident, $1,000,000 (one million dollars) each employee by disease, and $1,000,000 (one million dollars) disease policy limit. Coverage should include Voluntary Compensation, Jones Act, and U.S. Longshoremen’s and Harbor Worker’s Act coverage where applicable. Coverage must be applicable to employees, contractors, subcontractors, and volunteers, if any. d. If the Contractor is using its own property, or the property of the City or other provider, in connection with the performance of its obligations under this Agreement, then Contractor’s Equipment Insurance or Property Insurance on an “All Risks” basis with replacement cost coverage for property and equipment in the care, custody and control of others is required. e. Professional Liability Insurance coverage appropriate for the type of business engaged in by the Contractor with minimum limits of $1,000,000 (one million dollars) per occurrence. If a claims made form of coverage is provided, the retroactive date of coverage shall be no later than the inception date of claims made coverage, unless prior policy was extended indefinitely to cover prior acts. Coverage shall be extended beyond the policy year either by a supplemental extended reporting period (ERP) of as great a duration as available, and with no less coverage and with reinstated aggregate limits, or by requiring that any new policy provide a retroactive date no later than the inception date of claims made coverage. f. Contractor shall maintain Pollution Liability Insurance to respond to bodily injury, property damage, and environmental damaged caused by a pollution incident. The minimum limits of liability shall be $1,000,000 (one million dollars) per Occurrence/$2,000,000 (two million dollars) Aggregate for the Project. The above insurance limits may be achieved by a combination of primary and umbrella/excess liability policies. DETAILED SPECIFICATIONS CMAR – Long Center Renovations 9 RFQ #07-24 OTHER INSURANCE PROVISIONS. a. Prior to the execution of this Agreement, and then annually upon the anniversary date(s) of the insurance policy’s renewal date(s) for as long as this Agreement remains in effect, the Contractor will furnish the City with a Certificate of Insurance(s) (using appropriate ACORD certificate, SIGNED by the Issuer, and with applicable endorsements) evidencing all of the coverage set forth above and naming the City as an “Additional Insured.” In addition, when requested in writing from the City, Contractor will provide the City with certified copies of all applicable policies. The address where such certificates and certified policies shall be sent or delivered is as follows: City of Clearwater Attn: Procurement Division, RFQ #07-24 P.O. Box 4748 Clearwater, FL 33758-4748 b. Contractor shall provide thirty (30) days written notice of any cancellation, non-renewal, termination, material change or reduction in coverage. c. Contractor’s insurance as outlined above shall be primary and non-contributory coverage for Contractor’s negligence. d. Contractor reserves the right to appoint legal counsel to provide for the Contractor’s defense, for any and all claims that may arise related to Agreement, work performed under this Agreement, or to Contractor’s design, equipment, or service. Contractor agrees that the City shall not be liable to reimburse Contractor for any legal fees or costs as a result of Contractor providing its defense as contemplated herein. The stipulated limits of coverage above shall not be construed as a limitation of any potential liability to the City, and failure to request evidence of this insurance shall not be construed as a waiver of Contractor’s obligation to provide the insurance coverage specified. MILESTONES CMAR – Long Center Renovations 10 RFQ #07-24 1. ANTICIPATED BEGINNING AND END DATE OF INITIAL TERM. February 2024 – December 2025. If the commencement of performance is delayed because the City does not execute the contract on the start date, the City may adjust the start date, end date and milestones to reflect the delayed execution. 2. EXTENSION. The City reserves the right to extend the term of this contract, provided however, that the City shall give written notice of its intentions to extend this contract no later than thirty (30) days prior to the expiration date of the contract. RESPONSE FORMAT CMAR – Long Center Renovations 11 RFQ #07-24 1. RESPONSE SUBMISSION. It is recommended that responses are submitted electronically through our bids website at https://www.myclearwater.com/business/rfp. For responses mailed and/or hand-delivered, firm must submit one (1) signed original (identified as ORIGINAL) response, five (5) copies of the response and one (1) copy in an electronic format, on a disc or thumb drive, in a sealed container using the label provided at the end of this solicitation. If submitting electronically, hard copies are not required. 2. RESPONSE FORMAT - Qualifications shall be submitted in bound volumes on standard 8½" x 11" paper. A single 8½" x 11" sheet printed on both sides is two (2) pages. All information must be assembled and indexed in the order indicated below. The page count shall not exceed twenty-two (22) total pages, including typed text, graphics, charts and photographs. The total page count does not include documents submitted for Tabs 6 and 7, the tabbed separator pages, cover page, and back page. TAB 1 – LETTER OF INTEREST (two [2] pages). The cover letter must include the full legal name of the firm, the following information, and must be signed by an authorized representative of the company, preferably the president. Offeror must attach proof to the letter of signing authority for any representative who signs the cover letter other than the president. a. A brief summary of the proposing firm’s interest in providing the requested services. b. A statement of the Offeror’s understanding of the Construction Manager at Risk (CMAR) services with Guaranteed Maximum Price (GMP) to be provided. c. The address of the office conducting the CMAR services d. The address of the office that would administer the agreement. e. List Corporate officers, partners, or owners of your organization with titles and addresses. If the Offeror is a publicly held company list chairman of the board, chief executive officer (CEO), and president. f. The names(s) of the person(s) that will be authorized to make representations for the Offeror, including their titles, addresses, telephone numbers, and e-mail addresses. TAB 2 – QUALIFICATIONS, EXPERIENCE, AND REFERENCES (eight [8] pages). Explain related CMAR services experience for building renovation, include examples of similar completed projects. Provide list of construction projects with construction value of $10 million or more, both active and completed in the last five (5) years. Include the project name, location, owner, Architect/Engineer, description, dates services were performed for the project including original and final completion dates; color images of projects; initial and final construction cost (explain deviations from GMP), including change orders; initial and final contract duration (explain deviations); type of contract and the stage of design or construction that the construction contract amount (GMP) was agreed upon. Provide a minimum of three (3) references from similar projects using a CMAR with the GMP process with a value of $10 million or more within the past five (5) years. Reference projects must include: a. Offeror’s project management team assigned to respective project who will be designated for this RFQ’s project team. b. Client project manager name, title, email address, and telephone numbers. c. Reference letters from the project owner(s) must be specific to the referenced project (not included in page count). TAB 3 – PROJECT APPROACH (six [6] pages). Demonstrate the ability to provide the Concept Review and Cost Analysis, Pre-construction and Construction Phase services. Expand on items such as reporting systems, scheduling, construction phasing, cost estimating and value engineering (VE). Include examples of similar multi-phase projects where these processes have been used. RESPONSE FORMAT CMAR – Long Center Renovations 12 RFQ #07-24 a. Explain how the Offeror will provide the: (1) leadership; (2) management; and (3) administration required to be successful in the renovation of this project. b. Explain generally how Offeror will provide the Concept Review and Cost Analysis Services. c. Provide a summary of cost control methods for the (1) Pre-construction Phase; and (2) Construction Phase of the Project. d. Explain how the Offeror will manage construction activities and ensure public safety. e. Provide estimated duration of proposed construction phases. f. Describe how firm will maintain quality control methods for the (1) Pre-construction Phase; and (2) Construction Phase of the project. g. Describe how firm will maintain schedule control methods for the (1) Pre-construction Phase; and (2) Construction Phase of the project. h. Explain firm’s team approach to resolve potential conflicts with the (1) trade contractors and (2) City. i. Provide a brief narrative outlining why your firm is the best qualified to perform the CMAR services with GMP outlined in this RFQ. j. Provide key considerations for a project with a high humidity environment. TAB 4 – PROJECT STAFF AND AVAILABILITY (four [4] pages). Provide a list of key personnel the Offeror will commit to the project for its duration. Identify specific roles for each listed staff (such as project executive, project manager, on-site senior staff, superintendent etc.). Confirm that no key staff changes will take place without written authorization of the City. Identify prior similar projects the key personnel listed have worked on together as a team on behalf of the Offeror. Demonstrate staff’s knowledge of local work force, permitting processes, potential challenges on this project and solutions. Explain how expert sub-contractors in their field will be selected in a cost compatible process. Provide a list of key sub-contractors, their references, and a MOU for their commitment to join your team. Identify prior projects the key sub-contractors have worked on with your team. MOUs will not count towards page limitation. TAB 5 –SAFETY RECORD (two [2] pages). Provide data on the Offeror’s safety record of the past three (3) years as a percentage of employees’ direct hire fixed work hours, rounded to the nearest 1,000. Data should include the number of injuries and illnesses; number of lost time accidents; number of recordable cases; number of fatalities. Provide a number of direct hire fixed hours worked. List your organization’s Workers’ Compensation Experience Modification Rate (EMR) for the last seven (7) years as obtained from your insurance agent. Provide logistics and safety overview of working over pool and protecting existing decking and pool area. TAB 6 – Litigation. NOTE: this is not considered Confidential or Proprietary information – any response indicating such may be deemed non-responsive to the RFQ. 1. Provide a complete listing of any convictions or fines incurred by the respondent firm or any of its principals for violations of any state or federal law within the past three (3) years. Identify firm’s executives who have current claims or who have participated in litigation against the City of Clearwater while with another firm. Executives of firms currently under litigation with the City may not be considered for this project. 2. Provide a complete listing of all litigation involving a construction project or contract (excluding personal injury and workers’ compensation) whether currently pending or concluded within the past three (3) years in which the respondent firm was a named party. 3. Provide a complete listing of all administrative proceedings involving a construction project or contract, whether currently pending or concluded within the past three (3) years, in which the respondent firm was a named party. (NOTE: Administrative Proceedings shall include: (i) any action taken or proceeding brought by a RESPONSE FORMAT CMAR – Long Center Renovations 13 RFQ #07-24 governmental agency, department, or officer to enforce any law, regulation, code, legal, or contractual requirement, except for those brought in state or federal courts; (ii) any action taken by a governmental agency, department, or officer imposing penalties, fines, or other sanctions for failure to comply with any such legal or contractual requirement; or (iii) any other matter before an administrative body.) 4. Provide a complete listing of all arbitrations involving a construction project or contract, whether currently pending or concluded in the past three (3) years, in which the respondent firm was a named party. TAB 7 - Other Forms. The following forms should be completed and signed: 1. Exceptions, Additional Materials, Addenda form 2. Company Information form 3. Response Certification form 4. Exhibit C_Forms 5. Copy of the firm’s current Florida Department of Business and Professional Regulation’s License and Contractor License 6. If the firm is a corporation, a copy of the current Florida Corporation Registration 7. W-9 Form. All responses should include a fully completed, most current W-9 form. Failure to include the W-9 will not disqualify your bid. (http://www.irs.gov/pub/irs- pdf/fw9.pdf) EXCEPTIONS/ADDITIONAL MATERIALS/ADDENDA CMAR – Long Center Renovations 14 RFQ #07-24 Respondents shall indicate any and all exceptions taken to the provisions or requirements in this solicitation document. Exceptions that surface elsewhere and that do not also appear under this section shall be considered invalid and void and of no contractual significance. Exceptions (mark one): **Special Note – Any material exceptions taken to the City’s Terms and Conditions may render a Response non-responsive. No exceptions Exceptions taken (describe--attach additional pages if needed) Additional Materials submitted (mark one): No additional materials have been included with this response Additional Materials attached (describe--attach additional pages if needed) Addenda Respondents are responsible for verifying receipt of any addenda issued by checking the City’s website at https://www.myclearwater.com/business/rfp prior to the bid opening. Failure to acknowledge any addenda issued may render a Bid Non-responsive. Acknowledgement of Receipt of Addenda (initial for each addenda received, if applicable): Addenda Number Initial to acknowledge receipt Vendor Name__________________________________________________ Date__________________ COMPANY INFORMATION CMAR – Long Center Renovations 15 RFQ #07-24 Company Legal/Corporate Name: Doing Business As (if different than above): Address: City: State: Zip: - Phone: Fax: E-Mail Address: Website: DUNS # Remit to Address (if different than above): Order from Address (if different from above): Address: Address: City: State: Zip: City: State: Zip: Contact for Questions about this response: Name: Fax: Phone: E-Mail Address: Day-to-Day Project Contact (if awarded): Name: Fax: Phone: E-Mail Address: Certified Small Business Certifying Agency: Certified Minority, Woman or Disadvantaged Business Enterprise Certifying Agency: Provide supporting documentation for your certification, if applicable. RESPONSE CERTIFICATION CMAR – Long Center Renovations 16 RFQ #07-24 By signing and submitting this Bid/Proposal/Qualification/Response, the Vendor certifies that: a) It is under no legal prohibition on contracting with the City of Clearwater. b) It has read, understands, and is in compliance with the specifications, terms and conditions stated herein, as well as its attachments, and any referenced documents. c) It has no known, undisclosed conflicts of interest. d) The prices offered were independently developed without consultation or collusion with any of the other vendors or potential vendors or any other anti-competitive practices. e) No offer of gifts, payments or other consideration were made to any City employee, officer, elected official, or consultant who has or may have had a role in the procurement process for the commodities or services covered by this contract. The Vendor has not influenced or attempted to influence any City employee, officer, elected official, or consultant in connection with the award of this contract. f) It understands the City may copy all parts of this response, including without limitation any documents or materials copyrighted by the Vendor, for internal use in evaluating respondent’s offer, or in response to a public records request under Florida’s public records law (F.S. Chapter 119) or other applicable law, subpoena, or other judicial process; provided that the City agrees not to change or delete any copyright or proprietary notices. g) It hereby warrants to the City that the Vendor and its subcontractors will comply with, and are contractually obligated to comply with, all federal, state, and local laws, rules, regulations, and executive orders. h) It certifies that Vendor is not presently debarred, suspended, proposed for debarment, declared ineligible, voluntarily excluded, or disqualified from participation in this matter from any federal, state, or local agency. i) It will provide the commodities or services specified in compliance with all federal, state, and local laws, rules, regulations, and executive orders if awarded by the City. j) It is current in all obligations due to the City. k) It will accept all terms and conditions as set forth in this solicitation if awarded by the City. l) The signatory is an officer or duly authorized representative of the Vendor with full power and authority to submit binding offers and enter into contracts for the commodities or services as specified herein. ACCEPTED AND AGREED TO: Company Name: Signature: Printed Name: Title: Date: MAILING LABEL CUT ALONG THE LINE AND AFFIX TO THE FRONT OF YOUR BID CONTAINER CMAR – Long Center Renovations 17 RFQ #07-24 --------------------------------------------------------------------------------- For US Mail ------------------------------------------------------------------------------ SEALED RESPONSE Submitted by: Company Name: Address: City, State, Zip: RFQ #07-24, CMAR – Long Center Renovations Due Date: January 4, 2024, at 10:00 A.M. City of Clearwater Attn: Procurement Division PO Box 4748 Clearwater FL 33758-4748 --------------------------------------------------------------------------------- For US Mail ------------------------------------------------------------------------------ ---------------------------------------------- For Hand Deliveries, FEDEX, UPS or Other Courier Services ------------------------------------------------ SEALED RESPONSE Submitted by: Company Name: Address: City, State, Zip: RFQ #07-24, CMAR – Long Center Renovations Due Date: January 4, 2024, at 10:00 A.M. City of Clearwater Attn: Procurement Division 100 S Myrtle Ave 3rd Fl Clearwater FL 33756 ---------------------------------------------- For Hand Deliveries, FEDEX, UPS or Other Courier Services------------------------------------------------ LONG CENTER | NATATORIUM pg 1 Long Center Natatorium - Building Renovation Jan. 13, 2025 pg 2 Agenda I.Existing Conditions II.Current Issues III. Proposed Solutions / Design a.Envelope Upgrades b.Fenestration System Replacement c.Structural Repairs d.Reroof & PV Infrastructure e.HVAC Replacement pg 3 SITE PLAN Site Plan pg 4 EXISTING CONDITIONS •Existing natatorium built 1988 •Separated from existing building by fire wall. •Two Pools •Spectator seating at mezzanine •Exposed structural steel •Glass building envelope •Low slope roof •Dectron HVAC system pg 5 EXISTING CONDITIONS West Elevation •Exposed steel structure facade •Single pane glazing •Shaded Sun Deck •Dectron HVAC Unit (Back- ground) pg 6 EXISTING CONDITIONS East Elevation •Exposed steel structure facade •Single pane glazing •Manicured & matured planting pg 7 EXISTING CONDITIONS North Elevation •Exposed steel structure facade •Single pane glazing •Manicured & matured planting pg 8 CURRENT ISSUES •Dectron HVAC system beyond useful life span, unable to keep up with load demand. •Solar heat gain •Single pane non-impact fenes- tration system. •Corrosive environment causing steel to rust. •Roof system beyond usable life- span. •Poor water filtration at pools LONG CENTER | NATATORIUM pg 9 PROPOSED SOLUTION pg 10 UPGRADE FENESTRATION | REDUCE GLAZING PROPOSED SOLUTION pg 11 UPGRADE MECHANICAL PROPOSED SOLUTION pg 12 UPGRADE ROOF PROPOSED SOLUTION pg 13 SUN DECK ADDITION PROPOSED SOLUTION LONG CENTER | NATATORIUM pg 14 EAST FACADE pg 15 EAST FACADE LONG CENTER | NATATORIUM pg 16 Addition Enclose Sun-Deck WEST FACADE DESIGN ALTERNATE RENDERS | OPTION 2ANOV 6, 2023 Interior | View 02Interior | View 01 Exterior | North Facade INTERIOR PERSPECTIVE LONG CENTER | NATATORIUM Long Center Natatorium - Building Renovation Jan. 13, 2025 132 Mirror Lake Drive N. Unit 301/Wannemacher Jensen Arch itects, Inc./ 727.822.5566/www.wjarc.com/ AR94244 December 27, 2023 Jeff Walker, P.E. CBO, LEED AP, PMP Sr. Professional Engineer City of Clearwater Dept. of Public Works 1501 N. Belcher Rd. Clearwater, FL RE: The Long Center Natatorium Life Cycle Analysis Mr. Walker WJ Architectecs has completed the Life Cycle Analysis associated with The Long Center Natatorium. Our process and findings are described in the following pages and documents. Should there be any question regarding this study please don’t hesitate to contact Arturo Lopez via email at Arturo.lopez@wjarc.com or by phone at 727.308.2432. We look forward to working with you again in the future on this project or other projects. Respectfully Submitted, WJ Architects Arturo D. Lopez AIA Studio Director / Project Manager Table of Contents Project Summary & Findings 3 Appendix 4 1. Design Options 2. Cost Estimates a. Construction Consultants & Associates Cost Estimate b. WJ Create Cost Estimate 3. Non Destructive Evaluation testing 4. Energy Model Analysis 5. 30 Yr. HVAC Cost Comparison Project Information & Intent The Long Center Natatorium is in the City of Clearwater at 1501 N Belcher Rd. it houses two swimming pools that are used for community events and swim competitions. The building is a single-story structure, composed of an exposed steel and single pane window system envelope along the north, b. Name Date Page 5 Appendix Wannemacher JensenArchitects, Inc.132 Mirror Lake Drive N. Unit 301, St. Petersburg, Florida 33701-3214AA0002277No. DescriptionDatePREPARED FOR:TYPE CLIENT NAMEX CLIENT SIGNATURE AUTHORIZING PRODUCTION DOCUMENTS TO PROCEED INTO NEXT PHASE_ DATE11/28/2023 5:02:54 PMLONG CENTER NATATORIUM1501 N BELCHER RD. CLEARWATER FL, 33765McKim & Creed1365 Hamlet Ave. Clearwater, FL. 33756STRUCTURAL ENGINEEREmerald Engineering9942 Currie Davis Dr. Ste H. Tampa, FL. 33619MEP & FP ENGINEERCouncilman Hunsaker3636 Geyer Rd, Suite 100, St. Louis, MO. 63127SWIMMING POOL ENGINEERMILESTONE HERESCHEMATIC BID SET10.23.23OPTION 1City of Clearwater GENERAL NOTES 1. EXISTING ITEMS AND CONDITIONS ARE DEPICTED AND DESCRIBED ON THESE DRAWINGS ACCORDING TO THE BEST AVAILABLE INFORMATION AND SURVEYS. THE ARCHITECT PROVIDES NO ASSURANCE AS TO, AND ASSUMES NO RESPONSIBILITY FOR THE ACCURACY OF THESE DEPICTIONS AND DESCRIPTIONS. FIELD VERIFY AND DETERMINE, BY ANY MEANS NECESSARY, THE ACTUAL LOCATION, CONFIGURATION AND CONDITION OF ALL PERTINENT ITEMS, INCLUDING THOSE THAT MAY BE IN CONCEALED LOCATIONS. IF INVESTIGATION DISCOVERS THAT ACTUAL CONDITIONS DIFFER FROM WHAT IS DEPICTED OR DESCRIBED ON THESE DRAWINGS OR IF THE ITEMS AND CONDITIONS THAT ARE TO REMAIN AS PART OF THE FINISHED WORK ARE UNSUITABLE TO SUPPORT OR ACCOMMODATE THE WORK REQUIRED FOR THIS PROJECT, OR DO NOT COMPLY WITH BUILDING CODE REQUIREMENTS OR MEET CONSTRUCTION INDUSTRY STANDARDS, IMMEDIATELY NOTIFY THE ARCHITECT BY RFI AND DO NOT PROCEED WITH THE WORK UNTIL RECEIPT OF SUPPLEMENTAL INSTRUCTIONS FROM THE ARCHITECT. 2. ESTABLISH AREAS AND LIMITS OF CONSTRUCTION ACTIVITY ACCEPTABLE TO THE OWNER AND PROVIDE THE TEMPORARY FACILITIES REQUIRED TO ACCOMPLISH THE WORK INCLUDING; FIELD OFFICE, TOILETS, ELECTRIC SERVICE, SITE ACCESS, PARKING, STORAGE AND CONSTRUCTION STAGING AREAS. PROVIDE TEMPORARY WALKWAYS, DRIVEWAYS, BARRIERS, SIGNS AND ILLUMINATION TO SEPARATE AND PROTECT THE GENERAL PUBLIC FROM THE WORK RELATED ACTIVITIES. PROVIDE ACCESS ROUTES TO AND FROM AREAS OF CONSTRUCTION ACTIVITY FOR CONSTRUCTION PERSONNEL THAT COMPLY WITH ALL OSHA AND OTHER GOVERNMENT SAFETY AND ACCESSIBILITY REQUIREMENTS. ASSUME FULL LIABILITY FOR ANY DAMAGE TO ADJACENT PROPERTIES, DAMAGE TO PERSONAL PROPERTY, INJURY TO PERSONS, ETC. CAUSED BY WORK RELATED ACTIVITIES OR NEGLIGENCE.3. PROVIDE TEMPORARY SHORING AS REQUIRED TO ADEQUATELY SUPPORT AND RETAIN EXISTING MATERIALS AND CONSTRUCTION AFFECTED BY THE WORK. PROTECT THOSE ITEMS, MATERIALS & FINISHES TO REMAIN. REMOVE ONLY THOSE ITEMS AND MATERIALS NECESSARY TO ACCOMMODATE THE WORK WITH CLEAN, UNIFORM CUTS. FILL AND PATCH REMAINING CONSTRUCTION AS REQUIRED WITH MATERIALS MATCHING THE ADJACENT MATERIALS IN KIND, STRENGTH, AND APPEARANCE SO AS TO FINISH UNIFORMLY WITHOUT TELEGRAPHING DIFFERENCES BETWEEN THE PATCHES AND THE ADJACENT CONSTRUCTION. REPAIR OR REPLACE ANY ITEMS, MATERIALS OR FINISHES DAMAGED BY THE WORK AT NO COST TO THE OWNER.4. PROVIDE THE ITEMS, PRODUCTS AND FEATURES AS DEPICTED, DESCRIBED AND SPECIFIED ON THE DRAWINGS. IF DISCREPANCIES ARE DISCOVERED ON THE DRAWINGS, NOTIFY THE ARCHITECT BY RFI AND DO NOT PROCEED WITH WORK RELATED TO ITEMS IN QUESTION UNTIL RECEIPT OF SUPPLEMENTAL INSTRUCTIONS FROM THE ARCHITECT. REQUESTS FOR SUBSTITUTIONS MAY BE SUBMITTED TO THE ARCHITECT FOR CONSIDERATION. DO NOT MAKE SUBSTITUTIONS WITHOUT THE APPROVAL OF THE ARCHITECT. WHERE A "BASIS-OF-DESIGN" PRODUCT IS SPECIFIED, A COMPARABLE PRODUCT MAY BE PROVIDED, SUBJECT TO COMPLIANCE WITH THE REQUIREMENTS OF THE CONTRACT DOCUMENTS.5. SUBMIT SHOP DRAWINGS, PRODUCT DATA AND SAMPLES TO THE ARCHITECT AND BCA FOR REVIEW AS REQUIRED BY THE CONTRACT DOCUMENTS. DO NOT PROCEED WITH WORK RELATED TO SUBMITTALS MARKED "REJECTED" OR "REVISE AND RESUBMIT" BY THE ARCHITECT OR THE ARCHITECT'S CONSULTANTS. SUBMITTALS MARKED "APPROVED", "NO EXCEPTION TAKEN" OR "MAKE CORRECTIONS NOTED" DO NOT SUPERSEDE THE NEED TO COMPLY WITH THE REQUIREMENTS OF THE CONTRACT DOCUMENTS. 6. DO NOT SCALE DRAWINGS. THE DIMENSIONS ON THE DRAWINGS GOVERN. WRITTEN NOTES REFERENCING AN ITEM OR FEATURE WITH THE WORD "TYPICAL" (TYP) APPLY TO ALL IDENTICAL ITEMS OR FEATURES INDICATED ELSEWHERE ON THESE DRAWINGS.7. PROVIDE A FLORIDA PRODUCT APPROVAL ISSUED BY THE FLORIDA DEPARTMENT OF BUSINESS & PROFESSIONAL REGULATION OR A MIAMI-DADE NOTICE OF ACCEPTANCE (NOA) ISSUED BY THE MIAMI-DADE COUNTY GOVERNMENT FOR EACH EXTERIOR COMPONENT AND CLADDING ASSEMBLY CERTIFYING THAT APPROVED TESTING HAS SUFFICIENTLY DEMONSTRATED THAT THE ASSEMBLY AND IT'S COMPONENTS, AS DESIGNED AND MANUFACTURED, WILL WITHSTAND THE WIND LOADS AND WIND-BORNE MISSILE IMPACTS IN COMPLIANCE WITH ALL CODE AND JURISDICTIONAL REQUIREMENTS FOR THE PROJECT LOCATION WHEN INSTALLED ACCORDING TO THE MANUFACTURER'S INSTRUCTIONS INCLUDING INSTRUCTIONS THAT MAY BE PROVIDED WITH THE FLORIDA PRODUCT APPROVAL OR NOA DOCUMENTS. PROVIDE THESE DOCUMENTS AS PART OF THE SUBMITTAL FOR EACH OF THESE ITEMS AND ASSEMBLIES FOR BCA APPROVAL.8. PROVIDE ALL ITEMS AND FEATURES DEPICTED AND DESCRIBED ON THESE DRAWINGS AND OTHER CONTRACT DOCUMENTS SO THEY ARE PROPERLY PLACED, ALIGNED, PLUMB, SECURED, FINISHED AND FUNCTIONING AS INTENDED. PROVIDE FINISHED WORK THAT MEETS OR EXCEEDS CURRENT INDUSTRY STANDARDS FOR QUALITY AND PERFORMANCE. ARRANGE AND CONDUCT INSPECTIONS OF THE FINISHED WORK WITH THE OWNER, THE ARCHITECT, AND THE AUTHORITY HAVING JURISDICTION. APPROVAL OF THE WORK BY THESE OR ANY OTHER PARTY OR AGENCY DOES NOT SUPERSEDE THE NEED TO COMPLY WITH THE REQUIREMENTS OF THE CONTRACT DOCUMENTS.9. REMOVE CONSTRUCTION DEBRIS, INCLUDING DEMOLISHED MATERIALS, FROM THE SITE AS REQUIRED TO PREVENT ACCUMULATION. TRANSPORT THESE MATERIALS OFF THE SITE IN A MANNER THAT WILL PREVENT SPILLAGE AND LEGALLY DISPOSE OF THESE MATERIALS AT AN EPA APPROVED DISPOSAL OR RECYCLING FACILITY.10. KEEP COMPLETE AND LEGIBLE SETS OF CONSTRUCTION DOCUMENTS, ADDENDA, SUPPLEMENTAL INSTRUCTIONS, SUPPLEMENTAL DRAWINGS, MEETING NOTES, ETC. TOGETHER AND READILY AVAILABLE IN AN APPROPRIATE LOCATION ON SITE.11. CONCEAL CONDUIT, PIPING, ETC. WITHOUT EXCEPTION. PROVIDE ACCESSIBLE JUNCTION BOXES, VALVES, CLEANOUTS, ETC., AS REQUIRED BY CODE.12. WHERE POSSIBLE AND BEST PRACTICE, ALIGN THE SEAMS AND EDGES OF BREAK METAL AND FLASHING WITH ADJACENT REVEALS, EDGES OF MATERIAL TRANSITIONS, OR WITH BUILDING DESIGN FEATURES. CONSULT WITH ARCHITECT AS REQUIRED.13. PER OWNER - CONTRACTOR AGREEMENT, PROJECT TO FOLLOW ALL OSHA STANDARDS AND REQUIREMENTS. INCLUDE OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION (OSHA) EXCAVATION SAFETY STANDARD 29 C.P.R., SECTION 1926 630 SUBPART P, WHICH ARE INCORPORATED AS THE STATE STANDARD14. ALL CONTRACTORS SHALL INCLUDE IN THEIR BID REFERENCE TO THE TRENCH SAFETY STANDARD, WHERE RELEVANT, AND WRITTEN ASSURANCE THAT THE CONTRACTOR WILL COMPLY WITH CHAPTER 553, PART V TRENCH SAFETY ACT, SECTIONS 553.60 THROUGH 553.64, FLORIDA STATUTES. ALL TRENCH SAFETY SYSTEMS SHALL BE DESIGNED BY THE CONTRACTOR. 15. NEW HOLES IN FLOOR SLAB DUE TO REMOVAL OF FLOOR OUTLETS, CONDUIT OR PIPE SHALL BE FILLED FLUSH WITH FLOOR WITH 3000 PSI CONCRETE AND KEYED TO SLAB WITH STEEL DOWELS. BONDING AGENT SHALL BE APPLIED TO SIDES OF HOLE BEFORE PLACEMENT OF CONCRETE.16. AT STOREFRONT GLASS OR ANY GLASS WALL, FURNISH AND INSTALL DIAGONAL BRACING ABOVE IN CONCEALED LOCATION (IF EXPOSED, CONFIRM LOCATION SIDE WITH ARCHITECT).17. REQUESTS FOR SUBSTITUTIONS OF SPECIFIED ITEMS SHALL BE SUBMITTED IN WRITING WITHIN BID PROPOSAL FOR CONSTRUCTION TO THE ARCHITECT, AND WILL BE CONSIDERED ONLY IF THEY PROVIDE BETTER SERVICES, HAVE A MORE ADVANTAGEOUS DELIVERY DATE, OR HAVE A LOWER PRICE PROVIDING A CREDIT TO THE TENANT AND WILL NOT SACRIFICE QUALITY, APPEARANCE OR FUNCTION. UNDER NO CIRCUMSTANCES WILL THE ARCHITECT BE REQUIRED TO PROVE THAT A PRODUCT PROPOSED FOR SUBSTITUTION IS OR IS NOT OF EQUAL QUALITY TO THE SPECIFIED PRODUCT.18. SHOP DRAWINGS/SUBMITTALS ARE REQUIRED FOR BUT NOT LIMITED TO THE FOLLOWING: MILLWORK, STRUCTURAL/MISCELLANEOUS STEEL, HARDWARE, WOOD AND METAL DOORS, AND EQUIPMENT. SHOP DRAWINGS SHOULD INCLUDE DETAILED FABRICATION AND ERECTION DRAWINGS, SETTING DRAWINGS, AND MATERIAL SCHEDULES. FABRICATION SHALL BEGIN ONLY AFTER ARCHITECT'S REVIEW AND APPROVAL OF SHOP DRAWINGS.FLORIDA APPROVED EXTERIOR COMPONENTS & CLADDING PRODUCTS* LISTINGROOFINGCATEGORYAPPROVAL NUMBERAPPLICANTJOHNS MANVILLEDESCRIPTION* BASIS-OF-DESIGN PRODUCTS: COMPARABLE PRODUCTS BY OTHER MANUFACTURERS MAY BE PROVIDED. SUB CATEGORYTPO ROFF SYSTEMSMATERIALSBSPANEL WALLSYKKFL14218-R2AP YHS 50 FSSTOREFRONT ALUMINUMEXTERIOR DOORSINGERSOLL-RANDFL12400-R2IR SERIES FLUSH OUTSWINGSWINGING EXTERIOR DOOR ASSEMBLIES STEELROOFINGBILCOFL15110SERIES NBROOF HATCH STEELDOORSYKKFL13321-R535HSTOREFRONT ALUMINUMEXTERIOR DOORSOVERHEAD DOOR CO.FL11734.1MODEL 416SECTIONAL EXTERIOR DOOR ASSEMBLIES STEELABBREVIATIONS A/C AIR CONDITIONINGACOUS ACOUSTICALAD AREA DRAINADA AMERICANS WITH DISABILITIES ACTADD ADDITIONALADJ ADJUSTABLEAFF ABOVE FINISH FLOORALT ALTERNATEALUM ALUMINUMAPPD APPROVEDAPPROX APPROXIMATEARCH ARCHITECTURALAUTO AUTOMATICA/V AUDIO VISUALB/WBETWEENBCABUILDING CONSTRUCTION AUTHORITYBLDGBUILDINGCBU CEMENTITIOUS BACKER UNITCFMFCOLD FORM METAL FRAMINGCJ CONTROL JOINT / CONSTRUCTION JOINTCL CENTER LINECLG CEILINGCLR CLEARCMU CONCRETE MASONRY UNITCNTR COUNTERCO CLEANOUTCOL COLUMNCONC CONCRETECOND CONDITIONCONN CONNECTIONCONT CONTINUOUSCOORD COORDINATECORRCORRIDORCTR CENTERDBL DOUBLEDEMODEMOLITIONDEPT DEPARTMENTDET DETAILDF DRINKING FOUNTAINDIA DIAMETERDIFF DIFFUSERDIMDIMENSIONDN DOWNDPDIMENSION POINTDR DOORDRN DRAINDWG DRAWINGEA EACHEJ EXPANSION JOINTELEV ELEVATIONELECELECTRICALENCL ENCLOSUREEQEQUALEQUIPEQUIPMENTEWEACH WAYEWC ELECTRICAL WATER COOLEREXIST EXISTINGEXPEXPANSIONEXT EXTERIORF/ FACE OF (SEE OTHER WORD)FAFIRE ALARMFACPFIRE ALARM CONTROL PANELFDFLOOR DRAINFDC FIRE DEPARTMENT CONNECTIONFEC FIRE EXTINGUISHER CABINETFEXFIRE EXTINGUISHERFF FINISH FLOORFF&EFURNITURE, FINISHES & EQUIPMENTFHC FIRE HOSE CABINETFIN FINISHFIXT FIXTUREFL FLOORFR FRAMEFT FEETFURN FURNITURE/ FURNISHEDFURR FURRINGGA GAUGE / GAGEGALV GALVANIZEDGC GENERAL CONTRACT/ORGL-xx,GLASSGWB GYPSUM WALLBOARDHB HOSE BIBBHCP HANDICAPPEDHDW HARDWAREHM HOLLOW METALHORIZ HORIZONTALHCHANDICAPPEDHR HOURHSS HOLLOW STRUCTURAL SECTIONHTHEIGHTHVAC HEATING, VENTILATING, AIR CONDITIONINGHW HOT WATERIN INCHINCL INCLUDED / INCLUDINGINFO INFORMATIONINT INTERIORINTERM INTERMEDIATEISAINTNL SYMBOL OF ACCESSIBILITYLAV LAVATORYLVR LOUVERMAINT MAINTENANCEMAXMAXIMUMMECH MECHANICALMEP MECHANICAL, ELECTRICAL, PLUMBINGMFR MANUFACTURERMIN MINIMUMMISC MISCELLANEOUSMMMILLIMETERMTDMOUNTEDMTL METALMULL MULLIONN/A NOT APPLICABLENC NOISE CRITERIANIC NOT IN CONTRACTNO NUMBERNOM NOMINALNRC NOISE REDUCTION COEFFICIENTNTS NOT TO SCALEOC ON CENTEROH OVER HEADOPNG OPENINGOPP OPPOSITEOPP HD OPPOSITE HANDPAV PAVERPERF PERFORATEDPERIM PERIMETERPERP PERPENDICULARPLAMPLASTIC LAMINATEPLBG PLUMBINGPR PAIRPREFAB PREFABRICATEDPTPRESSURE TREATEDPTD PAINTEDPTN PARTITIONPTxx PAINTQC QUALITY CONTROLQTY QUANTITYR RADIUSRCP REFLECTED CEILING PLANRD ROOF DRAINREC RECESSEDREF REFERENCEREQ REQUIRE / REQUIREDREV REVISION / REVISEDRM ROOMSCHED SCHEDULESD STORM DRAINSECT SECTIONSF SQUARE FEET/FOOTSHT SHEETSIM SIMILARSPECSPECIFICATIONSPKRSPEAKERSPRSPRINKLERSQ SQUARESSSTAINLESS STEELSSK SERVICE SINKSTD STANDARDSTL STEELSTOR STORAGESTRL STRUCTURALSUSP SUSPENDEDSYMM SYMMETRICALTELTELEPHONE OR TELECOMTHKTHICKNESSTHRUTHROUGHTVTELEVISIONTYPTYPICALUL UNDERWRITERS LABORATORYUNFIN UNFINISHEDU.N.O.UNLESS NOTED OTHERWISEUON UNLESS OTHERWISE NOTEDUR URINALVCTVINYL COMPOSITION TILEVERTVERTICALVEST VESTIBULEVIF VERIFY IN FIELDW WIDE, WIDTHW/ WITHW/O WITHOUTWC WATER CLOSETWD WOODWDW WINDOWWWF WELDED WIRE FABRICXTREXISTING TO REMAINALIGN1'-0"A.F.F1001XA101A1011Ref1Ref1Ref1Ref1Ref1Ref1Ref1Ref1tNameElevation1A101SIMXXXX 6X6ROOM TAGDOOR TAGSTOREFRONT TAGWALL TAGSPECIALTY EQUIPMENTTAGFLOOR TAGELEMENT TAGSEXTERIOR ELEVATIONINTERIOR ELEVATIONSECTION MARKVIEW CALLOUTLEVEL HEADSPOT ELEVATION MARKVIEW TAGSA1011SIMANNOTATION TAGSALIGNMENT TAGTAG LEGEND ST-XRoom name101XXXSPECIFIC NOTE TAGTHE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONG-101DRAWING LEGENDAND BUILDING DATA0000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376500110.23.23SCHEMATIC BID SETSITE LOCATION MAPPROJECTLEGAL DESCRIPTIONParcel Number: 07-29-16-00000-220-0100. PART OF NW 1/4 OF SEC 7-29-16 DESD FROM NW SEC COR TH S89D35'50"E 55FT TO E R/W OF BELCHER RD TH S00D04'51"E 480.50FT FOR POB TH S89D35'50"E 662.69 FT TO C/L OF CREEK TH SE'LY ALG C/L S33D42'24"E 10.60FT TH S20D46'23"E 139.50FT TH S01D02'42"E 100.92FT TH S26D41'04"E 42.96FT TH N83D42'51"E 33.70FT TH S65D53'11"E 50.08FT TH S54D52'27"E 146.40FT TH S47D12'36"E 199.78FT TH S79D43'47"E 93.99FT TH LEAVING SD CREEK C/L S89D36'10"E 95FT TO E LINE OF NW 1/4 OF NW 1/4 OF SEC TH S00D23'50"W 324.98FT TO SE COR OF NW 1/4 OF NW 1/4 OF SD SEC TH N89D44'07"W 232.83FT TO NE'LY LINE OF SCL RR TH N72D45'16"W 1085.20FT TO E R/W OF BELCHER RD TH N00D04'51"W 539.23FT TO POB CONT 15.78ACFEMA FLOOD MAPWIND LOADSRISK CATEGORY (FBC TABLE 1604.5): IIULTIMATE DESIGN WIND SPEED: 144 MPHFLOOD ZONE FEMA FLOOD ZONE: FLOOD ZONE X BASE FLOOD ELEVATION (BFE): 36.10' NA FOR ZONE XLOWEST FFE IN PROPOSED PROJECT: 43.00' EXISTING NAVDMILESTONE DATEPROJECT THE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONG-103SHEET INDEX_OPT 10000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SETMILESTONE DATEDRAWING INDEXSHEET # SHEET NAMESD BID PACKAGE01 GENERALG-100 COVER_OPT 1●G-101 DRAWING LEGEND AND BUILDING DATA ●G-103 SHEET INDEX_OPT 106 DEMOAD-301 DEMO FLOOR PLAN●AD-302 DEMO ROOF PLAN●AD-303 DEMO EXTERIOR ELEVATIONS●AD-304 DEMO EXTERIOR ELEVATIONS●07 ARCHITECTURALA-002 3D VIEWS_OPT 1●A-003 RENDERINGS OPT_1●A-101 LEVEL 1 - FLOOR PLAN_OPT 1●A-102 ROOF PLAN_OPT 1●A-201 REFLECTED CEILING PLAN●A-303 EXTERIOR ELEVATIONS_OPT 1●A-304 EXTERIOR ELEVATIONS_OPT 1●A-410 EXTERIOR TRUSS PLANS, ELEVATIONS & SECTION_OPT 1 ●A-412 VENTILATION TOWERS_OPT 1●A-413 WALL SECTIONS_OPT 1●A-501 COVER_OPT 2●A-502 3D VIEWS_OPT 2●A-503 RENDERINGS OPT_2●A-504 LEVEL 1 - FLOOR PLAN_OPT 2●A-505 ROOF PLAN_OPT 2●A-506 EXTERIOR ELEVATIONS_OPT 2●A-507 EXTERIOR ELEVATIONS_OPT 2●A-508 EXTERIOR TRUSS PLANS, ELEVATIONS & SECTION_OPT 2 ●A-509 VENTILATION TOWERS_OPT 2●A-510 WALL SECTIONS_OPT 2● UPUPAD-3032AD-3031AD-3041D011D011D011D011D011D011D011D011D011D002D011D011D011D011D011D011D011D011D011D011D002D011D011D011D011D011D011D011COMPETITION POOLTRAINING POOLSUN DECKD012D017D012D012D0125' - 8 3/8"20' - 5 3/4"D021D011D021NOT IN SCOPEGENERAL NOTES -DEMOLITION 1. ALL DIMENSIONS AND CONDITIONS TO BE FIELD VERIFIED BY CONTRACTOR PRIOR TO WORK, NOTIFY ARCHITECT IF CONFLICTS ARE FOUND2. PROTECT ALL AREAS TO REMAIN. G.C. TO REPAIR OR REPLACE ANY ITEM TO REMAIN OR TO BE RELOCATED THAT IS DAMAGED DURING THE WORK. PROVIDE A SEAMLESS, UNDAMAGED APPEARANCE WHEN JOINING NEW TO EXISTING3. REMOVE DASHED PORTION OF EXISTING WALLS, DOORS, WINDOWS, SIDELIGHTS, TRANSOMS, AND FRAMES. PREPARE AREA TO RECEIVE NEW CONSTRUCTION AS SCHEDULED. 4. FINISHES - ALL EXISTING FINISHES SHALL REMAIN, UNLESS SCHEDULED FOR NEW. CONTINUE EXISTING FINISHES TO REMAIN INTO NEW EXTENDED AREAS THAT ARE ADJACENT. PATCH & REPAIR EXISTING TO MATCH NEW. PREPARE SUBSTRATES TO RECEIVE NEW FINISHES WHERE SCHEDULED. FINISH ALL PATCHED OR EXTENDED WALLS TO NEAREST CHANGE OF DIRECTION, WALL TERMINATION, OR INTERSECTION. PHASING - COORDINATE EQUIPMENT DELIVERIES AND INSTALLATION WITH THE PHASING PLAN FOR APPROPRIATE SCHEDULING.5. CONFLICTS - ANY CONFLICT FOUND WITH EXISTING CONDITIONS AND REQUIREMENTS FOR NEW CONSTRUCTION SHALL BE IMMEDIATELY BROUGHT TO THE ATTENTION OF THE ARCHITECT. IF THE CONFLICT AFFECTS THE PROGRESS OF THE WORK, VERIFY WITH ARCHITECT SOLUTION NECESSARY PRIOR TO PROCEEDING WITH THAT PORTION OF THE WORK AND IN A TIMELY FASHION SO AS NOT TO DELAY THE WORK. COORDINATE ALL TRADES TO ASCERTAIN NO FURTHER WORK WILL BE IMPACTED BY THE CONFLICT, OR ITS SOLUTION.ABDCTHE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONAD-301DEMO FLOOR PLAN0000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SET3/32" = 1'-0"DEMOLITION FLOOR PLAN1MILESTONE DATEDEMOLITION KEY NOTESTAG NOTED002 DEMOLISH EXISTING DOOR & FRAME ENTIRELY.D011 DEMOLISH GLAZYNG SYSTEM ENTIRELY, STEEL STRUCTURE TO REMAIN.D012 DEMOLISH TRENCH DRAIN AND POOL EDGE TO ACCOMODATE FOR NEW DRAINASSEMBLY AROUND COMPETITION POOLD017 CAREFULLY REMOVE POOL ACCESSORIES AS REQUIRED TO DEMOLISH POOL EDGE.D021 DEMOLISH CONCRETE SLAB IN PREPARATION FOR NEW FOUNDATION SYSTEM. 121' - 3 3/4" ± V.I.F.1/4" / 12"1/4" / 12"D003D003D004D004D004D004D004D004D003D005D004D004225' - 7 1/2"7' - 7"10' - 4"D018D018D018D018ABDCTHE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONAD-302DEMO ROOF PLAN0000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SETMILESTONE DATE3/32" = 1'-0"DEMOLITION ROOF PLAN1DEMOLITION KEY NOTESTAG NOTED003 DEMOLISH ROOF SYSTEM DOWN TO DECK.D004 DEMOLISH EXISTING ROOF CURB ENTIRELY.D005 REFER TO MECHANICAL ENGINEERS' DWGS. FOR DEMOLITION OFMECHANICAL EQUIPMENT & COMPONENTS.D018 EXISTING METAL DECK TO BE CUT OUT TO PROVIDE ACCESS FORDUCTWORK. LEVEL 10"GRADE -ENTRY-2' -0"ABB2B3B5B7B9B11OPT 1 -ROOF PLANNAVD 38' -1 3/4"MEZZANINE LEVELNAVD 17' -3 3/4"D011D011D011D011D011D011LEVEL 10"11.322.333.344.355.366.377.388.399.31010.3OPT 1 -ROOF PLANNAVD 38' -1 3/4"MEZZANINE LEVELNAVD 17' -3 3/4"D011D011D011D011D011D011D011D011D011D011D011ABDCTHE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONAD-303DEMO EXTERIORELEVATIONS0000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SET1/8" = 1'-0"DEMOLITION ELEVATION - EAST11/8" = 1'-0"DEMOLITION ELEVATION - NORTH2MILESTONE DATEDEMOLITION KEY NOTESTAG NOTED011 DEMOLISH GLAZYNG SYSTEM ENTIRELY, STEEL STRUCTURE TOREMAIN. LEVEL 10"OPT 1 -ROOF PLANNAVD 38' -1 3/4"D011D011D011D011D011D011D011ABDCTHE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONAD-304DEMO EXTERIORELEVATIONS0000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SET1/8" = 1'-0"DEMOLITION ELEVATION - WEST1MILESTONE DATE DESIGN CRITERIA ROOF:60 MIL TPO SINGLE PLY MEMBRANEINSULATION:ROOF IS R-20 MIN POLYISO RIGID INSULATIONCURTAIN WALL: YKK - YHC 300 OG IMPACT RESISTANT SYSTEMGLAZING: 1-1/4" INSULATED LOW E GLAZING, IMPACT RESISTANT OPAQUE WALLS: METAL STUD WALLS FIBERGLASS BATT INSULATION R-19 + 1" RIGID INSULATION 5/8" MOISTURE RESISTANT GYPSUM BOARDEXISTING STRUCTURE: REPAIRED AS NEEDED, PER STRUCTURAL. SAND AND PAINT PAINT, COLOR BY ARCHITECT.POOL TRENCH DRAIN: NATURE CORPORATION GMP GRATINGPOOL DECK COATING: ARMORTRAK FLEXIBLE MILITARY GRADE URETHANE COATINGTHE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONA-0023D VIEWS_OPT 10000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SETMILESTONE DATEOPT - 1 3D VIEW -22OPT - 1 3D VIEW -1121 THE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONA-003RENDERINGS OPT_10000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SETMILESTONE DATEEXTERIOR RENDER - NORTHINTERIOR RENDER - VIEW 1INTERIOR RENDER - VIEW 2EXTERIOR RENDER - WEST - NORTHEXTERIOR RENDER - EAST E 9 - 3 1 0 1 E 9- 3 1 6 1 A S - 3 1 7 8 E 9- 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9- 3 101 E 9- 3 161A S- 3 178 E 9- 3 101A S- 3 172E 9- 3 161 E 9- 3 101A S- 3 172E 9- 3 161 E 9- 3 101 E 9- 3 161A S- 3 178 E 9- 3 101A S- 3 172E 9- 3 161 E 9- 3 101A S- 3 172E 9- 3 161 E 9- 3 101 E 9- 3 161A S- 3 178 E 9- 3 101A S- 3 172E 9- 3 161 E 9- 3 101A S- 3 172E 9- 3 161 E 9- 3 101 E 9- 3 161A S- 3 178 E 9- 3 101A S- 3 172E 9- 3 161 E 9- 3 101A S- 3 172E 9- 3 161 E 9- 3 101 E 9- 3 161A S- 3 178 E 9- 3 101A S- 3 172E 9- 3 161 E 9- 3 101 E 9- 3 161A S- 3 178 E 9- 3 101E 9- 3 161 A S- 3 178 E 9- 3 101A S- 3 172E 9- 3 161 E 9- 3 101A S- 3 172E 9- 3 161 E 9- 3 101E 9- 3 161 A S- 3 178 E 9- 3 101A S- 3 172E 9- 3 161 E 9- 3 101A S- 3 172E 9- 3 161 E 9- 3 101E 9- 3 161 A S- 3 178 E 9- 3 101A S- 3 172E 9- 3 161 E 9- 3 101A S- 3 172E 9- 3 161 E 9- 3 101 E 9- 3 161A S- 3 178 E 9- 3 101E 9- 3 161A S- 3 178E 9- 3 101A S- 3 172E 9- 3 161 E 9- 3 101A S- 3 172E 9- 3 161 E 9- 3 101A S- 3 172E 9- 3 161 E 9- 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S- 3 1 7 8 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1 E 9 - 3 1 6 1A S - 3 1 7 8 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1 A S - 3 172 E 9 - 3 1 6 1 E 9 - 3 1 0 1 E 9 - 3 1 6 1A S - 3 1 7 8 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 101 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 E 9 - 3 161 A S - 3 1 7 8 E 9 - 3 1 0 1 A S- 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1 A S- 3 1 7 2 E 9- 3 1 6 1 E 9 - 3 101 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1A S - 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9- 3 101E 9- 3 161A S- 3 178E 9- 3 101E 9- 3 161A S- 3 178 E 9- 3 101A S- 3 172E 9- 3 161 E 9- 3 101A S- 3 172E 9- 3 161 E 9- 3 101A S- 3 172E 9- 3 161 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 178 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9- 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9- 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 UPUPA-3033A-303211.322.333.344.355.366.377.388.399.31010.3ABB2B3B5B7B9B11A-3041223' - 4"113' - 8"1A-4132A-4122A-41020' - 11 1/2" V.I.F.20' - 1"39' - 11"20' - 1"POOL DECK DRAINSCW-02CW-03CW-04CW-05CW-06CW-07CW-08CW-09CW-10CW-11CW-12CW-13CW-14CW-01A-4101CW-15A-5091PN06PN06PN10PN07COMPETITION POOLTRAINING POOLSUN DECKPN14PN12PN16PN16PN16PN16NOT IN SCOPEGENERAL NOTES 1. HATCHED AREA NOT INCLUDED IN SCOPE OF WORK UNLESS OTHERWISE NOTED.2. PROVIDE SUPPORT FOR WALL MOUNTED CABINETS AND PLUMBING FIXTURES. STEEL STUDS SUPPORTING WALL MOUNTED FIXTURES TO BE DOUBLED AT 16 O.C. OR NOT LESS THAN 20 GAUGE PER FBC 2517.5.1.1.3. COMBUSTIBLE MATERIALS IN TYPES I & II CONSTRUCTION TO COMPLY WITH FBC 603.1 (FIRE RETARDANT - TREATED WOOD ) AND 805.1 & 806.14. PROVIDE CEMENTITIOUS BACKER BOARD IN PLACE OF GWB AT ALL LOCATIONS SHOWING CERAMIC OR PORCELAIN TILE FINISH.5. SEE SHEET ID100 - ID10X FOR FINISH PLANS.6. SEE SHEET AX.X FOR PLAN DETAIL CALLOUTS.7. SEE SHEET AX.X FOR PARTITION TYPE DETAILS. PROVIDE ACOUSTICAL BATT INSULATION WHERE INDICATED.8. SEE SHEET AX.X FOR DIMENSION PLANS.9. SEE SHEET AX.X FOR DOOR SCHEDULE.10. SEE ENLARGED PLANS FOR ADDITIONAL WALL TAG INFORMATION.ALIGN1'-0"A.F.F1001XA101A1011Ref1Ref1Ref1Ref1Ref1Ref1Ref1Ref1tNameElevation1A101SIMXXXX 6X6ROOM TAGDOOR TAGSTOREFRONT TAGWALL TAGSPECIALTY EQUIPMENTTAGFLOOR TAGELEMENT TAGSEXTERIOR ELEVATIONINTERIOR ELEVATIONSECTION MARKVIEW CALLOUTLEVEL HEADSPOT ELEVATION MARKVIEW TAGSA1011SIMANNOTATION TAGSALIGNMENT TAGTAG LEGEND ST-XRoom name101XXXSPECIFIC NOTE TAGABDC5/8" WATER RESISTANT GWB, (1) LAYER ON FINISH SIDEPLANC03METAL STUD FRAMING @ 16" O.C.THE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONA-101LEVEL 1 - FLOORPLAN_OPT 10000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SET3/32" = 1'-0"OPT 1 - LEVEL 1 - FLOOR PLAN1MILESTONE DATESPECIFIC NOTESTAG NOTEPN06 SIDEKICK BIG ASS FAN, PLUG-IN TYPE, PROPELLER STYLE ONWHEELS.PN07 PROVIDE NEW POOL EDGE AND TRENCH DRAIN ASSEMBLY TOMATCH TRAINING POOL.PN10 EXISTING BEAM ABOVE.PN12 REMOVE AND REPLACE POOL ACCESSORIES TO REPLACE POOLEDGE.PN14 CROWN SST-II HYDRAULIC BI-FOLD DOOR SYSTEM.PN16 EPOXY DECK COATING THROUGHOUT POOL DECK. GENERAL NOTES 1. ROOFING PRODUCT BASIS-OF-DESIGN: 60 MIL TPO SINGLE PLY MEMBRANE ROOF OR APPROVED EQUAL (COLOR WHITE) RIGID INSULATION BOARD MECHANICALLY FASTENED TO STEEL ROOF DECK. INSULATION TO HAVE AN AVERAGE R-20 @ ALL ROOFS OVER CONDITIONED SPACES. PROVIDE ROOFING COMPONENTS AND MATERIALS APPROVED BY THE ROOFING PRODUCT MANUFACTURER. ASSEMBLE ROOFING COMPONENTS INCLUDING FLASHING, ROOF DRAINS, ETC. PER THE ROOFING PRODUCT MANUFACTURER'S DETAILS AND INSTRUCTIONS SO AS TO QUALIFY FOR, AND RECEIVE A SPECIAL 20-YEAR WEATHER-TIGHTNESS WARRANTY FROM THE MANUFACTURER AS WELL AS A SPECIAL 2-YEAR PROJECT WARRANTY FROM THE ROOFING INSTALLER COVERING ALL COMPONENTS OF THE ROOFING SYSTEM SUCH AS ROOFING, BASE FLASHING, ROOF INSULATION, FASTENERS, COVER BOARDS, ETC. PROVIDE ROOFING FROM A QUALIFIED MANUFACTURER THAT IS FM GLOBAL APPROVED FOR ROOFING SYSTEM IDENTICAL TO THAT USED FOR THIS PROJECT.2. PROVIDE METAL ROOF COPINGS AND PARAPET FASCIAS FABRICATED OF ASTM B209 0.050-INCH ALUMINUM SHEET. COMPLY WITH "THE NRCA ROOFING MANUAL" AND THE SMACNA "ARCHITECTURAL SHEET METAL MANUAL REQUIREMENTS FOR DIMENSIONS AND PROFILES SHOWN UNLESS MORE STRINGENT REQUIREMENTS ARE INDICATED. PROVIDE MANUFACTURER'S 20-YEAR FINISH WARRANTY. SECURE COPINGS TO PARAPETS WITH CONT ALUMINUM CLEATS.3. PROVIDE GALVANIZED STEEL INTERNALLY REINFORCED ROOF-CURB UNITS CAPABLE OF SUPPORTING SUPERIMPOSED LIVE AND DEAD LOADS, INCLUDING EQUIPMENT LOADS, WITH WELDED OR MECHANICALLY FASTENED, NON-SAG SEALED JOINTS AND INTEGRALLY FORMED DECK-MOUNTING FLANGE AT PERIMETER BOTTOM. COORDINATE DIMENSIONS WITH ROUGHING-IN INFORMATION ON SHOP DRAWINGS OF EQUIPMENT TO BE SUPPORTED.4. ROOF DRAIN BASIS-OF-DESIGN: Z125 8 3/8" DIAMETER ROOF DRAIN WITH LOW SILHOUETTE DOME MANUFACTURED BY ZURN INDUSTRIES.5. GENERAL - IT IS THE INTENT OF THE CONTRACT DOCUMENTS TO PROVIDE FOR A COMPLETE AND WEATHERTIGHT INSTALLATION OF ALL ROOF ITEMS, PENETRATIONS, ETC. THE CONTRACTOR SHALL PROVIDE ALL ROOF ACCESSORIES, FLASHING, SEALANT, SCUPPERS, DRAINS, LABOR, MATERIALS, EQUIPMENT, ETC. REQUIRED FOR COMPLETION OF A WEATHERTIGHT ROOF INSTALLATION. FOLLOW ALL RECOMMENDATIONS OF THE NRCA REGARDING INSTALLATION PROCEDURES, UNLESS MORE STRINGENT REQUIREMENTS ARE INDICATED6. SLOPE - ROOF SURFACE SHALL HAVE A MINIMUM SLOPE OF 1/4" PER FOOT IN A PERPENDICULAR DIRECTION FROM THE ROOF EDGE DOWN TOWARD THE ROOF DRAINS AS INDICATED BY THE ARROWS DRAWN ON THE ROOF PLAN. WHERE REQUIRED TO FACILITATE DRAINAGE, PROVIDE VALLEYS, CRICKETS, RIDGES, ETC. OF REQUIRED SLOPE TO PROPERLY DRAIN ALL ROOF SURFACES.7. ROOF DRAINS - COORDINATE LOCATION OF ALL ROOF DRAINS TO AVOID RATED WALLS, BEAMS, COLUMNS, JOISTS, ETC. BELOW.8. PENETRATIONS - PROPERLY FLASH, WATERPROOF, SECURE AND SEAL ALL ITEMS THAT PENETRATE THE ROOF MEMBRANE. DO NOT INSTALL ANY PITCH POCKETS. FOLLOW GUIDELINES OF NRCA CONCERNING FLASHING AND WATERPROOFING ALL ROOF PENETRATIONS. SEE ROOF DETAILS9. ROOF EQUIPMENT - MOUNT ALL ROOF EQUIPMENT ON PREFABRICATED EQUIPMENT SUPPORT CURBS WITH INTEGRAL INSULATION. WHERE EQUIPMENT IS RAISED ABOVE ROOF SURFACE, ALIGN SUPPORTS PARALLEL TO DIRECTION OF WATERFLOW TO FACILITATE DRAINAGE. VERIFY ALL REQUIREMENTS WITH EQUIPMENT AND CURB MANUFACTURERS. WHERE ROOF MEMBRANE EXTENDS BENEATH EQUIPMENT, MOUNT EQUIPMENT ABOVE THE ROOF SURFACE IN ACCORDANCE WITH BUILDING CODE AND NRCA REQUIREMENTS TO ALLOW FOR INSTALLATION OF ALL REQUIRED ROOFING COMPONENTS AND TO ALLOW FOR FUTURE OWNER MAINTENANCE.10. LIGHTNING PROTECTION - REFER TO ELECTRICAL DRAWINGS PROTECTION FOR ALL LIGHTNING PROTECTION. GROUNDING RODS, CABLES, CONNECTIONS, ETC. SHALL BE INSTALLED IN SUCH A MANNER TO PREVENT ANY DAMAGE TO INSTALLED ROOF MEMBRANE. GROUNDING RODS SHALL BE FASTENED TO THE SUBSTRATE ON WHICH THEY ARE MOUNTED. PROVIDE ALL REQUIRED FLASHING, SEALANT, WATERPROOFING, NON-CORROSIVE FASTENERS, ETC. AT EACH LOCATION AND AT MEMBRANE PENETRATION POINTS.1' - 0"121' - 3 3/4"1A-4132A-4122A-4101/4" / 12"1/4" / 12"1/4" / 12"1/4" / 12"RN01RN02RN03HVACEQUIPMENTHVACEQUIPMENTHVACEQUIPMENTHVACEQUIPMENT10' - 8 3/8"RN05RN05225' - 8 1/4"20' - 3 3/4"6' - 3"20' - 5 3/4"RN06ABDCRN08EL12RN0760 MIL TPO MEMBRANE FULLY ADHEREDHEAT WELD1/2" HIGH DENSITY COVER BOARDPOLYISO RIGID INSULATION (R-20 MIN)EXISTING METAL DECK TO REMAINMEMBRANE LAP PER MANUFACTURER STANDARDSSINGLE PLY ROOF MEMBRANE SYSTEMSOLID BLOCKINGPRE-FINISHED TWO PIECE METAL FASCIA3/8" STEEL BENT PLATESTEEL DECK EXTENSION 12 ±SEALANT1' - 0 1/8"THE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONA-102ROOF PLAN_OPT 10000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SETMILESTONE DATE3/32" = 1'-0"OPT 1 - ROOF PLAN1SPECIFIC NOTESTAG NOTEEL12 LOUVERED ROOF EQUIPMENT SCREEN WALL, HEIGHT TO BEDETERMINED.RN01 60 MIL SINGLE PLY TPO ROOF MEMBRANE.RN02 12" ROOF EXTENSION, REFER TO SECTION DETAIL.RN03 TOP OF TRUSS BELOW.RN05 PHOTOVOLTAIC ARRAY.RN06 ALUMINUM SUNSHADES BY CURTAIN WALL MANUFACTURER.RN07 PROVIDE STEEL SUPPORT FRAMES FOR DUCT WORK @ 48" O.C.RN08 LOUVERED ROOF EQUIPMENT SCREEN WALL, HEIGHT TO BEDETERMINED.1 1/2" = 1'-0"OPT 1 - DETAIL - TYPICAL TPO ROOF ASSEMBLY21" = 1'-0"OPT 1 - TYP. NORTH ROOF EDGE3 E 9 - 3 1 0 1 E 9 - 3 1 6 1A S - 3 1 7 8 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9- 3 101 E 9- 3 161A S- 3 178 E 9- 3 101 A S- 3 172E 9- 3 161 E 9- 3 101 A S- 3 172E 9- 3 161 E 9- 3 101 E 9- 3 161A S- 3 178 E 9- 3 101 A S- 3 172E 9- 3 161 E 9- 3 101 A S- 3 172E 9- 3 161 E 9- 3 101 E 9- 3 161A S- 3 178 E 9- 3 101 A S- 3 172E 9- 3 161 E 9- 3 101 A S- 3 172E 9- 3 161 E 9- 3 101 E 9- 3 161A S- 3 178 E 9- 3 101 A S- 3 172E 9- 3 161 E 9- 3 101 A S- 3 172E 9- 3 161 E 9- 3 101 E 9- 3 161A S- 3 178 E 9- 3 101 A S- 3 172E 9- 3 161 E 9- 3 101 A S- 3 172E 9- 3 161 E 9- 3 101 E 9- 3 161A S- 3 178 E 9- 3 101 A S- 3 172E 9- 3 161 E 9- 3 101E 9- 3 161A S- 3 178 E 9- 3 101A S- 3 172E 9- 3 161E 9- 3 101A S- 3 172E 9- 3 161E 9- 3 101E 9- 3 161A S- 3 178 E 9- 3 101A S- 3 172E 9- 3 161E 9- 3 101A S- 3 172E 9- 3 161 E 9- 3 101E 9- 3 161A S- 3 178 E 9- 3 101 A S- 3 172E 9- 3 161 E 9- 3 101A S- 3 172E 9- 3 161E 9- 3 101A S- 3 172E 9- 3 161 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9- 3 101 E 9- 3 161A S- 3 178 E 9- 3 101E 9- 3 161A S- 3 178 E 9 - 3 1 0 1 E 9- 3 1 6 1 A S- 3 1 7 8 E 9- 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1 E 9- 3 1 6 1 A S - 3 1 7 8E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 161 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1E 9 - 3 1 6 1 A S - 3 1 7 8E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1 A S- 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 178 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9- 3 1 6 1 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 178 E 9 - 3 1 0 1 A S - 3 1 7 2E 9 - 3 1 6 1 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9- 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 E 9- 3 1 6 1 A S - 3 1 7 8 E 9 - 3 101 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S- 3 1 7 8 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9- 3 101E 9- 3 161 A S- 3 178E 9- 3 101E 9- 3 161A S- 3 178 E 9- 3 101A S- 3 172E 9- 3 161E 9- 3 101A S- 3 172E 9- 3 161E 9- 3 101A S- 3 172E 9- 3 161 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S- 3 1 7 8 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 A201A201A201A201A201A201A205A206DUCT SOXABDCCEILING FIXTURE LEGENDCEILING MATERIAL LEGENDEXPOSED DECK TO BE REPAINTED, STRUCTURAL STEEL TO BE REPAIRED, SAND BLASTED AND PAINTED. SEE STRUCTURAL FOR REPAIRSGENERAL NOTES: 1. EXISTING STEEL STRUCTURE TO BE REPAIRED PER STRUCTURAL DRAWINGS. 2. EXISTING STEEL STRUCTURE TO BE SANDED AND PAINTED ENTIRELY.3. EXISTING INTERIOR LIGHTING TO REMAIN. 4. LIGHTING SCOPE LIMITED TO EXTERIOR LIGHT FIXTURES MOUNTED TO FACE OF TRUSS FRAMES. 5. VERIFY LOCATIONS OF ALL LIGHT FIXTURES, AIR SLOTS, AIR SUPPLY AND RETURN GRILLES WITH PLANS AND COORDINATE INSTALLATION WITH MECHANICAL AND ELECTRICAL CONTRACTORS. NOTIFY ARCHITECT OF ANY CONFLICTS PRIOR TO INSTALLATION.6. PAINT ALL MECHANICAL SLOTS, GRILLES, OR ACCESS PANELS TO MATCH SURFACE ON WHICH THEY OCCUR, UNLESS OTHERWISE NOTED.7. CONTRACTOR IS TO PROVIDE ALL MISCELLANEOUS MTL STUD FRAMING REQUIRED FOR SOFFITS AND BULKHEADS AS GRAPHICALLY DEPICTED ON THE REFLECTED CEILING PLAN, SECTIONS AND ELEVATIONS.8. PAINT ALL EXPOSED STEEL STRUCTURE AND ALL OTHER EXPOSED SURFACES THAT ARE NOT PREFINISHED OR INTEGRALLY COLORED EXCEPT IN CONCEALED SPACES INCLUDING MECHANICAL ROOMS, JANITOR CLOSETS, AND ELECTRICAL ROOMS.9. PROVIDE CARE AND COORDINATION TO CONCEAL ALL CONDUIT, FIRE PROTECTION PIPING, AND PLUMBING10. ALL LIGHTING IS DEPICTED TO INDICATE LOCATION ONLY, SEE ELECTRICAL FOR FIXTURE SPECIFICATIONS, NOTIFY ARCHITECT OF ANY DISCREPANCIES.11. AT ALL EXPOSED METAL DECK LOCATIONS UTILIZE WEDGE BOLT/NET SYSTEM TO HANG ALL SYSTEMS.THE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONA-201REFLECTED CEILINGPLAN0000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SET3/32" = 1'-0"LEVEL 1 - REFLECTED CEILING PLAN1MILESTONE DATESPECIFIC NOTESTAG NOTEA201 SIDEWALL MOUNTED BIG ASS FAN, ADJUSTABLE PIVOT FAN"A205 SAND AND PAINT ALL EXISTING STEEL"A206 EXISTING CEILING LIGHTING AND FIXTURES TO REMAIN. COVERAND PROTECT WHILE PERFORMING NEW WORK. LEVEL 10"GRADE -ENTRY-2' -0"ABB2B3B5B7B9B11OPT 1 -ROOF PLANNAVD 38' -1 3/4"MEZZANINE LEVELNAVD 17' -3 3/4"2A-412CW-13CW-14CW-12EL06EL02EL04EL04EL01EL12LEVEL 10"11.322.333.344.355.366.377.388.399.31010.3OPT 1 -ROOF PLANNAVD 38' -1 3/4"MEZZANINE LEVELNAVD 17' -3 3/4"2A-410CW-11CW-10CW-09CW-08CW-06CW-05CW-04CW-03CW-07EL02EL07EL01EL02EL06ABDCEL06EL06EL06EL06EL06EL06EL06EL06EL06EL12THE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONA-303EXTERIORELEVATIONS_OPT 10000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SET1/8" = 1'-0"OPT 1 - EAST ELEVATION21/8" = 1'-0"OPT 1 - NORTH ELEVATION3MILESTONE DATESPECIFIC NOTESTAG NOTEEL01 THREE PART STUCCO SYSTEM OVER LATH & WEATHERPROOFINGEL02 TWO PIECE PRE FINISHED ALUMINUM ROOF FASCIA.EL04 TWO PIECE ROOF EDGE FASCIA, PRE-FINISHED.EL06 EXTERIOR LIGHT FIXTUREEL07 ALUMINUM SUNSHADES BY CURTAIN WALL MANUFACTUREREL12 LOUVERED ROOF EQUIPMENT SCREEN WALL, HEIGHT TO BEDETERMINED. LEVEL 10"ABB2B3B5B7B9B11OPT 1 -ROOF PLANNAVD 38' -1 3/4"1A-413CW-02EL07EL08EL06EL02EL10EL12EL12CW-023"6' - 6 1/2"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 6 1/2"3"33' - 10"120' - 3"3"6' - 5"3"13' - 5 1/2"13' - 1"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"7' - 8 3/4"6' - 9 1/2"3' - 9 5/8"1' - 0 3/4"G01G01CW-11CW-10CW-09CW-08CW-06CW-05CW-04CW-03CW-0715' - 0"33' - 10"3"6' - 6 1/2"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 6 1/2"3"3"3"3"3"4' - 6 3/8"4' - 11 3/8"4' - 6 3/8"3"3' - 0 5/8"3"3' - 0 5/8"33' - 10"3"6' - 6 1/2"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 6 1/2"3"3"4' - 6 3/8"3"4' - 11 3/8"3"4' - 6 3/8"3"15' - 0"TYP. DIMS FOR CW-03 - CW-10G01G01G01G01G01G01G01G01G017' - 10 3/4"6' - 9 1/2"CW-13CW-14CW-1233' - 10"3"6' - 6 1/2"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 6 1/2"3"19' - 10 3/8"3"6' - 5"3"6' - 5"3"6' - 0 3/8"3"3"6' - 6 1/2"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 6 1/2"3"33' - 10"3"6' - 0 3/8"3"6' - 5"3"6' - 5"3"19' - 10 3/8"33' - 10"3"6' - 6 1/2"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 6 1/2"3"39' - 5 5/8"3"6' - 0 3/8"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 0 3/8"3"G01G01G01ABDCTHE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONA-304EXTERIORELEVATIONS_OPT 10000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SETSPECIFIC KEYNOTES - ELEVATIONSNUMBERTEXTMILESTONE DATE1/8" = 1'-0"OPT 1 - WEST ELEVATION1SPECIFIC NOTESTAG NOTEEL02 TWO PIECE PRE FINISHED ALUMINUM ROOF FASCIA.EL06 EXTERIOR LIGHT FIXTUREEL07 ALUMINUM SUNSHADES BY CURTAIN WALL MANUFACTUREREL08 CROWN SST-II HYDRAULIC BI-FOLD DOOR SYSTEM.EL10 VENTS FOR NATURAL VENTILATION.EL12 LOUVERED ROOF EQUIPMENT SCREEN WALL, HEIGHT TO BEDETERMINED.G01 1-1/4" INSULATED, IMPACT RESISTANT SAFETY GLAZING.1/8" = 1'-0"OPT 1 - CURTAIN WALL ELEVATION - WEST21/8" = 1'-0"OPT 1 - CURTAIN WALL ELEVATIONS - NORTH41/8" = 1'-0"OPT 1 - CURTAIN WALL ELEVATIONS - EAST3 E9- 3 1 0 1E9- 3 1 6 1 AS- 3 1 78 E9- 3 10 1E9- 3 1 6 1 AS- 3 1 7 8 E9- 3 10 1AS- 3 1 7 2 E9- 3 1 6 1 2A-410A-4104A-4103C03C038' - 6 1/4"1' - 5 1/2"CW-06CW-07PN10WS26WS06A-1023C03WS04WS07WS24WS31WS05WS01WS04LEVEL 10"2A-410CW-06CW-07EL02EL06EL10EL01EL11EL06EL10EL10THE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONA-410EXTERIOR TRUSSPLANS, ELEVATIONS &SECTION_OPT 10000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SETSPECIFIC NOTESTAG NOTEEL01 THREE PART STUCCO SYSTEM OVER LATH & WEATHERPROOFINGEL02 TWO PIECE PRE FINISHED ALUMINUM ROOF FASCIA.EL06 EXTERIOR LIGHT FIXTUREEL10 VENTS FOR NATURAL VENTILATION.EL11 EXISTING MASONRY BASE TO BE CLEANED AND REPOINTED ASNEEDED.PN10 EXISTING BEAM ABOVE.WS01 3 5/8" METAL STUDS FASTENED TO EXISTING TRUSS FRAME @ 16"O.C..WS04 FRAMING CLIP @ EVERY HORIZONTAL HSS MEMEBER OR 24" O.C.VERTICALLY.WS05 THREE PART STUCCO SYSTEM OVER LATH & WEATHERPROOFING,SAND FINISH - PTD.WS06 EXISTING MASONRY WALL BASE TO REMAIN.WS07 FILL CAVITY WITH R-19 INSULATION, TYP.WS24 VENTS FOR NATURAL VENTILATION.WS26 STEEL FRAME TRUSS TO BE SANDBLASTED & REPAINTED, TYP.WS31 5/8" THK WATER RESISTANT GYPSUM BOARD.MILESTONE DATE1/2" = 1'-0"OPT 1 - SECTION @ TRUSS FRAME21/4" = 1'-0"OPT 1 - ENLARGED PLAN @ TRUSS11/2" = 1'-0"OPT 1 - TRUSS NORTH ELEVATION31/2" = 1'-0"OPT 1 - TRUSS SIDE ELEVATION4 E9- 3101 E9- 3161AS- 3178 E9- 3101 E9- 3161 AS- 3178B7B92A-412C0820' - 0"5' - 6"A-4123A-4124PN01CW-14CW-13PN03PN04LEVEL 10"2A-412CW-13CW-14EL0343' - 4 1/8"EL07EL04EL091' - 6"1' - 0"8' - 4 7/8"13' - 3 7/8"EL03EL02EL09WS08WS12WS10WS07WS13WS06WS14WS09C08WS09WS03WS15WS16WS32METAL STUD CHANNELWS28WS27WS35THE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONA-412VENTILATIONTOWERS_OPT 10000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SETSPECIFIC NOTESTAG NOTEEL02 TWO PIECE PRE FINISHED ALUMINUM ROOF FASCIA.EL03 FIBER CEMENT SIDING, PTD.EL04 TWO PIECE ROOF EDGE FASCIA, PRE-FINISHED.EL07 ALUMINUM SUNSHADES BY CURTAIN WALL MANUFACTUREREL09 CNC CUT ALUMINUM STANDOFF BUILDING SIGNAGE, BACKLIT.PN01 FACE OF WALL BELOW.PN03 HVAC LOUVERPN04 EXISTING STEEL TO BE REPAIRED AS NEEDED, SAND & REPAINTWS03 EXISTING STEEL TRUSS TO REMAIN, SEE STRUCTURAL FORSPECIFIED REPAIRS.WS06 EXISTING MASONRY WALL BASE TO REMAIN.WS07 FILL CAVITY WITH R-19 INSULATION, TYP.WS08 CONCRETE FDN BY STRUCTURAL.WS09 HVAC LOUVER BY HVAC.WS10 METAL STUD FRAMING, REFER TO STRUCTURAL.WS12 COMPACTED FILL.WS13 VAPOR BARRIER.WS14 EXISTING STEEL TO BE REPAIRED AS NEEDED, REFER TOSTRUCTURAL, SANDED & PAINTEDWS15 ROOF CRICKET.WS16 REFER TO ROOF PLAN FOR TYPICAL ROOF ASSEMBLY.WS27 8" TUBE STEEL BOX FRAME.WS28 FILL CAVITY WITH BATT INSULATION R-19.WS32 CNC CUT ALUMINUM STANDOFF BUILDING SIGNAGE, BACKLIT.WS35 1/2" SHEATHING, 1" RIGID INSULATION, STUCCO FINISH.MILESTONEDATE1/4" = 1'-0"OPT 1 - ENLARGED PLAN @ MECHANICAL CHASE TOWER13/8" = 1'-0"OPT 1 - HVAC CHASE EAST ELEVATION33/8" = 1'-0"OPT 1 - HVAC CHASE SOUTH ELEVATION43/8" = 1'-0"OPT 1 - WALL SECTION @ HVAC CHASE28" SQUARE STEEL COLUMN @ EACH CORNER E9-3161AS-3172 E9-3162E9-310 4 E9-3161AS-3172 E9-3162E9-310 4 E9-3161AS-3172 E9-316 2 E9-310 4 E9-3161AS-3172 E9-316 2 E9-3104E9-316 2 E9-316 2 AS-3178 E9-3161 E9-3104WS20WS22WS21WS22WS23THE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONA-413WALL SECTIONS_OPT10000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SETMILESTONEDATE1/2" = 1'-0"OPT 1 - TYPICAL CURTAIN WALL SECTION1SPECIFIC NOTESTAG NOTEWS20 IMPACT RATED, INSULATED GLAZING CURTAIN WALL SYSTEM.WS21 ALUMINUM SUNSHADES BY CURTAIN WALL MANUFACTURER.WS22 EXISTING STEEL TO BE REPAIRED AS NEEDED. REFER TOSTRUCTURAL, SAND AND PAINT.WS23 CURTAIN WALL FASTENED TO EXISTING HSS BEAMS, PER CURTAINWALL MANUFACTURER. 11/28/2023 5:04:48 PMLONG CENTER NATATORIUM1501 N BELCHER RD. CLEARWATER FL, 33765OPTION 2 DESIGN CRITERIA ROOF:60 MIL TPO SINGLE PLY MEMBRANEINSULATION:ROOF IS R-20 MIN POLYISO RIGID INSULATIONCURTAIN WALL: YKK - YHC 300 OG IMPACT RESISTANT SYSTEMGLAZING: 1-1/4" INSULATED LOW E GLAZING, IMPACT RESISTANT OPAQUE WALLS: METAL STUD WALLS FIBERGLASS BATT INSULATION R-19 + 1" RIGID INSULATION 5/8" MOISTURE RESISTANT GYPSUM BOARDEXISTING STRUCTURE: REPAIRED AS NEEDED, PER STRUCTURAL. SAND AND PAINT PAINT, COLOR BY ARCHITECT.POOL TRENCH DRAIN: NATURE CORPORATION GMP GRATINGPOOL DECK COATING: ARMORTRAK FLEXIBLE MILITARY GRADE URETHANE COATINGTHE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONA-5023D VIEWS_OPT 20000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SETOPT - 2 3D VIEW -22OPT - 2 3D VIEW -1121MILESTONEDATE THE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONA-503RENDERINGS OPT_20000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SETMILESTONE DATEEXTERIOR RENDER - NORTHINTERIOR RENDER - VIEW 1INTERIOR RENDER - VIEW 2EXTERIOR RENDER - WEST - NORTHEXTERIOR RENDER - EAST E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9- 3 101E 9- 3 161A S- 3 178 E 9- 3 101E 9- 3 161 A S- 3 178 E 9- 3 101A S- 3 172 E 9- 3 161 E 9- 3 101E 9- 3 161 A S- 3 178 E 9- 3 101A S- 3 172 E 9- 3 161 E 9- 3 101E 9- 3 161A S- 3 178E 9- 3 101E 9- 3 161A S- 3 178 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 E 9 - 3 161 A S - 3 1 7 8 E 9- 3 101E 9- 3 161A S- 3 178 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 E 9- 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 A S- 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9- 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1 E 9- 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9- 3 101E 9- 3 161 A S- 3 178 E 9- 3 101E 9- 3 161A S- 3 178 E 9- 3 101E 9- 3 161A S- 3 178 E 9- 3 101E 9- 3 161A S- 3 178 E 9- 3 101E 9- 3 161A S- 3 178E 9- 3 101E 9- 3 161 A S- 3 178 E 9- 3 101E 9- 3 161A S- 3 178 UPUPE 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9- 3 101E 9- 3 161A S- 3 178 E 9- 3 101A S- 3 172E 9- 3 16111.322.333.344.355.366.377.388.399.31010.3ABB2B3B5B7B9B11A-5062A-5061A-50712A-508A-50812A-509A-50912A-5101A-510223' - 4"113' - 8"20' - 11 1/2" V.I.F.20' - 1"39' - 11"20' - 1"COMPETITION POOLTRAINING POOLCW-01CW-15PN06PN06PN10PN10POOL DECK DRAINSSUN DECKPN07PN11PN12PN14PN16PN16PN16PN16NOT IN SCOPECW-02CW-03CW-04CW-06CW-07CW-08CW-09CW-10CW-11CW-12CW-13CW-14CW-15CW-16CW-17CW-18CW-05GENERAL NOTES 1. HATCHED AREA NOT INCLUDED IN SCOPE OF WORK UNLESS OTHERWISE NOTED.2. PROVIDE SUPPORT FOR WALL MOUNTED CABINETS AND PLUMBING FIXTURES. STEEL STUDS SUPPORTING WALL MOUNTED FIXTURES TO BE DOUBLED AT 16 O.C. OR NOT LESS THAN 20 GAUGE PER FBC 2517.5.1.1.3. COMBUSTIBLE MATERIALS IN TYPES I & II CONSTRUCTION TO COMPLY WITH FBC 603.1 (FIRE RETARDANT - TREATED WOOD ) AND 805.1 & 806.14. PROVIDE CEMENTITIOUS BACKER BOARD IN PLACE OF GWB AT ALL LOCATIONS SHOWING CERAMIC OR PORCELAIN TILE FINISH.5. SEE SHEET ID100 - ID10X FOR FINISH PLANS.6. SEE SHEET AX.X FOR PLAN DETAIL CALLOUTS.7. SEE SHEET AX.X FOR PARTITION TYPE DETAILS. PROVIDE ACOUSTICAL BATT INSULATION WHERE INDICATED.8. SEE SHEET AX.X FOR DIMENSION PLANS.9. SEE SHEET AX.X FOR DOOR SCHEDULE.10. SEE ENLARGED PLANS FOR ADDITIONAL WALL TAG INFORMATION.ALIGN1'-0"A.F.F1001XA101A1011Ref1Ref1Ref1Ref1Ref1Ref1Ref1Ref1tNameElevation1A101SIMXXXX 6X6ROOM TAGDOOR TAGSTOREFRONT TAGWALL TAGSPECIALTY EQUIPMENTTAGFLOOR TAGELEMENT TAGSEXTERIOR ELEVATIONINTERIOR ELEVATIONSECTION MARKVIEW CALLOUTLEVEL HEADSPOT ELEVATION MARKVIEW TAGSA1011SIMANNOTATION TAGSALIGNMENT TAGTAG LEGEND ST-XRoom name101XXXSPECIFIC NOTE TAGABDCPLANC04METAL STUD FRAMING @ 16" O.C.1/2" SHEATHING1" RIGID INSULATION5/8" STUCCO FINISH 5/8" WATER RESISTANT GWB, (1) LAYER ON FINISH SIDEPLANC03METAL STUD FRAMING @ 16" O.C.THE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONA-504LEVEL 1 - FLOORPLAN_OPT 20000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SET3/32" = 1'-0"OPT 2 - LEVEL 1 - FLOOR PLAN1SPECIFIC NOTESTAG NOTEPN06 SIDEKICK BIG ASS FAN, PLUG-IN TYPE, PROPELLER STYLE ONWHEELS.PN07 PROVIDE NEW POOL EDGE AND TRENCH DRAIN ASSEMBLY TOMATCH TRAINING POOL.PN10 EXISTING BEAM ABOVE.PN11 SAND AND PAINT DOOR FRAMES.PN12 REMOVE AND REPLACE POOL ACCESSORIES TO REPLACE POOLEDGE.PN14 CROWN SST-II HYDRAULIC BI-FOLD DOOR SYSTEM.PN16 EPOXY DECK COATING THROUGHOUT POOL DECK.MILESTONE DATE GENERAL NOTES 1. ROOFING PRODUCT BASIS-OF-DESIGN: 60 MIL TPO SINGLE PLY MEMBRANE ROOF OR APPROVED EQUAL (COLOR WHITE) RIGID INSULATION BOARD MECHANICALLY FASTENED TO STEEL ROOF DECK. INSULATION TO HAVE AN AVERAGE R-20 @ ALL ROOFS OVER CONDITIONED SPACES. PROVIDE ROOFING COMPONENTS AND MATERIALS APPROVED BY THE ROOFING PRODUCT MANUFACTURER. ASSEMBLE ROOFING COMPONENTS INCLUDING FLASHING, ROOF DRAINS, ETC. PER THE ROOFING PRODUCT MANUFACTURER'S DETAILS AND INSTRUCTIONS SO AS TO QUALIFY FOR, AND RECEIVE A SPECIAL 20-YEAR WEATHER-TIGHTNESS WARRANTY FROM THE MANUFACTURER AS WELL AS A SPECIAL 2-YEAR PROJECT WARRANTY FROM THE ROOFING INSTALLER COVERING ALL COMPONENTS OF THE ROOFING SYSTEM SUCH AS ROOFING, BASE FLASHING, ROOF INSULATION, FASTENERS, COVER BOARDS, ETC. PROVIDE ROOFING FROM A QUALIFIED MANUFACTURER THAT IS FM GLOBAL APPROVED FOR ROOFING SYSTEM IDENTICAL TO THAT USED FOR THIS PROJECT.2. PROVIDE METAL ROOF COPINGS AND PARAPET FASCIAS FABRICATED OF ASTM B209 0.050-INCH ALUMINUM SHEET. COMPLY WITH "THE NRCA ROOFING MANUAL" AND THE SMACNA "ARCHITECTURAL SHEET METAL MANUAL REQUIREMENTS FOR DIMENSIONS AND PROFILES SHOWN UNLESS MORE STRINGENT REQUIREMENTS ARE INDICATED. PROVIDE MANUFACTURER'S 20-YEAR FINISH WARRANTY. SECURE COPINGS TO PARAPETS WITH CONT ALUMINUM CLEATS.3. PROVIDE GALVANIZED STEEL INTERNALLY REINFORCED ROOF-CURB UNITS CAPABLE OF SUPPORTING SUPERIMPOSED LIVE AND DEAD LOADS, INCLUDING EQUIPMENT LOADS, WITH WELDED OR MECHANICALLY FASTENED, NON-SAG SEALED JOINTS AND INTEGRALLY FORMED DECK-MOUNTING FLANGE AT PERIMETER BOTTOM. COORDINATE DIMENSIONS WITH ROUGHING-IN INFORMATION ON SHOP DRAWINGS OF EQUIPMENT TO BE SUPPORTED.4. ROOF DRAIN BASIS-OF-DESIGN: Z125 8 3/8" DIAMETER ROOF DRAIN WITH LOW SILHOUETTE DOME MANUFACTURED BY ZURN INDUSTRIES.5. GENERAL - IT IS THE INTENT OF THE CONTRACT DOCUMENTS TO PROVIDE FOR A COMPLETE AND WEATHERTIGHT INSTALLATION OF ALL ROOF ITEMS, PENETRATIONS, ETC. THE CONTRACTOR SHALL PROVIDE ALL ROOF ACCESSORIES, FLASHING, SEALANT, SCUPPERS, DRAINS, LABOR, MATERIALS, EQUIPMENT, ETC. REQUIRED FOR COMPLETION OF A WEATHERTIGHT ROOF INSTALLATION. FOLLOW ALL RECOMMENDATIONS OF THE NRCA REGARDING INSTALLATION PROCEDURES, UNLESS MORE STRINGENT REQUIREMENTS ARE INDICATED6. SLOPE - ROOF SURFACE SHALL HAVE A MINIMUM SLOPE OF 1/4" PER FOOT IN A PERPENDICULAR DIRECTION FROM THE ROOF EDGE DOWN TOWARD THE ROOF DRAINS AS INDICATED BY THE ARROWS DRAWN ON THE ROOF PLAN. WHERE REQUIRED TO FACILITATE DRAINAGE, PROVIDE VALLEYS, CRICKETS, RIDGES, ETC. OF REQUIRED SLOPE TO PROPERLY DRAIN ALL ROOF SURFACES.7. ROOF DRAINS - COORDINATE LOCATION OF ALL ROOF DRAINS TO AVOID RATED WALLS, BEAMS, COLUMNS, JOISTS, ETC. BELOW.8. PENETRATIONS - PROPERLY FLASH, WATERPROOF, SECURE AND SEAL ALL ITEMS THAT PENETRATE THE ROOF MEMBRANE. DO NOT INSTALL ANY PITCH POCKETS. FOLLOW GUIDELINES OF NRCA CONCERNING FLASHING AND WATERPROOFING ALL ROOF PENETRATIONS. SEE ROOF DETAILS9. ROOF EQUIPMENT - MOUNT ALL ROOF EQUIPMENT ON PREFABRICATED EQUIPMENT SUPPORT CURBS WITH INTEGRAL INSULATION. WHERE EQUIPMENT IS RAISED ABOVE ROOF SURFACE, ALIGN SUPPORTS PARALLEL TO DIRECTION OF WATERFLOW TO FACILITATE DRAINAGE. VERIFY ALL REQUIREMENTS WITH EQUIPMENT AND CURB MANUFACTURERS. WHERE ROOF MEMBRANE EXTENDS BENEATH EQUIPMENT, MOUNT EQUIPMENT ABOVE THE ROOF SURFACE IN ACCORDANCE WITH BUILDING CODE AND NRCA REQUIREMENTS TO ALLOW FOR INSTALLATION OF ALL REQUIRED ROOFING COMPONENTS AND TO ALLOW FOR FUTURE OWNER MAINTENANCE.10. LIGHTNING PROTECTION - REFER TO ELECTRICAL DRAWINGS PROTECTION FOR ALL LIGHTNING PROTECTION. GROUNDING RODS, CABLES, CONNECTIONS, ETC. SHALL BE INSTALLED IN SUCH A MANNER TO PREVENT ANY DAMAGE TO INSTALLED ROOF MEMBRANE. GROUNDING RODS SHALL BE FASTENED TO THE SUBSTRATE ON WHICH THEY ARE MOUNTED. PROVIDE ALL REQUIRED FLASHING, SEALANT, WATERPROOFING, NON-CORROSIVE FASTENERS, ETC. AT EACH LOCATION AND AT MEMBRANE PENETRATION POINTS.2A-4102A-5092A-5101' - 0"121' - 3 3/4"1/4" / 12"1/4" / 12"1/4" / 12"1/4" / 12"RN01RN02RN03HVACEQUIPMENTHVACEQUIPMENTHVACEQUIPMENTHVACEQUIPMENT10' - 8 3/8"RN05RN05225' - 8 1/4"1A-510RN07ABDCRN08EL1220' - 5 3/4"20' - 5 3/4"6' - 3"6' - 3"60 MIL TPO MEMBRANE FULLY ADHEREDHEAT WELD1/2" HIGH DENSITY COVER BOARDPOLYISO RIGID INSULATION (R-20 MIN)EXISTING METAL DECK TO REMAINMEMBRANE LAP PER MANUFACTURER STANDARDSSINGLE PLY ROOF MEMBRANE SYSTEMSOLID BLOCKINGPRE-FINISHED TWO PIECE METAL FASCIA3/8" STEEL BENT PLATESEALANTSTEEL DECK EXTENSION 12 ±1' - 0 1/8"THE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONA-505ROOF PLAN_OPT 20000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SET3/32" = 1'-0"OPT 2 - ROOF PLAN1SPECIFIC NOTESTAG NOTEEL12 LOUVERED ROOF EQUIPMENT SCREEN WALL, HEIGHT TO BEDETERMINED.RN01 60 MIL SINGLE PLY TPO ROOF MEMBRANE.RN02 12" ROOF EXTENSION, REFER TO SECTION DETAIL.RN03 TOP OF TRUSS BELOW.RN05 PHOTOVOLTAIC ARRAY.RN07 PROVIDE STEEL SUPPORT FRAMES FOR DUCT WORK @ 48" O.C.RN08 LOUVERED ROOF EQUIPMENT SCREEN WALL, HEIGHT TO BEDETERMINED.1 1/2" = 1'-0"DETAIL - TYPICAL TPO ROOF ASSEMBLY2MILESTONE DATE1" = 1'-0"TYP. NORTH ROOF EDGE3 LEVEL 10"GRADE -ENTRY-2' -0"ABB2B3B5B7B9B11OPT 1 -ROOF PLANNAVD 38' -1 3/4"MEZZANINE LEVELNAVD 17' -3 3/4"CW-15CW-17CW-182A-509EL06EL02EL04EL04EL01EL12LEVEL 10"11.322.333.344.355.366.377.388.399.31010.3OPT 1 -ROOF PLANNAVD 38' -1 3/4"MEZZANINE LEVELNAVD 17' -3 3/4"CW-06CW-07CW-08CW-09CW-10CW-11CW-12CW-13CW-142A-5081A-510EL02EL01ABDCEL12EL06EL06EL06EL06EL06EL06EL06EL06EL06EL06THE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONA-506EXTERIORELEVATIONS_OPT 20000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SET1/8" = 1'-0"OPT 2 - EAST ELEVATION11/8" = 1'-0"OPT - 2 NORTH ELEVATION2MILESTONE DATESPECIFIC NOTESTAG NOTEEL01 THREE PART STUCCO SYSTEM OVER LATH & WEATHERPROOFINGEL02 TWO PIECE PRE FINISHED ALUMINUM ROOF FASCIA.EL04 TWO PIECE ROOF EDGE FASCIA, PRE-FINISHED.EL06 EXTERIOR LIGHT FIXTUREEL12 LOUVERED ROOF EQUIPMENT SCREEN WALL, HEIGHT TO BEDETERMINED. LEVEL 10"ABB2B3B5B7B9B11OPT 1 -ROOF PLANNAVD 38' -1 3/4"CW-02CW-03CW-04CW-052A-510EL06EL02EL09E103EL10EL12EL12CW-02CW-03CW-04CW-056' - 2"3"3"6' - 5"3"6' - 5"3"20' - 4 1/2"33' - 10"3"6' - 6 1/2"3"6' - 5"3"6' - 5"3"6' - 5"3"3"6' - 5"3"TYP. DIMS FOR CW-03 - CW-04 &CW-16 - CW-173"6' - 5"3"6' - 5"3"6' - 11"13' - 7"3"6' - 6 1/2"3"G01G01G013"6' - 6 1/2"6' - 6 1/2"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 9 1/2"5' - 1 1/4"7' - 8 3/4"6' - 9 1/2"3"6' - 5"3"CW-06CW-07CW-08CW-09CW-10CW-11CW-12CW-13CW-1433' - 10"3"6' - 6 1/2"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 6 1/2"3"3"4' - 7 3/8"3"4' - 7 3/8"TYP. DIMS FOR CW-07, CW-09, CW-11, CW-13, TYP. DIMS FOR CW-06, CW-08, CW-10, CW-12, 33' - 10"3"6' - 6 1/2"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 6 1/2"3"9' - 11 5/8"3"4' - 7 3/8"3"4' - 7 3/8"3"3"1' - 4"G01G01G01G01G01G01G01G01G016' - 9 1/2"7' - 10 3/4"4' - 11 1/4"33' - 10"3"6' - 6 1/2"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 6 1/2"3"3"4' - 5 1/4"3"CW-15CW-18CW-17TYP. DIMS FOR CW-15 & CW-18 33' - 10"3"6' - 6 1/2"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 6 1/2"3"3"6' - 5"3"6' - 4 1/2"3"13' - 6 1/2"G01G01G01G01ABDCTHE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONA-507EXTERIORELEVATIONS_OPT 20000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SET1/8" = 1'-0"OPT 2 - WEST ELEVATION1SPECIFIC NOTESTAG NOTEEL02 TWO PIECE PRE FINISHED ALUMINUM ROOF FASCIA.EL06 EXTERIOR LIGHT FIXTUREEL09 CNC CUT ALUMINUM STANDOFF BUILDING SIGNAGE, BACKLIT.EL10 VENTS FOR NATURAL VENTILATION.EL12 LOUVERED ROOF EQUIPMENT SCREEN WALL, HEIGHT TO BEDETERMINED.G01 1-1/4" INSULATED, IMPACT RESISTANT SAFETY GLAZING.1/8" = 1'-0"OPT 2 - CURTAIN WALL ELEVATION - WEST21/8" = 1'-0"OPT 2 - CURTAIN WALL ELEVATIONS - NORTH41/8" = 1'-0"OPT 2 - CURTAIN WALL ELEVATIONS - EAST3MILESTONE DATE E9- 3 1 0 1 E9- 3 16 1 AS- 31 7 8 E9- 3 1 0 1 E9- 3 16 1 AS- 3 1 78 2A-508A-5084A-50838' - 6 1/4"1' - 5 1/2"C03C03CW-09CW-101A-510C04C04PN10WS26WS06C03WS04WS07A-5053WS24WS31WS05WS01WS04LEVEL 10"2A-508EL02EL06CW-10CW-091A-510EL10EL11EL01EL06EL11EL10THE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONA-508EXTERIOR TRUSSPLANS, ELEVATIONS &SECTION_OPT 20000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SETSPECIFIC NOTESTAG NOTEEL01 THREE PART STUCCO SYSTEM OVER LATH & WEATHERPROOFINGEL02 TWO PIECE PRE FINISHED ALUMINUM ROOF FASCIA.EL06 EXTERIOR LIGHT FIXTUREEL10 VENTS FOR NATURAL VENTILATION.EL11 EXISTING MASONRY BASE TO BE CLEANED AND REPOINTED ASNEEDED.PN10 EXISTING BEAM ABOVE.WS01 3 5/8" METAL STUDS FASTENED TO EXISTING TRUSS FRAME @ 16"O.C..WS04 FRAMING CLIP @ EVERY HORIZONTAL HSS MEMEBER OR 24" O.C.VERTICALLY.WS05 THREE PART STUCCO SYSTEM OVER LATH & WEATHERPROOFING,SAND FINISH - PTD.WS06 EXISTING MASONRY WALL BASE TO REMAIN.WS07 FILL CAVITY WITH R-19 INSULATION, TYP.WS24 VENTS FOR NATURAL VENTILATION.WS26 STEEL FRAME TRUSS TO BE SANDBLASTED & REPAINTED, TYP.WS31 5/8" THK WATER RESISTANT GYPSUM BOARD.1/2" = 1'-0"OPT 2 - SECTION @ TRUSS FRAME21/4" = 1'-0"OPT 2 - ENLARGED PLAN @ TRUSS11/2" = 1'-0"OPT 2 - TRUSS NORTH ELEVATION31/2" = 1'-0"OPT 2 - TRUSS SIDE ELEVATION4MILESTONE DATE B7B92A-509C0820' - 0"5' - 6"PN01PN03PN04A-5093A-5094LEVEL 10"2A-509EL01EL0443' - 4 1/8"CW-18CW-17EL091' - 6"1' - 0"1' - 6"1' - 0"8' - 4 7/8"13' - 3 7/8"EL01EL02EL09WS08WS12WS10WS07WS13WS06WS14WS09C08WS09WS03WS15WS16WS32METAL STUD CHANNELWS28WS27WS35THE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONA-509VENTILATIONTOWERS_OPT 20000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SETSPECIFIC NOTESTAG NOTEEL01 THREE PART STUCCO SYSTEM OVER LATH & WEATHERPROOFINGEL02 TWO PIECE PRE FINISHED ALUMINUM ROOF FASCIA.EL04 TWO PIECE ROOF EDGE FASCIA, PRE-FINISHED.EL09 CNC CUT ALUMINUM STANDOFF BUILDING SIGNAGE, BACKLIT.PN01 FACE OF WALL BELOW.PN03 HVAC LOUVERPN04 EXISTING STEEL TO BE REPAIRED AS NEEDED, SAND & REPAINTWS03 EXISTING STEEL TRUSS TO REMAIN, SEE STRUCTURAL FORSPECIFIED REPAIRS.WS06 EXISTING MASONRY WALL BASE TO REMAIN.WS07 FILL CAVITY WITH R-19 INSULATION, TYP.WS08 CONCRETE FDN BY STRUCTURAL.WS09 HVAC LOUVER BY HVAC.WS10 METAL STUD FRAMING, REFER TO STRUCTURAL.WS12 COMPACTED FILL.WS13 VAPOR BARRIER.WS14 EXISTING STEEL TO BE REPAIRED AS NEEDED, REFER TOSTRUCTURAL, SANDED & PAINTEDWS15 ROOF CRICKET.WS16 REFER TO ROOF PLAN FOR TYPICAL ROOF ASSEMBLY.WS27 8" TUBE STEEL BOX FRAME.WS28 FILL CAVITY WITH BATT INSULATION R-19.WS32 CNC CUT ALUMINUM STANDOFF BUILDING SIGNAGE, BACKLIT.WS35 1/2" SHEATHING, 1" RIGID INSULATION, STUCCO FINISH.1/4" = 1'-0"OPT 2 - ENLARGED PLAN @ MECHANICAL CHASE TOWER13/8" = 1'-0"OPT 2 - HVAC CHASE EAST ELEVATION33/8" = 1'-0"OPT 2 - HVAC CHASE SOUTH ELEVATION43/8" = 1'-0"OPT 2 - WALL SECTION @ HVAC CHASE2MILESTONE DATE8" SQUARE STEEL COLUMN @ EACH CORNER WS22WS223' - 10 1/8"WALL BEYONDNEW CONCRETE SLAB W/ THICKENED EDGEWS32WS29WS29WS31WS28C04C05WS29WS30WS34WS35WS22C03C04WS29WS29WS29WS28WS35THE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONA-510WALL SECTIONS_OPT20000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SET1/2" = 1'-0"OPT 2 - TYPICAL WEST WALL SECTION2SPECIFIC NOTESTAG NOTEWS22 EXISTING STEEL TO BE REPAIRED AS NEEDED. REFER TOSTRUCTURAL, SAND AND PAINT.WS28 FILL CAVITY WITH BATT INSULATION R-19.WS29 METAL STUD BRACING.WS30 METAL STUD FRAMING @ 16" O.C.WS31 5/8" THK WATER RESISTANT GYPSUM BOARD.WS32 CNC CUT ALUMINUM STANDOFF BUILDING SIGNAGE, BACKLIT.WS34 REFER TO FLOOR PLAN FOR POOL DECK COATING.WS35 1/2" SHEATHING, 1" RIGID INSULATION, STUCCO FINISH.MILESTONE DATE1/2" = 1'-0"OPT 2 - TYP NORTH WALL SECTION1 11/29/2023 11:34:32 AMLONG CENTER NATATORIUM1501 N BELCHER RD. CLEARWATER FL, 33765ENCLOSED SUN-DECK THE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONG-106SHEETINDEX_ENCLOSEDSUN-DECK_2B0000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SETMILESTONEDATEDRAWING INDEX ENCLOSED SUN-DECKSHEET #SHEET NAMESD BID PACKAGE01 GENERALG-105COVER_ENCLOSED SUN-DECK_2B●G-106SHEET INDEX_ENCLOSED SUN-DECK_2B06 DEMOAD-101DEMO FLOOR PLAN_ENCLOSED SUN-DECK●07 ARCHITECTURALA-515ENCLOSED SUN-DECK WEST ELEVATION_2B●A-516RENDERINGS ENCLOSED SUN-DECK_2B●A-517LEVEL 1 - FLOOR PLAN_ENCLOSED SUN-DECK_2B●A-518ENCLOSED SUN-DECK ENLARGED PLAN & SECTION_2B● D011D011D011D002D014D014D015D015D013D013D016SUN DECKD020D019GENERAL NOTES -DEMOLITION 1. ALL DIMENSIONS AND CONDITIONS TO BE FIELD VERIFIED BY CONTRACTOR PRIOR TOWORK, NOTIFY ARCHITECT IF CONFLICTS ARE FOUND2. PROTECT ALL AREAS TO REMAIN. G.C. TO REPAIR OR REPLACE ANY ITEM TO REMAIN ORTO BE RELOCATED THAT IS DAMAGED DURING THE WORK. PROVIDE A SEAMLESS,UNDAMAGED APPEARANCE WHEN JOINING NEW TO EXISTING3. REMOVE DASHED PORTION OF EXISTING WALLS, DOORS, WINDOWS, SIDELIGHTS,TRANSOMS, AND FRAMES. PREPARE AREA TO RECEIVE NEW CONSTRUCTION ASSCHEDULED.4. FINISHES - ALL EXISTING FINISHES SHALL REMAIN, UNLESS SCHEDULED FOR NEW.CONTINUE EXISTING FINISHES TO REMAIN INTO NEW EXTENDED AREAS THAT AREADJACENT. PATCH & REPAIR EXISTING TO MATCH NEW. PREPARE SUBSTRATES TORECEIVE NEW FINISHES WHERE SCHEDULED. FINISH ALL PATCHED OR EXTENDEDWALLS TO NEAREST CHANGE OF DIRECTION, WALL TERMINATION, OR INTERSECTION.PHASING - COORDINATE EQUIPMENT DELIVERIES AND INSTALLATION WITH THEPHASING PLAN FOR APPROPRIATE SCHEDULING.5. CONFLICTS - ANY CONFLICT FOUND WITH EXISTING CONDITIONS AND REQUIREMENTSFOR NEW CONSTRUCTION SHALL BE IMMEDIATELY BROUGHT TO THE ATTENTION OFTHE ARCHITECT. IF THE CONFLICT AFFECTS THE PROGRESS OF THE WORK, VERIFYWITH ARCHITECT SOLUTION NECESSARY PRIOR TO PROCEEDING WITH THAT PORTIONOF THE WORK AND IN A TIMELY FASHION SO AS NOT TO DELAY THE WORK.COORDINATE ALL TRADES TO ASCERTAIN NO FURTHER WORK WILL BE IMPACTED BYTHE CONFLICT, OR ITS SOLUTION.ABDCTHE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONAD-101DEMO FLOORPLAN_ENCLOSEDSUN-DECK0000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SET1/8" = 1'-0"DEMOLITION FLOOR PLAN - ENCLOSED SUN DECK1DEMOLITION KEY NOTESTAG NOTED002 DEMOLISH EXISTING DOOR & FRAME ENTIRELY.D011 DEMOLISH GLAZYNG SYSTEM ENTIRELY, STEEL STRUCTURE TO REMAIN.D013 DEMOLISH SUN DECK WALL & ASSOCIATED FOUNDATIONS.D014 DEMOLISH SUN DECK GATE.D015 DEMOLISH SUN DECK FENCE.D016 DEMOLISH KNEE WALL 1' BELOW GRADE.D019 DEMOLISH STRUCTURAL STEEL.D020 DEMOLISH EXISTING SLAB.MILESTONEDATE ABB2B3B5B7B9B111A-518EL07EL12EL10EL01EL02EL12EL08CW-02CW-03CW-04CW-05CW-06WINDOWS TO BE OPERABLEEL07ABDCCW-03CW-04CW-05CW-068' - 0"TYP. DIMS FOR CW-03 - CW-063"3' - 7 1/2"3"3' - 7 1/2"3"18' - 8"3"5' - 7 1/2"3"6' - 5"3"5' - 7 1/2"3"CW-023"6' - 6 1/2"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 6 1/2"3"33' - 10"119' - 1 1/2"3"6' - 0 1/2"3"5' - 8"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"6' - 5"3"12' - 4"3"1' - 0 3/4"3"6' - 5"3"7' - 8 5/8"6' - 9 1/2"THE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONA-515ENCLOSED SUN-DECKWEST ELEVATION_2B0000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SETMILESTONEDATE1/8" = 1'-0"WEST ELEVATION - ENCLOSED SUN-DECK11/8" = 1'-0"NORTH ELEVATION - ENCLOSED SUN-DECK2SPECIFIC NOTESTAG NOTEEL01 THREE PART STUCCO SYSTEM OVER LATH & WEATHERPROOFINGEL02 TWO PIECE PRE FINISHED ALUMINUM ROOF FASCIA.EL07 ALUMINUM SUNSHADES BY CURTAIN WALL MANUFACTUREREL08 CROWN SST-II HYDRAULIC BI-FOLD DOOR SYSTEM.EL10 VENTS FOR NATURAL VENTILATION.EL12 LOUVERED ROOF EQUIPMENT SCREEN WALL, HEIGHT TO BEDETERMINED.1/8" = 1'-0"CURTAIN WALL ELEVATIONS - WEST31/8" = 1'-0"CURTAIN WALL ELEVATIONS - WEST CW-024 THE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONA-516RENDERINGSENCLOSEDSUN-DECK_2B0000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SETMILESTONEDATEINTERIOR RENDER -VIEW 1EXTERIOR RENDER - WEST - NORTH E 9- 31 01E9- 31 61A S- 31 78 E 9- 31 01A S- 31 72E 9- 31 61 E 9- 31 01E 9- 31 61A S- 31 78 E 9- 31 01A S- 31 72E 9- 31 61 E 9- 31 01E 9- 31 61A S- 31 78E 9- 31 01A S- 31 72E 9- 31 61 E 9- 31 01A S- 31 72E 9- 31 61 E 9- 31 01 E 9- 31 61A S- 31 78 E 9- 31 01A S- 31 72E 9- 31 61 E 9- 31 01A S- 31 72E 9- 31 61 E 9 - 3 1 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 31 0 1 E 9 - 3 1 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 E 9 - 31 6 1 A S - 3 1 7 8 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9 - 3 1 0 1 A S - 3 1 7 2 E 9 - 3 1 6 1 E 9- 31 01 E 9- 31 61A S- 31 78 E 9- 31 01A S- 31 72E 9- 31 61 E 9- 31 01A S- 31 72E 9- 31 61 E 9- 31 01 E 9- 31 61A S- 31 78 E 9- 31 01A S- 31 72E 9- 31 61 E 9- 31 01A S- 31 72E 9- 31 61 E 9- 31 01 E 9- 31 61A S- 31 78 E 9- 31 01A S- 31 72E 9- 31 61 E 9- 31 01A S- 31 72E 9- 31 61 E 9- 31 01 E 9- 31 61A S- 31 78 E 9- 31 01 E 9- 31 61A S- 31 78 E 9- 31 01 E 9- 31 61A S- 31 78 E 9- 31 01 E 9- 31 61A S- 31 78 CW-01PN06PN061A-518A-5151ENCLOSED SUN-DECK1624 SFA-5152PN1481' - 8"PN15PN15PN1519' - 6"20' - 4 1/2"CW-02CW-03CW-04CW-05CW-06CW-02A-5153A-5154GENERAL NOTES 1. HATCHED AREA NOT INCLUDED IN SCOPE OF WORK UNLESS OTHERWISE NOTED.2. PROVIDE SUPPORT FOR WALL MOUNTED CABINETS AND PLUMBING FIXTURES. STEELSTUDS SUPPORTING WALL MOUNTED FIXTURES TO BE DOUBLED AT 16 O.C. OR NOT LESSTHAN 20 GAUGE PER FBC 2517.5.1.1.3. COMBUSTIBLE MATERIALS IN TYPES I & II CONSTRUCTION TO COMPLY WITH FBC 603.1(FIRE RETARDANT - TREATED WOOD ) AND 805.1 & 806.14. PROVIDE CEMENTITIOUS BACKER BOARD IN PLACE OF GWB AT ALL LOCATIONS SHOWINGCERAMIC OR PORCELAIN TILE FINISH.5. SEE SHEET ID100 - ID10X FOR FINISH PLANS.6. SEE SHEET AX.X FOR PLAN DETAIL CALLOUTS.7. SEE SHEET AX.X FOR PARTITION TYPE DETAILS. PROVIDE ACOUSTICAL BATT INSULATIONWHERE INDICATED.8. SEE SHEET AX.X FOR DIMENSION PLANS.9. SEE SHEET AX.X FOR DOOR SCHEDULE.10. SEE ENLARGED PLANS FOR ADDITIONAL WALL TAG INFORMATION.ALIGN1'-0"A.F.F1001XA101A1011Ref1Ref1Ref1Ref1Ref1Ref1Ref1Ref1tNameElevation1A101SIMXXXX 6X6ROOM TAGDOOR TAGSTOREFRONT TAGWALL TAGSPECIALTY EQUIPMENTTAGFLOOR TAGELEMENT TAGSEXTERIOR ELEVATIONINTERIOR ELEVATIONSECTION MARKVIEW CALLOUTLEVEL HEADSPOT ELEVATION MARKVIEW TAGSA1011SIMANNOTATION TAGSALIGNMENT TAGTAG LEGEND ST-XRoom name101XXXSPECIFIC NOTE TAG1A-518A-5151A-5152RN09RN091/4" / 12"RN05RN0581' - 8"ABDCTHE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONA-517LEVEL 1 - FLOORPLAN_ENCLOSEDSUN-DECK_2B0000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SET1/8" = 1'-0"ENCLOSED SUN-DECK - FLOOR PLAN1SPECIFIC NOTESTAG NOTEPN06 SIDEKICK BIG ASS FAN, PLUG-IN TYPE, PROPELLER STYLE ONWHEELS.PN14 CROWN SST-II HYDRAULIC BI-FOLD DOOR SYSTEM.PN15 6" SQ STEEL COLUMNS ADJACENT TO THE EXISTING STRUCTURE,ADDITION WOULD BE ITS OWN STRUCTURE.RN05 PHOTOVOLTAIC ARRAY.RN09 ROOF SCUPPER & DOWN SPOUT.MILESTONEDATE1/8" = 1'-0"ENCLOSED SUN-DECK - ROOF PLAN2 E9-3161AS-3172E9-3162E9-3104 AS-317 8 E9-3161 E9-3162E9-31 0 4 E9-3162 AS-3178 E9-3161E9-3104AS-3178 E9-3161 E9-3162E9-310 4 E9-3162 AS-3178 E9-3161E9-3104E9-3161AS-3172E9-3162E9-3104WS20WS23WS22WS25WS22 12' - 0"COLUMN BEYOND3-5/8" METAL STUDS @ 16 O.C.6" SQ STEEL COLUMNWS35WS282' - 0"1' - 4"12"x24" CONCRETE FOUNDATION4" CONCRETE SLAB OVER 15 MIL VAPOR BARRIER10' - 0"8" CMU WALL5/8" CEMENTITIOUS FINISH - PTD12"x24" CONCRETE FOUNDATION PADCEILING SYSTEMTRUSS GIRDER16' - 0"1/4" PER FT SLOPEROOF SCUPPERSINGLE PLY MEMBRANE ROOF, OVER TAPERED INSULATION R-20 MIN, AND 3" METAL DECK2" EXPANSION JOINTSTEEL FRAME (BEYOND)MASONRY WALL BASE (BEYOND)11 7/8"THE ARCHITECT'S COMMON LAW COPYRIGHT AND OTHER PROPERTY RIGHTS ARE HEREBY RESERVED IN THE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS PRODUCED BY THE ARCHITECT. THESE IDEAS, DESIGNS, PLANS, DRAWINGS, AND SPECIFICATIONS SHALL NOT BE REPRODUCED OR CONVEYED IN ANY MANNER NOR ASSIGNED TO ANY THIRD PARTY WITHOUT FIRST OBTAINING THE EXPRESS WRITTEN PERMISSION OF THE ARCHITECT. CONSENT IS HEREBY GRANTED TO GOVERNMENTAL AGENCIES TO REPRODUCE THE CONSTRUCTION DRAWINGS IN COMPLIANCE WITH THE STATE STATUTES. TO THE BEST OF THE ARCHITECT'S OF ENGINEER'S KNOWLEDGE, THE PLANS AND SPECIFICATIONS COMPLY WITH THE APPLICABLE MINIMUM BUILDING CODES AND THE APPLICABLE FIRE SAFETY STANDARDS AS DETERMINED BY THE LOCAL AUTHORITY IN ACCORDANCE WITH CHAPTERS 553 AND 633 OF THE FLORIDA STATUTES.132 Mirror Lake Drive N. Unit 301St. Petersburg, Florida 33701-3214(727) 822-5566www.wjarc.comAR94244©Wannemacher Jensen Architects, Inc.Wannemacher Jensen Architects, Inc.Project numberDISTRIBUTIONPRELIMINARY NOT FOR CONSTRUCTIONA-518ENCLOSED SUN-DECKENLARGED PLAN &SECTION_2B0000LONG CENTER NATATORIUMCITY OF CLEARWATER1501 N BELCHER RD. CLEARWATER FL, 3376510.23.23SCHEMATIC BID SETSPECIFIC NOTESTAG NOTEWS20 IMPACT RATED, INSULATED GLAZING CURTAIN WALL SYSTEM.WS22 EXISTING STEEL TO BE REPAIRED AS NEEDED. REFER TOSTRUCTURAL, SAND AND PAINT.WS23 CURTAIN WALL FASTENED TO EXISTING HSS BEAMS, PER CURTAINWALL MANUFACTURER.WS25 SIDEWALL MOUNTED BIG ASS FAN, ADJUSTABLE PIVOT FAN.WS28 FILL CAVITY WITH BATT INSULATION R-19.WS35 1/2" SHEATHING, 1" RIGID INSULATION, STUCCO FINISH.MILESTONEDATE1/2" = 1'-0"ENCLOSED SUN DECK SECTION1 Project:Long Center Renovations Location:Clearwater, Fl Date:12/19/2023 File Name:Long Center Budget Project #:2023.116 Work Description Qty Unit Lab unit $ Lab Tot Mat unit $ Mat Tot Sub unit $ Sub Tot Total Area Sub Total BUILDING CONSTRUCTION - SCHEMATIC DESIGN BUDGET 01 General Requirements 4,384,486 Contractor General Conditions 1 ls 15.0%0 1324208.4 1324208 1,324,209 Contractor General Liability Insurance 1 ls 2.0%0 203045.3 203045 203,045 Builder's Risk Insurance - By Owner 0 Sub-Contractor Bonds 1 ls 2.5%0 258882.7 258883 258,883 Public Art Allowance - N.I.C. Estimate Contingency 1 ls 5.0%0 1072033.5 1072033 1,072,034 Escalation 1 ls 5.0%0 589618.4 589618 589,618 Permits Allowance 1 ls 1.0%0 123819.9 123820 123,820 Contractor General OH&P 1 ls 6.5%0 812877.4 812877 812,877 02 Existing Conditions 425,369 Asbestos Remediation - N.I.C. Selective Building Demolition Demo storefront 3070dr/hdw 2 ea 0 0 750.0 1500 1,500 Demo storefront 6070dr/hdw 3 ea 0 0 1000.0 3000 3,000 Demo glazing sys 16,071 sf 0 0 15.0 241062 241,062 Demo pool trench drain 500 lf 0 0 100.0 50000 50,000 Pool protection during demo 500 lf 0 0 25.0 12500 12,500 Rem pool accessories 8 ea 0 0 1000.0 8000 8,000 Demo SOG 240 sf 0 0 10.0 2400 2,400 Demo CMU wall 120 sf 0 0 7.5 900 900 Demo roof sys 27,383 sf 0 0 2.5 68457 68,457 Demo roof curb 13 ea 0 0 250.0 3250 3,250 Demo Mech equip 1 ls 0 0 25000.0 25000 25,000 Demo Mech piping 300 lf 0 0 15.0 4500 4,500 Cut-out metal deck 320 sf 0 0 15.0 4800 4,800 03 Concrete 175,000 New pool gutter drain 500 lf 0 0 300.0 150000 150,000 Slab on Grade with mesh - HVAC Chase 10 cy 0 0 2500.0 25000 25,000 04 Masonry 10,000 Patch cmu walls 1 ls 0 0 10000.0 10000 10,000 05 Metals 1,173,053 Page 1 of 4 Project:Long Center Renovations Location:Clearwater, Fl Date:12/19/2023 File Name:Long Center Budget Project #:2023.116 Work Description Qty Unit Lab unit $ Lab Tot Mat unit $ Mat Tot Sub unit $ Sub Tot Total Area Sub Total Sandblast steel structure 37,914 sf 0 0 5.5 208527 208,527 Pool int floor area prot. during sandblasting 26,760 sf 0 0 2.5 66900 66,900 Pool int clg area prot. during sandblasting 26,760 sf 0 0 3.5 93660 93,660 Bldg ext area protection during sandblasting 15,279 sf 0 0 4.5 68756 68,756 Roof extension stl plate/deck 446 lf 0 0 125.0 55750 55,750 Tube steel framing - stl boxes 12 tn 0 0 6500.0 78000 78,000 Tube steel framing - deck openings 5 tn 0 0 6500.0 32500 32,500 Tube steel framing - mech equip 9 tn 0 0 6500.0 60938 60,938 Tube steel posts - roof screen 7 tn 0 0 6500.0 42656 42,656 Tube steel framing - OH door fr 0.67 tn 0 0 6500.0 4367 4,367 Curtainwall attachment to stl fr 1.00 ls 0 0 25000.0 25000 25,000 Structural steel repairs 1 ls 0 0 436000.0 436000 436,000 06 Wood / Plastic / Composites 27,808 Rough Carpentry Work Roof Edge 2x Blocking 3,476 lf 0 0 8.0 27808 27,808 07 Thermal & Moisture Protection 776,850 Insulation walls - Fiberglass 6" R19 10,030 sf 0 0 1.5 15045 15,045 Roof Deck Insulation - Polyiso R20 min 31,050 sf 0 0 6.0 186300 186,300 Gypsum cover bd 1/2"31,050 sf 0 0 2.5 77625 77,625 Tapered insulation bd 31,050 sf 0 0 2.5 77625 77,625 Roofing - Single-ply TPO 31,050 sf 0 0 12.0 372600 372,600 Walkway Pads 600 sf 0 0 5.0 3000 3,000 Metal Flashings Pre-fin 2 piece metal fascia 983 lf 0 0 25.0 24585 24,585 Sealants 26,760 sf 0 0 0.75 20070 20,070 08 Openings 1,701,942 Entrances/Storefronts Alum Storefront doors - 6070 2 ea 0 0 7000.0 14000 14,000 Alum Storefront doors - 3070 2 ea 0 0 5000.0 10000 10,000 Al/Gl Curtainwall - impact rated 11,365 sf 0 0 145.0 1647942 1,647,942 Special Doors Overhead Doors Hydraulic Bi-Fold Door 1 ea 0 0 25000.0 25000 25,000 Access Doors/Panels Louver vents 20 ea 0 0 250.0 5000 5,000 09 Finishes 1,010,808 Page 2 of 4 Project:Long Center Renovations Location:Clearwater, Fl Date:12/19/2023 File Name:Long Center Budget Project #:2023.116 Work Description Qty Unit Lab unit $ Lab Tot Mat unit $ Mat Tot Sub unit $ Sub Tot Total Area Sub Total Exterior Wall Finishes Stucco on framing, Painted 11,372 sf 0 0 18.0 204692 204,692 Ext MS framing at stucco walls 11,372 sf 0 0 15.0 170577 170,577 Interior Finishes Walls Ms 3 5/8"/MR gyp bd 1s 6,452 sf 0 0 12.0 77418 77,418 Floors Porcelain Tile at pool edge 16"771 sf 0 0 15.0 11558 11,558 Epoxy Floor Coating - Pool Deck 11,615 sf 0 0 17.5 203263 203,263 Wall Finishes Porcelain Tile at pool edge 8"369 sf 0 0 15.0 5528 5,528 Paint gyp bd, epoxy 6,452 sf 0 0 2.0 12903 12,903 Ceiling Finishes Epxoy Paint steel framing/metal deck 64,974 sf 0 0 5.0 324870 324,870 10 Specialties 457,650 Exterior Signs Letters - 12" Alum 10 ea 0 0 175.0 1750 1,750 Letters - 18" Alum 10 ea 0 0 250.0 2500 2,500 Misc. Bigass Fans - side mtd.6 ea 0 0 12000.0 72000 72,000 Sun Shades - Alum 1,000 lf 0 0 150.0 150000 150,000 Equip. Screen wall 3,560 sf 0 0 65.0 231400 231,400 11 Equipment 298,000 Pool Equip. - Replace UV system 1 ls 0 0 286000.0 286000 286,000 Pool Equip. - Reinstall accessories 8 ea 0 0 1500.0 12000 12,000 12 Furnishings - By Owner 13 Special Construction 479,375 Enclosed Sundeck Addition 1,625 sf 0 0 295.0 479375 479,375 14 Conveying Systems - None 21 Fire Suppression System - None Page 3 of 4 Project:Long Center Renovations Location:Clearwater, Fl Date:12/19/2023 File Name:Long Center Budget Project #:2023.116 Work Description Qty Unit Lab unit $ Lab Tot Mat unit $ Mat Tot Sub unit $ Sub Tot Total Area Sub Total 22 Plumbing 9,000 Replace roof drains - same location 3 ea 0 0 3000.0 9000 9,000 23 HVAC 1,942,200 Pool Dehumidifier & Fan 2 ea 258600 517,200.0 646500 1,293,000 25000 50,000 1,860,200 Ductwork & support frames 1 ls 2000 2,000.0 5000 5,000 25000 25,000 32,000 Test & Balance 1 ls 0 0 15000 15,000 15,000 Controls 1 ls 0 0 25000 25,000 25,000 HVAC Commissioning 1 ls 0 0 10000 10,000 10,000 26 Electrical 341,000 Photovotaic System - Allowance 1 ls 0 0 300000 300,000 300,000 HVAC power 1 ls 0 0 10000 10,000 10,000 Building sigange power 1 ls 0 0 5000 5,000 5,000 Ext wall lighting 10 ea 0 0 1850 18,500 18,500 Tie into ex panel 1 ls 0 0 7500 7,500 7,500 TOTAL BUILDING CONSTRUCTION PROBABLE COST - Option #1 13,212,542 13,212,542 The above budget does not include the following; Site Work, Civil Work, Utilities Pool Equipment Equipment not specifically listed in the budget Impact Fees Testing & 3rd Party Inspections Design Fees Owner Contingency Builder's Risk Insurance Public Art ALTERNATES Option #2 - (less Al/Gl more soild wall) DEDUCT (330,184) Pool Equipment - New High Rate Sand Filter sys ADD 998,140 Pool Equipment - New Defender Filter sys ADD 1,092,520 Page 4 of 4 CONSTRUCTION COST ESTIMATE Long Center Renovations Schematic Bid Set Estimate Prepared: 12/15/2023 PREPARED BY: 132 MIRROR LAKE DR N, # 301 SAINT PETERSBURG, FL 33701 727.767.9509 WWW.WJCREATE.COM Clearwater Long Center Renovation CONSTRUCTION COST ESTIMATE WJCreate LLC // 132 Mirror Lake Dr N, #301, St. Petersburg, FL 33701 // (727) 767-9512 // info@wjcreate.com Page 2 of 7 CONTENTS 01 BASIS 02 DOCUMENTS 03 NARRATIVE 04 ESTIMATE Clearwater Long Center Renovation CONSTRUCTION COST ESTIMATE WJCreate LLC // 132 Mirror Lake Dr N, #301, St. Petersburg, FL 33701 // (727) 767-9512 // info@wjcreate.com Page 3 of 7 01 BASIS ESTIMATORS APPROACH PRELIMINARY ESTIMATE: When approaching the task of developing a construction cost estimate WJCreate utilizes a variety of industry leading methods, tools, and technologies. We employ a combination of parametric data, assembly and systems costs, along with unit price and square foot calculations to develop a realistic probable cost model for the project’s construction. Due to the limited detail of design documentation, which is typical of a project at this stage, numerous assumptions were made to develop an estimation that would reflect a complete project in line with what is understood to be the design intent. For this estimate our estimating team collaborated with the project design team to provide technical input and fill in gaps where details were lacking or yet to be incorporated into the design documents. In parts of the estimate scopes were fairly well defined and measured to specific details in drawings while others may have been conceptualized by our estimating team. Costs assigned to items are estimated utilizing a combination of our experience with similar work and figures from our internal libraries of historical cost data, and values provided by industry leading resources like R.S. Means and BNI. Supplemental information was obtained by consultants hired by the Architect and their information is included in part of this estimate. ESTIMATOR’S CONTINGENCY While our estimating team takes numerous steps to fill in the gaps in the design documents it is not always possible to foresee every detail. The “Estimators Contingency” included within this estimate is intended to provide safeguard from costs associated with design-related uncertainties that exist at the time the estimate is being provided. The Estimator’s Contingency is based on the level of detail provided by the design documents and the number of assumptions taken by the estimating team. QUALIFICATION: This opinion of probable costs of construction is provided based on company staff experience, qualifications, and best judgment. WJCreate has prepared this estimate in accordance with generally accepted cost estimating practices and standards. WJCreate reserves the right to amend our opinions based upon new and/or differing information discovered. Clearwater Long Center Renovation CONSTRUCTION COST ESTIMATE WJCreate LLC // 132 Mirror Lake Dr N, #301, St. Petersburg, FL 33701 // (727) 767-9512 // info@wjcreate.com Page 4 of 7 02 DOCUMENTS The listed documents below were utilized in the development of the cost estimate provided herein. SHEET # SHEET NAME SD BID PACKAGE 01 GENERAL G-100 COVER_OPT 1 ● G-101 DRAWING LEGEND AND BUILDING DATA ● G-103 SHEET INDEX_OPT 1 06 DEMO AD-301 DEMO FLOOR PLAN ● AD-302 DEMO ROOF PLAN ● AD-303 DEMO EXTERIOR ELEVATIONS ● AD-304 DEMO EXTERIOR ELEVATIONS ● 07 ARCHITECTURAL A-002 3D VIEWS_OPT 1 ● A-003 RENDERINGS OPT_1 ● A-101 LEVEL 1 - FLOOR PLAN_OPT 1 ● A-102 ROOF PLAN_OPT 1 ● A-201 REFLECTED CEILING PLAN ● A-303 EXTERIOR ELEVATIONS_OPT 1 ● A-304 EXTERIOR ELEVATIONS_OPT 1 ● A-410 EXTERIOR TRUSS PLANS, ELEVATIONS & SECTION_OPT 1 ● A-412 VENTILATION TOWERS_OPT 1 ● A-413 WALL SECTIONS_OPT 1 ● A-501 COVER_OPT 2 ● A-502 3D VIEWS_OPT 2 ● A-503 RENDERINGS OPT_2 ● A-504 LEVEL 1 - FLOOR PLAN_OPT 2 ● A-505 ROOF PLAN_OPT 2 ● A-506 EXTERIOR ELEVATIONS_OPT 2 ● A-507 EXTERIOR ELEVATIONS_OPT 2 ● A-508 EXTERIOR TRUSS PLANS, ELEVATIONS & SECTION_OPT 2 ● A-509 VENTILATION TOWERS_OPT 2 ● A-510 WALL SECTIONS_OPT 2 ● Clearwater Long Center Renovation CONSTRUCTION COST ESTIMATE WJCreate LLC // 132 Mirror Lake Dr N, #301, St. Petersburg, FL 33701 // (727) 767-9512 // info@wjcreate.com Page 5 of 7 SUNDECK SHEET # SHEET NAME SD BID PACKAGE 01 GENERAL G-105 COVER_ENCLOSED SUN-DECK_2B ● G-106 SHEET INDEX_ENCLOSED SUN- DECK_2B 06 DEMO AD-101 DEMO FLOOR PLAN_ENCLOSED SUN-DECK ● 07 ARCHITECTURAL A-515 ENCLOSED SUN-DECK WEST ELEVATION_2B ● A-516 RENDERINGS ENCLOSED SUN- DECK_2B ● A-517 LEVEL 1 - FLOOR PLAN_ENCLOSED SUN-DECK_2B ● A-518 ENCLOSED SUN-DECK ENLARGED PLAN & SECTION_2B ● Clearwater Long Center Renovation CONSTRUCTION COST ESTIMATE WJCreate LLC // 132 Mirror Lake Dr N, #301, St. Petersburg, FL 33701 // (727) 767-9512 // info@wjcreate.com Page 6 of 7 03 NARRATIVE The following narrative is intended to provide additional information and clarification for the line items listed within the estimate. GENERAL ITEMS 1. The estimate includes two potential renovations schemes. 2. Cost Model is based upon design documents listed herein. 3. No Structural, Mechanical, Electrical or Plumbing drawings provided. All costs are conceptualized figures based on assembly systems typical of the scope of work. 4. The estimate is based on current market costs at the time the estimate was prepared and work being performed during normal business hours at a typical pace. 5. Estimate does not include amounts associated with the replacement of Pool Equipment. GENERAL EXCLUSIONS The items below are not included in this estimate unless specifically called out as included: 1. Permitting costs or any other municipal fees. 2. Professional design services and engineering service fees. OPTION ONE 01 – GENERAL CONDITIONS: • All general conditions assume an overall 8-month construction timeline. • Project Management assumes (1) Full-time Superintendent and (1) Part-time Project Manager. • All other items typical of a project of this nature. 02 – EXISTING CONDITIONS • Estimate includes all demolition as noted on drawings. • Amount allocated for protection for Pool • Conceptualized demolition items include: o Landscape Demolition. o Demolition of slab for Duct Chase. o Pool Edge demolition for Drain Replacement. o Demolition and removal of existing HVAC equipment. o Demolition and removal of pool equipment. 03 – CONCRETE • Includes cost for foundation of the duct chase and an allowance for misc. concrete and masonry repair. 05 – METALS • No Structural Drawings provided. All amounts provided are conceptualized amounts. • Estimate for Structural Steel Modification components provided by Architect’s Structural Consultant. 07 – THERMAL AND MOISTURE PROTECTIONS • Roof system to be replaced from deck up per drawing specifications. • Insulation and weather barrier systems included is wall assembly costs. • A misc. caulking/waterproofing line item included. 08 – OPENINGS • New Curtain wall system priced as specified by Architect. o Includes YKK (YHC 300 OG) system and 1-5/16" VNE1-53 Insulating Laminated Glazing. o Therma Shade System Included where indicated. Clearwater Long Center Renovation CONSTRUCTION COST ESTIMATE WJCreate LLC // 132 Mirror Lake Dr N, #301, St. Petersburg, FL 33701 // (727) 767-9512 // info@wjcreate.com Page 7 of 7 09 – FINISHES • Metal Truss framing system assembly priced as specified in the drawings. • Allowance included for preparation of existing floors • Sandblasting of existing ceilings included. 22 – PLUMBING • No plumbing drawings provided. All amounts provided are conceptualized amounts. 23 – HVAC • No HVAC drawings provided. All amounts provided are conceptualized amounts. • HVAC Systems costs included per Engineer’s quote. • An Additional line item included for installation of equipment and other necessities. 26 – ELECTRICAL • No Electrical drawings provided. All amounts provided are conceptualized amounts. 35 – WATERWAY & MARINE • Estimate includes pool equipment per Counsilman – Hunsaker Estimate. • An allowance included for miscellaneous pool repair. 48 – ELECTRICAL POWER GENERATION • A conceptualized amount is provided for a photovoltaic array system. These systems vary drastically in cost depending on the system specified. The amount assigned is based on a 171 kW System to occupy the areas indicated on the roof drawings. LONG CENTER RENOVATIONS ESTIMATE OF PROBABLE CONSTRUCTION COST SCHEMATIC BID SET (10/23/23) ESTIMATE PREPARED: 12/15/2023 DIVISION / DESCRIPTION $ % OF TOTAL $/SF $ % OF TOTAL $/SF $ % OF TOTAL $/SF 01 GENERAL REQUIREMENTS 789,527 8%$31 751,546 9%$30 143,138 20%$84 02 EXISTING CONDITIONS 271,997 3%$11 271,997 3%$11 20,825 3%$12 03 CONCRETE 25,400 0%$1 25,400 0%$1 45,048 6%$26 04 MASONRY - 0%$0 - 0%$0 47,824 7%$28 05 METALS 1,015,846 10%$40 1,015,846 12%$40 66,671 9%$39 07 THERMAL AND MOISTURE PROTECTIONS 550,122 5%$22 550,122 6%$22 53,488 8%$31 08 OPENINGS 3,408,110 33%$134 1,507,750 18%$60 114,432 16%$67 09 FINISHES 769,192 7%$30 1,053,363 12%$42 89,147 13%$52 10 SPECIALTIES 32,000 0%$1 32,000 0%$1 - 0%$0 22 PLUMBING 55,179 1%$2 55,179 1%$2 - 0%$0 23 HVAC 1,603,415 16%$63 1,603,415 19%$63 - 0%$0 26 ELECTRICAL 156,100 2%$6 156,100 2%$6 35,100 5%$21 31 EARTHWORK - 0%$0 - 0%$0 11,260 2%$7 32 EXTERIOR IMPROVEMENTS 20,000 0%$1 20,000 0%$1 8,000 1%$5 35 WATERWAY & MARINE 370,852 4%$15 370,852 4%$15 - 0%$0 48 ELECTRICAL POWER GENERATION 468,000 5%$18 468,000 5%$18 - 0%$0 00 PROCUREMENT & CONTRACTING 808,506 8%$32 676,172 8%$27 68,714 10%$40 SUBTOTAL $408 $338 $414 Estimator's Contingency 827,540 8%$33 684,619 8%$27 56,292 8%$33 GRAND TOTAL:$441 $365 $447 Pool Equipment Alternatives UV System Replacements Included in Base Estimate Recirculation Systems Replacement - High Rate Sand Filters (Add)+714,820 Recirculation Systems Replacement - Defeinder Filter System (Add)+829,330 OPTION ONE OPTION TWO 8,557,743$ 9,242,362$ SUN DECK 703,647$ 759,939$ 10,344,246$ 11,171,785$ Page 1 of 9 OPTION 1 LONG CENTER RENOVATIONS MAS ITEM DESCRIPTION UOM COST TOTAL 02. EXISTING CONDITIONS Selective Demolition Doors & Openings D002 3 EA x $198.00 =$594 Glazing Systems D011 15,458 SF x $4.75 =$73,426 Pool Edge Trench Drain D012 494 LF x $22.45 =$11,090 Pool Equipment 1 LSUM x $6,250.00 =$6,250 Pool Specialties D017 1 LSUM x $1,250.00 =$1,250 Roofing Systems Demolition To Deck, Including Curbs & Edge 27,250 SF x $1.48 =$40,194 Minor Site Demolition Exterior Hardscape Selective Demolition D021 1 SF x $2,650.00 =$2,650 Landscaping Demolition 1 LSUM x $4,800.00 =$4,800 Service System Demolition HVAC Systems & Components Demolition All Existing Mechanical Equipment 1 LSUM x $28,250.00 =$28,250 Protection & Controls Scaffolding False Deck in Pool to Ceiling 1 LSUM x $80,000.00 =$80,000 Temporary Protection Misc. Protection for Existing to Remain and WIP 1 LSUM x $8,750.00 =$8,750 Pool Cover Temporary Pool Cover - Poly Tarp 12,820 SF x $1.15 =$14,743 02 SUBTOTAL - EXISTING CONDITIONS $271,997 03. CONCRETE Foundation Systems Concrete Foundations Foundations @ Duct Chase 320 SF x $32.50 =$10,400 Concrete Patching Concrete & Masonry Patching Allowance - Misc. repair of existing walls as needed 1 LSUM x $15,000.00 =$15,000 03 SUBTOTAL - CONCRETE $25,400 05. METALS Structural Steel Systems Existing Systems Modifications Metal Truss Modifciations Estimate Provided by Structural Consultants 1 LSUM x $453,440.00 =$453,440 HVAC RTU Equipment Supports Estimate Provided by Structural Consultants 1 LSUM x $241,620.00 =$241,620 Roofing Modifications Estimate Provided by Structural Consultants 1 LSUM x $51,510.00 =$51,510 HVAC Chase(s)Estimate Provided by Structural Consultants 1 LSUM x $87,326.00 =$87,326 Other Metals Roof Screen Louvered metal screens @ Mech 3,600 SF x $42.50 =$153,000 Metal Louvers Ventilation louvers on truss walls 30 EA x $965.00 =$28,950 05 SUBTOTAL - METALS $1,015,846 07. THERMAL AND MOISTURE PROTECTIONS Roofing Systems Rigid Insulation Polyiso Rigid Insulation 27,690 SF x $8.15 =$225,674 Coverboard 1/2"27,690 SF x $1.45 =$40,151 Membrane 60 Mil Single Ply TPO 27,690 SF x $7.36 =$203,798 Roof Edge Blocking & Metal Flashing 720 LF x $81.25 =$58,500 Waterproofing & Caulking Misc. Waterproofing & Caulking 1 LSUM x $22,000.00 =$22,000 07 SUBTOTAL - WOODS & PLASTICS $550,122 08. OPENINGS Doors Storefront Door System 2 EA x $9,250.00 =$18,500 Bi-Fold Door System 1 EA x $19,250.00 =$19,250 Exterior Glazing Systems Curtain Wall system YKK Curtain Wall System YKK System 11,018 SF x $300.00 =$3,305,400 Awning Systems Therma Shade System @ Curtain Wall 580 LF x $112.00 =$64,960 08 SUBTOTAL - OPENINGS $3,408,110 Page 2 of 9 OPTION 1 LONG CENTER RENOVATIONS MAS ITEM DESCRIPTION UOM COST TOTAL 09. FINISHES Wall Assembly Systems Framing Metal Studs & Clips 10,935 SF x $8.28 =$90,542 Sheathing Exterior Gyp Board 10,935 SF x $6.74 =$73,702 Insulation Batt & Rigid Insulation 4,830 SF x $3.25 =$15,698 Stucco Systems 3 Coat Stucco only Ply inc. VB 10,935 SF x $9.15 =$100,055 Paint Paint on Stucco & Gyp 15,765 SF x $2.15 =$33,895 Gypsum Board 5/8 Moisture Resistant Gyp 4,830 SF x $3.10 =$14,973 Wall Finishes Paint / Epoxy Painting Existing Structural Steel Systems 1 LSUM x $18,748.75 =$18,749 Floor Finishes Floor Preparation Prepare Pool Deck for Epoxy 11,040 SF x $2.15 =$23,736 Epoxy Flooring Systems Pool Deck 11,040 SF x $12.48 =$137,779 Ceiling Finishes Sand Blasting Interior Ceiling 25,200 SF x $4.32 =$108,864 Paint / Epoxy Painting Structural Beams & Deck 25,200 SF x $6.00 =$151,200 09 SUBTOTAL - FINISHES $769,192 10. SPECIALTIES Signage Backlight Marquee Signage Wall Mounted 1 LSUM x $32,000.00 =$32,000 10 SUBTOTAL - SPECIALTIES $32,000 22. PLUMBING Sanitary Specialties Roof Drain Pipe Replace Existing Systems 480 LF x $108.80 =52,224.00$ Roof Drain 3 EA x $985.00 =2,955.00$ 22 SUBTOTAL - PLUMBING $55,179 23. HVAC HVAC Systems HVAC Equipment Per Engineer's Quote 1 lsum x $1,293,000.00 =$1,293,000 HVAC Installation & Other Materials 1 lsum x $310,415.00 =$310,415 23 SUBTOTAL - HVAC SYSTEMS $1,603,415 26. ELECTRICAL Electrical Service & Distribution Electrical Systems Fixtures & Signage Connection - Wiring, Conduit, Etc.1 LSUM x $124,250.00 =$124,250 Lighting & Fixtures Exterior Light Fixtures 10 EA x $1,850.00 =$18,500 Pivot Fans 6 EA x $2,225.00 =$13,350 26 SUBTOTAL - ELECTRICAL SYSTEMS $156,100 32. EXTERIOR IMPROVEMENTS Landscaping & Irrigation Landscaping Landscaping Allowance 1 LSUM x $20,000.00 =$20,000 32 SUBTOTAL - EXTERIOR IMPROVEMENTS $20,000 35. WATERWAY & MARINE Pool Equipment & Specialties Pool Equipment Cost Provided by Pool Consultant 1 LSUM x $286,000.00 =$286,000 Page 3 of 9 OPTION 1 LONG CENTER RENOVATIONS MAS ITEM DESCRIPTION UOM COST TOTAL Pool Edge - Trench Drain Curb Natare Grating 494 LF x $131.28 =$64,852 Pool Repair Pool Repair Allowance 1 LSUM x $20,000.00 =$20,000 35 SUBTOTAL - WATERWAY & MARINE $370,852 48. ELECTRICAL POWER GENERATION Solar Power Generating Systems Photovoltaic Array System 171 kW System 1 LSUM x $468,000.00 =$468,000 48 SUBTOTAL - ELECTRICAL POWER GENERATION $468,000 01. GENERAL REQUIREMENTS Project Management Project Supervision Project Manager(s) Time (1) Project Manager(s)8 MTH x $11,088.00 =$88,704 Assistant Project Manager(s) Time (1) Assistant Project Manager(s)8 MTH x $14,300.00 =$114,400 Project Accountant(s)(1) Project Accountant 8 MTH x $600.00 =$4,800 Software Project Management Software & Cloud Services 8 MTH x $1,850.00 =$14,800 Field Supervision Project Site Superintendent (1) Site Superintendent(s)8 MTH x $16,800.00 =$134,400 Assistant Superintendent (1) Site Assistant Superintendent(s)8 MTH x $14,800.00 =$118,400 Field Office & Supplies Site Office & Equipment Jobsite Trailer & Office Supplies 8 MTH x $2,845.00 =$22,760 Temporary Toilets 8 MTH x $750.00 =$6,000 Field Office Supplies 8 MTH x $215.00 =$1,720 Maintenance & Housekeeping Jobsite Clean-up Temp Labor / Clean-up 8 MTH x $1,750.00 =$14,000 Temporary Controls & Safety Safety Supplies 1 LSUM x $1,200.00 =$1,200 Site Signage 1 LSUM x $2,000.00 =$2,000 Construction Aids, Equipment, & Tools Equipment Rentals 1 LSUM x $10,000.00 =$10,000 Punchlist Allowance 1 LSUM x $3,500.00 $3,500 Trash and Dump Charges Dumpster & Trash Removal Charges 25,340 SF x $0.95 =$24,073 Testing and Quality Control Quality Control Quality Control Manager 1 LSUM x $9,825.00 =$9,825 SUBTOTAL - COST OF WORK $9,316,795 Cascading Costs General Liability Insurance Cost of Work x 1.00%=$93,168 Builder's Risk Insurance Cost of Work x 0.35%=$32,609 Bonds Cost of Work x 1.00%=$93,168 01 SUBTOTAL - GENERAL REQUIREMENTS $789,527 00. PROCUREMENT & CONTRACTING Fees & Overhead Contractor's Fee Cost of Work x 5.00%=$505,316 Construction Contingency Cost of Work x 3.00%=$303,190 00 SUBTOTAL - CONTRACTOR'S FEE & CONTINGENCY $808,506 PROJECT TOTAL $10,344,246 Page 4 of 9 OPTION 2 LONG CENTER RENOVATIONS MAS ITEM DESCRIPTION UOM COST TOTAL 02. EXISTING CONDITIONS Selective Demolition Doors & Openings D002 3 EA x $198.00 =$594 Glazing Systems D011 15,458 SF x $4.75 =$73,426 Pool Edge Trench Drain D012 494 LF x $22.45 =$11,090 Pool Equipment 1 LSUM x $6,250.00 =$6,250 Pool Specialties D017 1 LSUM x $1,250.00 =$1,250 Roofing Systems Demolition To Deck, Including Curbs & Edge 27,250 SF x $1.48 =$40,194 Minor Site Demolition Exterior Hardscape Selective Demolition D021 1 SF x $2,650.00 =$2,650 Landscaping Demolition 1 LSUM x $4,800.00 =$4,800 Service System Demolition HVAC Systems & Components Demolition All Existing Mechanical Equipment 1 LSUM x $28,250.00 =$28,250 Protection & Controls Scaffolding False Deck in Pool to Ceiling 1 LSUM x $80,000.00 =$80,000 Temporary Protection Misc. Protection for Existing to Remain and WIP 1 LSUM x $8,750.00 =$8,750 Pool Cover Temporary Pool Cover - Poly Tarp 12,820 SF x $1.15 =$14,743 02 SUBTOTAL - EXISTING CONDITIONS $271,997 03. CONCRETE Foundation Systems Concrete Foundations Foundations @ Duct Chase 320 SF x $32.50 =$10,400 Concrete Patching Concrete & Masonry Patching Misc. repair of existing walls as needed 1 LSUM x $15,000.00 =$15,000 03 SUBTOTAL - CONCRETE $25,400 05. METALS Structural Steel Systems Existing Systems Modifications Metal Truss Modifciations Estimate Provided by Structural Consultants 1 LSUM x $453,440.00 =$453,440 HVAC RTU Equipment Supports Estimate Provided by Structural Consultants 1 LSUM x $241,620.00 =$241,620 Roofing Modifications Estimate Provided by Structural Consultants 1 LSUM x $51,510.00 =$51,510 HVAC Chase(s)Estimate Provided by Structural Consultants 1 LSUM x $87,326.00 =$87,326 Other Metals Roof Screen Louvered metal screens @ Mech 3,600 SF x $42.50 =$153,000 Metal Louvers Ventilation louvers on truss walls 30 EA x $965.00 =$28,950 05 SUBTOTAL - METALS $1,015,846 07. THERMAL AND MOISTURE PROTECTIONS Roofing Systems Rigid Insulation Polyiso Rigid Insulation 27,690 SF x $8.15 =$225,674 Coverboard 1/2"27,690 SF x $1.45 =$40,151 Membrane 60 Mil Single Ply TPO 27,690 SF x $7.36 =$203,798 Roof Edge Blocking & Metal Flashing 720 LF x $81.25 =$58,500 Waterproofing & Caulking Misc. Waterproofing & Caulking 1 LSUM x $22,000.00 =$22,000 07 SUBTOTAL - WOODS & PLASTICS $550,122 08. OPENINGS Doors Storefront Door System 2 EA x $9,250.00 =$18,500 Bi-Fold Door System 1 EA x $19,250.00 =$19,250 Exterior Glazing Systems Curtain Wall system YKK Curtain Wall System YKK System 4,900 SF x $300.00 =$1,470,000 08 SUBTOTAL - OPENINGS $1,507,750 Page 5 of 9 OPTION 2 LONG CENTER RENOVATIONS MAS ITEM DESCRIPTION UOM COST TOTAL 09. FINISHES Wall Assembly Systems Framing Metal Studs & Clips 17,595 SF x $8.28 =$145,687 Sheathing Exterior Gyp Board 17,595 SF x $6.74 =$118,590 Insulation Batt & Rigid Insulation 11,710 SF x $3.25 =$38,058 Stucco Systems 3 Coat Stucco only Ply inc. VB 17,595 SF x $9.15 =$160,994 Paint Paint on Stucco & Gyp 29,305 SF x $2.15 =$63,006 Gypsum Board 5/8 Moisture Resistant Gyp 11,710 SF x $3.10 =$36,301 Wall Finishes Paint / Epoxy Painting Existing Structural Steel Systems 1 LSUM x $18,748.75 =$18,749 Floor Finishes Floor Preparation Prepare Pool Deck for Epoxy 11,040 SF x $2.15 =$23,736 Epoxy Flooring Systems Pool Deck 11,040 SF x $12.48 =$137,779 Ceiling Finishes Sand Blasting Interior Ceiling 25,200 SF x $4.32 =$108,864 Paint / Epoxy Painting Structural Beams & Deck 25,200 SF x $8.00 =$201,600 09 SUBTOTAL - FINISHES $1,053,363 10. SPECIALTIES Signage Backlight Marquee Signage Wall Mounted 1 LSUM x $32,000.00 =$32,000 10 SUBTOTAL - SPECIALTIES $32,000 22. PLUMBING Sanitary Specialties Roof Drain Pipe Replace Existing Systems 480 LF x $108.80 =52,224.00$ Roof Drain 3 EA x $985.00 =2,955.00$ 22 SUBTOTAL - PLUMBING $55,179 23. HVAC HVAC Systems HVAC Equipment Per Engineer's Quote 1 lsum x $1,293,000.00 =$1,293,000 HVAC Installation & Other Materials 1 lsum x $310,415.00 =$310,415 23 SUBTOTAL - HVAC SYSTEMS $1,603,415 26. ELECTRICAL Electrical Service & Distribution Electrical Systems Fixtures & Signage Connection - Wiring, Breakers, Etc.1 LSUM x $124,250.00 =$124,250 Lighting & Fixtures Exterior Light Fixtures 10 EA x $1,850.00 =$18,500 Pivot Fans 6 EA x $2,225.00 =$13,350 26 SUBTOTAL - ELECTRICAL SYSTEMS $156,100 32. EXTERIOR IMPROVEMENTS Landscaping & Irrigation Landscaping Landscaping Allowance 1 LSUM x $20,000.00 =$20,000 32 SUBTOTAL - EXTERIOR IMPROVEMENTS $20,000 35. WATERWAY & MARINE Pool Equipment & Specialties Pool Equipment Cost Provided by Pool Consultant 1 LSUM x $286,000.00 =$286,000 Pool Edge - Trench Drain Curb Natare Grating - Includes Install 494 LF x $131.28 =$64,852 Page 6 of 9 OPTION 2 LONG CENTER RENOVATIONS MAS ITEM DESCRIPTION UOM COST TOTAL Pool Repair Pool Repair Allowance 1 LSUM x $20,000.00 =$20,000 35 SUBTOTAL - WATERWAY & MARINE $370,852 48. ELECTRICAL POWER GENERATION Solar Power Generating Systems Photovoltaic Array System 171 kW System 1 LSUM x $468,000.00 =$468,000 48 SUBTOTAL - ELECTRICAL POWER GENERATION $468,000 01. GENERAL REQUIREMENTS Project Management Project Supervision Project Manager(s) Time (1) Project Manager(s)8 MTH x $11,088.00 =$88,704 Assistant Project Manager(s) Time (1) Assistant Project Manager(s)8 MTH x $14,300.00 =$114,400 Project Accountant(s)(1) Project Accountant 8 MTH x $600.00 =$4,800 Software Project Management Software & Cloud Services 8 MTH x $1,850.00 =$14,800 Field Supervision Project Site Superintendent (1) Site Superintendent(s)8 MTH x $16,800.00 =$134,400 Assistant Superintendent (1) Site Assistant Superintendent(s)8 MTH x $14,800.00 =$118,400 Field Office & Supplies Site Office & Equipment Jobsite Trailer & Office Supplies 8 MTH x $2,845.00 =$22,760 Temporary Toilets 8 MTH x $750.00 =$6,000 Field Office Supplies 8 MTH x $215.00 =$1,720 Maintenance & Housekeeping Jobsite Clean-up Temp Labor / Clean-up 8 MTH x $1,750.00 =$14,000 Temporary Controls & Safety Safety Supplies 1 LSUM x $1,200.00 =$1,200 Site Signage 1 LSUM x $2,000.00 =$2,000 Construction Aids, Equipment, & Tools Equipment Rentals 1 LSUM x $10,000.00 =$10,000 Punchlist Allowance 1 LSUM x $3,500.00 $3,500 Trash and Dump Charges Dumpster & Trash Removal Charges 25,340 SF x $0.95 =$24,073 Testing and Quality Control Quality Control Quality Control Manager 1 LSUM x $9,825.00 =$9,825 SUBTOTAL - COST OF WORK $7,700,606 Cascading Costs General Liability Insurance Cost of Work x 1.00%=$77,006 Builder's Risk Insurance Cost of Work x 0.35%=$26,952 Bonds Cost of Work x 1.00%=$77,006 01 SUBTOTAL - GENERAL REQUIREMENTS $751,546 00. PROCUREMENT & CONTRACTING Fees & Overhead Contractor's Fee Cost of Work x 5.00%=$422,608 Construction Contingency Cost of Work x 3.00%=$253,565 00 SUBTOTAL - CONTRACTOR'S FEE & CONTINGENCY $676,172 PROJECT TOTAL $8,557,743 Page 7 of 9 SUN DECK LONG CENTER RENOVATIONS MAS ITEM DESCRIPTION UOM COST TOTAL 02. EXISTING CONDITIONS Selective Demolition Foundations 1,700 SF x $6.15 =$10,455 Steel Demolition 1 LSUM x $3,200.00 =$3,200 Fence Demolition 145 LF X $6.00 =$870 Minor Site Demolition Landscaping Demolition 1 LSUM x $1,800.00 =$1,800 Protection & Controls Temporary Protection Misc. Protection for Existing to Remain and WIP 1 LSUM x $4,500.00 =$4,500 02 SUBTOTAL - EXISTING CONDITIONS $20,825 03. CONCRETE Foundation Systems Concrete Foundations Foundations 205 LF x $78.50 =$16,093 Slab on Grade 1,700 SF x $11.15 =$18,955 Concrete Patching Concrete & Masonry Patching Misc. repair of existing walls as needed 1 LSUM x $10,000.00 =$10,000 03 SUBTOTAL - CONCRETE $45,048 04. MASONRY Wall Assembly CMU 1,952 SF x $24.50 =$47,824 04 SUBTOTAL - MASONRY $47,824 05. METALS Structural Steel Systems Steel Joists & Metal Decking 1,700 SF x $21.50 =$36,550 Structural Components Columns & Beams 182 LF x $165.50 =$30,121 05 SUBTOTAL - METALS $66,671 07. THERMAL AND MOISTURE PROTECTIONS Roofing Systems Rigid Insulation Polyiso Rigid Insulation 1,700 SF x $8.15 =$13,855 Coverboard 1/2"1,700 SF x $1.45 =$2,465 Membrane 60 Mil Single Ply TPO 1,700 SF x $7.36 =$12,512 Roof Edge Blocking & Metal Flashing 205 LF x $81.25 =$16,656 Waterproofing & Caulking Misc. Waterproofing & Caulking 1 LSUM x $8,000.00 =$8,000 07 SUBTOTAL - WOODS & PLASTICS $53,488 08. OPENINGS Exterior Glazing Systems Operable Glazing 596 SF x $192.00 =$114,432 08 SUBTOTAL - OPENINGS $114,432 09. FINISHES Wall Assembly Systems Framing Metal Studs & Clips 650 SF x $8.28 =$5,382 Sheathing Exterior Gyp Board 650 SF x $6.74 =$4,381 Insulation Batt & Rigid Insulation 650 SF x $3.25 =$2,113 Stucco Systems 3 Coat Stucco only Ply inc. VB 650 SF x $9.15 =$5,948 Paint Paint on Stucco & Gyp 650 SF x $2.15 =$1,398 Gypsum Board 5/8 Moisture Resistant Gyp 650 SF x $3.10 =$2,015 Page 8 of 9 Wall Finishes Stucco Direct Applied to CMU 2,006 SF x $8.50 =$17,051 Paint 4,012 SF x $2.10 =$8,425 Floor Finishes Epoxy Flooring Systems Continuation of Pool Deck 1,624 SF x $12.48 =$20,268 Ceiling Finishes Acoustical Ceiling System 1,624 SF x $11.50 =$18,676 Paint 1,624 SF x $2.15 =$3,492 09 SUBTOTAL - FINISHES $89,147 26. ELECTRICAL Electrical Service & Distribution Electrical Systems Wiring, Recepticles, Etc.1,624 SF x $12.50 =$20,300 Electrical Fixtures Lighting Fixtures 8 EA x $1,850.00 =$14,800 26 SUBTOTAL - ELECTRICAL SYSTEMS $35,100 31. EARTHWORK Sitework General Building Pad & Grade 1 LSUM x $11,260.00 =$11,260 31 SUBTOTAL - EARTHWORK $11,260 32. EXTERIOR IMPROVEMENTS Landscaping & Irrigation Landscaping Landscaping Allowance 1 LSUM x $8,000.00 =$8,000 32 SUBTOTAL - EXTERIOR IMPROVEMENTS $8,000 01. GENERAL REQUIREMENTS Project Management Project Supervision Project Manager(s) Time (1) Project Manager(s)4 MTH x $8,400.00 =$33,600 Software Project Management Software & Cloud Services 4 MTH x $1,850.00 =$7,400 Field Supervision Project Site Superintendent (1) Site Superintendent(s)4 MTH x $16,800.00 =$67,200 Field Office & Supplies Temporary Toilets 4 MTH x $750.00 =$3,000 Field Office Supplies 4 MTH x $215.00 =$860 Maintenance & Housekeeping Jobsite Clean-up Temp Labor / Clean-up 4 MTH x $1,750.00 =$7,000 Temporary Controls & Safety Safety Supplies 1 LSUM x $1,200.00 =$1,200 Site Signage 1 LSUM x $2,000.00 =$2,000 Construction Aids, Equipment, & Tools Equipment Rentals 1 LSUM x $2,500.00 =$2,500 Punchlist Allowance 1 LSUM x $1,250.00 $1,250 Trash and Dump Charges Dumpster & Trash Removal Charges 3 EA x $850.00 =$2,550 SUBTOTAL - COST OF WORK $620,355 Cascading Costs General Liability Insurance Cost of Work x 1.00%=$6,204 Builder's Risk Insurance Cost of Work x 0.35%=$2,171 Bonds Cost of Work x 1.00%=$6,204 01 SUBTOTAL - GENERAL REQUIREMENTS $143,138 00. PROCUREMENT & CONTRACTING Fees & Overhead Contractor's Fee Cost of Work x 6.00%=$45,810 Construction Contingency Cost of Work x 3.00%=$22,905 00 SUBTOTAL - CONTRACTOR'S FEE & CONTINGENCY $68,714 PROJECT TOTAL $703,647 Page 9 of 9 CITY OF CLEARWATER LONG CENTER NATATORIUM Technical Memorandum Draft Long Center Structure Repairs Phase II Date: December 07, 2023 Prepared for: Wannemacher Jensen Architects, Inc. 1559 Fruitville Road Sarasota, FL 34236 Prepared by: McKim & Creed, Inc. 1365 Hamlet Avenue Clearwater, FL 33756 Firm License No. 29588 McKim & Creed Project No. 09692-0001 City of Clearwater Long Center Natatorium December 2023 Technical Memorandum 06962-0001 ii Contents 1. INTRODUCTION ............................................................................................... 1 1.1 Background .............................................................................................. 1 1.2 Project Goals and Objectives ....................................................................... 3 2. NON-DESTRUCTIVE EVALUATION DATA COLLECTION ............................................ 5 2.1 Testing ..................................................................................................... 5 2.2 Report ..................................................................................................... 5 3. CONCLUSIONS ................................................................................................ 8 APPENDIX A – ULTRASONIC THICKNESS TESTING REPORT ......................................... A City of Clearwater Long Center Natatorium December 2023 Technical Memorandum 06962-0001 iii TABLES Table 2.1– Minimum Measured Thickness and Member Thickness Net Section Loss ....... 6 FIGURES Figure 1.1 - Existing Long Center Site & Complex Layout .......................................... 3 City of Clearwater Long Center Natatorium December 2023 Technical Memorandum 09692-0001 1 1. INTRODUCTION 1.1 Background The City of Clearwater’s Long Center Natatorium (LCN) was originally constructed in 1988 as part of a four building complex providing education, training, and athletic facilities to the local community. The complex consists of an approximate 15.8 acre property located in central Pinellas County on the east side of North Belcher Road, almost midway between NE Coachman Road (Florida state road (SR 590)) and Sunset Point Road (county road 576). The street address is 1501 North Belcher Road in Clearwater, Florida. The record drawings reviewed indicated the LCN as “Building A” for the complex. The four building complex is “L”-shaped with Building A and Building B comprising the north / south oriented leg and Building B, Building C and Building D comprising the east / west oriented leg. Building A is north of Building B. The site and building complex layout is shown below in Figure 1.1. The LCN is primarily a structural steel framed building. Record drawings reviewed indicated the building frames are supported by cast-in-place (c.i.p.) reinforced concrete shallow foundations. The shallow foundations consist of spread footings at the columns and continuous strip footings supporting wall assemblies. The structural steel framing at the LCN consists of roof truss assemblies spanning north / south direction over the approximate 120 foot distance over the Main and Therapeutic pools and their surrounding c.i.p. reinforced concrete pool deck areas. The trusses are comprised of square tube hollow shaped sections (HSS) of various thickness. Steel columns for the LCN consist of wide flange sections at the east and west side walls and vertical truss space frames below the roof trusses, along the north and south walls. These vertical space frame trusses consist of HSS members similar to the roof trusses. The steel framing in the pool area is exposed structural steel with a paint coating system finish. Horizontal beams and girts, in addition to diagonal bracing between the various trusses, consists of HSS square or rectangular members, similar in appearance to the trusses. In November of 2021 McKim & Creed (M&C) contracted with the City of Clearwater to review and recommend specific repairs to interior portions of the existing approximately 33 year old LCN steel structure around the pool area. The city reported to M&C their personnel have observed multiple locations where the existing structural steel and anchor bolts appeared to be exhibiting loss of section due to corrosion. The interior of the pool area is enclosed by the existing roof and glass panels between the steel HSS sections at the north, east and west walls. The interior of this enclosed area of the LCN experiences humidity, thermal differences with the exterior environment and chemical off-gassing from the chlorine in City of Clearwater Long Center Natatorium December 2023 Technical Memorandum 09692-0001 2 the pool. To determine the specific repairs M&C conducted a visual review of the facility to document the existing conditions, utilizing lift equipment to achieve an up-close observation of the steel assemblies, from pool deck elevation to the roof. Upon completion of documenting these existing conditions, M&C provided the city construction drawings detailing recommended repairs. Existing conditions where M&C recommended repairs, in general included the following: 1. Repair areas where the existing coating has peeled, flaked, bubbled, or other and no longer adheres to the surface of the steel. 2. Repair areas where coating exhibited conditions noted in Item No. 1 and surface rust observed. 3. Repair areas where coating exhibited conditions noted in Item No. 1 and rust observed, appeared to extend beyond the surface, into the steel sections and potentially reducing the thickness of the steel. 4. Repair areas where coating exhibited conditions noted in Item No. 1 and rust observed, extended through the surface, leaving a hole in the steel sections. Recommended repairs in general included the following: 1. Remove existing areas of no and /or loose coating system top and base coats. Provide the required surface preparation and install the new repair coating system. 2. Remove existing surface rusted areas observed and provide the required surface preparation cleaning and install the new repair coating system. 3. Remove existing rusted areas observed, weld new plates and / or angles to the existing steel and provide the required surface preparation cleaning and install the new repair coating system. 4. Remove existing surface rust from areas around holes, weld new plates and / or angles to the existing steel and provide the required surface preparation cleaning and install the new repair coating system. After completing the construction drawings M&C worked with the city to prioritize locations requiring immediate repairs and opting to repair remaining areas in a future project. City of Clearwater Long Center Natatorium December 2023 Technical Memorandum 09692-0001 3 Figure 1.1 - Existing Long Center Site & Complex Layout 1.2 Project Goals and Objectives The City of Clearwater has contracted with Wannemacher Jensen Architects (WJA), to provide architectural services to improve the LCN. It is M&C’s understanding WJA’s improvements include, but not limited to the following: 1. Removal of the existing glass panels and installation of a new curtain wall system outside of the existing steel frame. 2. Upgrading the air handling system in the pool area. 3. Implementing Phase II of repairing the LCN interior structural steel locations not addressed in the previous phase. The previous phase by M&C included an onsite up-close visual review of the facility to document the existing conditions reported by the city’s personnel. Documentation from construction administration activities of the initial construction could not be provided by the city. In addition to the site review, M&C’s scope of services included review of existing record drawings from the original construction. However, services excluded from M&C’s site review included the following: 1. Non-destructive testing of existing concrete, steel, or masonry assemblies. 2. Load testing of existing anchor bolt, connection bolt or welded connections to determine capacities. City of Clearwater Long Center Natatorium December 2023 Technical Memorandum 09692-0001 4 3. Testing existing materials for chemical composition or material grades. 4. Load testing to determine existing construction assembly deflections. To assist in implementing the LCN Phase II repairs, in September 2023, M&C subcontracted with WJA to conduct a Non-Destructive Evaluation (NDE), to gather additional data regarding the existing conditions initially reviewed in the previous phase, and potentially document new additional locations recommended for repairs. This Technical Memorandum (TM) is provided to bridge the work conducted for the previous phase repairs project with the new NDE data and develop a summary of updated conclusions and recommendations. This TM will be utilized to help WJA, and M&C achieve the following future project goals: 1. Provide a complete set of Issued For Permit documents addressing the repair locations, the specific repair recommendations, and details for each location, in addition to the finish coating system. 2. Issue full size drawings to the City of Clearwater Building Department. 3. Issue full and half size drawings to the future CMAR to be hired by the City of Clearwater. City of Clearwater Long Center Natatorium December 2023 Technical Memorandum 09692-0001 5 2. NON-DESTRUCTIVE EVALUATION DATA COLLECTION M&C subcontracted with S&ME in September 2023 to material test the existing steel structure. S&ME mobilized to the LCN the second week of October. Testing the structural steel began October 9,2023 and concluded October 13, 2023. 2.1 Testing S&ME utilized the “Long Center Natatorium Structural Frame Repairs” drawings prepared by M&C and dated May 2022, detailing the locations where repairs were recommended, for the City of Clearwater. From these drawings M&C documented approximately 122 steel joints. Focusing on locations where corrosion was visually evident lowered the number of locations testing would occur. Testing the steel involved non-destructive tests (NDT) to determine existing steel thickness at and around the points of corrosion. In general the majority of the locations of corrosion occur at steel connection joints (nodes) between the various, HSS tube to HSS tube, and HSS tube to wide flange column connections. In general testing included the following: 1. The NDT was an ultrasonic thickness test (UTT) procedure. 2. The NDT was performed by personnel certified to conduct Level II UTT. 3. The equipment utilized to conduct the NDT an Olympus, model no. 38DL Plus, ultrasonic thickness gage. facility. 4. The NDT testing procedure included conducting an initial test reading at the joint centerline, followed by additional tests at approximate 4 inch intervals out from the centerline, and concluding at approximately 16 inches maximum from the initial test. 5. Each joint test was documented with an Ultrasonic Examination Thickness Report detailing test information and results. 6. Each joint test location was given the same designation utilized by M&C in the May 2022 drawings. 2.2 Report The Report of UT Thickness Testing of Existing Structural Steel Members Clearwater Long Center Pool by S&ME was November 6, 2023. In general the report includes project information regarding the site, testing services, methods of inspection for the tests, and comments regarding results of data. In addition individual Ultrasonic Examination Thickness Report for each joint tested and pictures from the time onsite City of Clearwater Long Center Natatorium December 2023 Technical Memorandum 09692-0001 6 of the NDT’s are included in the appendices. A summary of the minimum thickness measured at each joint is provided in. Table 2.1 below. Regarding the table below note the following:  Node Mk. No. = Building column grid.  Elevation Mk. No. = Frame level height from bottom of column (5 framing intersects typical). Table 2.1– Minimum Measured Thickness and Member Thickness Net Section Loss Node Mk. No. Elevation Mk. No. Minimum Measured Thickness (inches) Original Member Thickness (inches) Member Thickness Net Loss (inches) B-1-T2 2 0.103 0.25 0.147 B-1.3-T1 1 0.070 0.3125 0.243 B-2-T1 3 0.201 0.25 0.049 B-2.3-T1 2 0.163 0.3125 0.150 B-3-T1 3 0.113 0.25 0.137 B-4-T1 1 0.113 0.3125 0.200 B-4.3-T1 3 0.198 0.3125 0.115 B-5-T1 1 0.118 0.25 0.132 B-5.3-T1 1 0.097 0.3125 0.215 B-6-T1 1 0.239 0.3125 0.074 B-6.3-T1 1 0.234 0.25 0.016 B-7-T1 2 0.167 0.3125 0.146 B-8-T1 1 0.226 0.25 0.024 B-8.3-T1 2 0.211 0.25 0.039 B-9-T1 2 0.117 0.3125 0.196 B-9.3-T1 1 0.221 0.25 0.029 B-10-T1 2 0.208 0.25 0.042 B-10.3-T2 1 0.215 0.25 0.035 B.2-1-T2 1 0.405 0.50 0.095 B.4-1-T2-N 1 0.457 0.50 0.043 B.4-1-T2-S 1 0.376 0.50 0.124 B.4-10.3-T2-N 3 0.491 0.50 0.009 B.4-10.3-T2-S 2 0.478 0.50 0.022 B.5-1-T2-N 1 0.440 0.50 0.060 B.5-1-T2-S 1 0.440 0.50 0.060 B.5-10.3-T2 1 0.458 0.50 0.042 B.7-1-T2-N 1 0.440 0.50 0.060 B.7-1-T2-S 3 0.440 0.50 0.060 B.7-10.3-T2-N 3 0.467 0.50 0.033 B.7-10.3-T2-S 1 0.455 0.50 0.045 B.9-1-T2-N 3 & 4 0.440 0.50 0.060 B.9-1-T2-S 1 0.433 0.50 0.067 City of Clearwater Long Center Natatorium December 2023 Technical Memorandum 09692-0001 7 B.9-10.3-T2-N 1 0.328 0.50 0.172 B.9-10.3-T2-S 2 0.440 0.50 0.060 D-1-T2 2 0.112 0.25 0.130 D1.3-T1 4 0.185 0.25 0.065 D-10-T1 3 0.217 0.25 0.033 D-10.3-T2 2 0.207 0.25 0.043 Based upon the values shown in Table 2.1 net section loss of the steel members varies from less than 1/16” to 1/4" maximum. For areas where corrosion was initially visually observed the design team has additional data to review the repair recommendations from the previous phase. Regarding the NDT report data provided note the following: 1. There were joints that were not tested due to safety access concerns with positioning the lift to access the steel and regarding the height of the joints, existing conduits, utilities and / or signage preventing hindering the vertical lift space. 2. Although the report provides a summary table indicating minimum member thickness measured for a joint assembly at each column, review of the individual Ultrasonic Examination Thickness Report documents for the various joints, indicates there are conditions where a single column has additional connections where the test results indicate section loss for multiple members. 3. The report includes information indicating locations where the extents of existing corrosion have increased in severity. City of Clearwater Long Center Natatorium December 2023 Technical Memorandum 09692-0001 8 3. CONCLUSIONS The information provided in the NDT and obtained for this NDE memorandum confirms section loss of the steel section wall thickness, for various connections observed to be exhibiting signs of corrosion, in the previous phase of the structural repairs. In addition the report data indicates profiles of the section loss from the center of the joints which can be used to assess the Phase II repair recommendations by the following: 1. Knowing the limits and the depth of the section loss allows the design team to be more efficient with the material lengths and widths of the repair plates and angles. 2. Knowing the depth of the section loss can help ensure the design team is providing an adequate design capable of withstanding the expected stresses the sections could be subjected to. Utilizing the Ultrasonic Examination Thickness Report documents, M&C will use the member thickness data to verify the geometry of the connection repairs recommended in the previous phase. Review of the reports has indicated multiple locations where the plate assemblies may have to be revised, or added, to include diagonal bracing or horizontal beam and / or girt sections that were not accounted for due to the condition of the steel at the time of the previous visual observation. The information provided in the NDT did not appear to indicate new areas of corrosion that have developed since the previous phase repairs. However, the NDT did indicate existing locations that have since continued to corrode. Note the following: 1. The most severe existing area of increased corrosion appears to be Node Mk. No. D-1T-2-3. At this location corrosion has progressed to a hole in the HSS tube wall (ref. photo nos. 8 & 9 pgs. 94 & 95 Appendix A). The improvements WJA is planning and designing for the LCN will assist in the future maintenance of this facility for the City of Clearwater, resulting in a more efficient ventilation and air handling system, in addition to extending the structure’s service life. This NDE is a critical component for the design team to extend the structure’s service life, by providing an updated set of Issue For Permit documents. Provision of these documents will assist the design team in moving toward completion of project goals regarding implementing the second phase of structural repairs to the existing steel structure, and issuing repair documents to the city’s Building department and the future construction managing consultant. City of Clearwater Long Center Natatorium December 2023 Technical Memorandum 09692-0001 1 APPENDIX A – ULTRASONIC THICKNESS TESTING REPORT Report of UT Thickness Testing of Existing Structural Steel Members Clearwater Long Center Pool Clearwater, Florida S&ME Project No. 23050318 PREPARED FOR: McKim & Creed, Inc. 1730 Varsity Drive, #500 Raleigh, North Carolina 27606 PREPARED BY: S&ME, Inc. 3201 Spring Forest Road Raleigh, North Carolina 27616 November 6, 2023 S&ME, Inc. | 3201 Spring Forest Road | Raleigh, NC 27616 | p 919.872.2660 | www.smeinc.com November 6, 2023 McKim & Creed, Inc. 1730 Varsity Drive, #500 Raleigh, North Carolina 27606 Attention: Mr. Aubrey Haudricourt, P.E. Reference: Report of UT Thickness Testing of Existing Structural Steel Members Clearwater Long Center Pool Structural Assessment Clearwater, Florida S&ME Project No. 23050318 Dear Mr. Haudricourt: S&ME, Inc. (S&ME) has completed the ultrasonic (UT) thickness testing services of the existing structural steel at the Clearwater Long Center Pool located at 1501 North Belcher Road, Clearwater, Florida. Our services were performed in general accordance with S&ME Proposal No. 23050318 dated April 5, 2023 as authorized by David Ardman, with McKim & Creed, Inc. on September 21, 2023. As noted in our proposal, our testing was limited to areas of the existing structure which were safe to access at the time of our site visit.  PROJECT INFORMATION Our understanding of the project is based on information provided to Mr. Perry Vezina of S&ME by Mr. Aubrey Haudricourt and David Ardman, with McKim & Creed, Inc. through a series of emails and phone conversations between April 4, 2023, and the date of this report. Appended to the emails was the following document:  Structural Frame Repairs, Sheets S0.00 through S1.13 dated May 23,2022 as prepared by McKim & Creed, Inc. We understand that McKim & Creed has performed a visual structural assessment of the existing structural steel at the Clearwater Long Center Pool located at 1501 North Belcher Road, Clearwater, Florida. This assessment identified several structural nodes or joints with visually evident corrosion. We also understand that in order to design repairs for the identified corrosion McKim & Creed requested nondestructive testing be performed to determine the material thickness at and around the corroded structural nodes or joints. McKim & Creed requested S&ME Inc. perform ultrasonic thickness testing of the structural steel members at the joints identified in the attached drawings S1.03-S1.13 (Appendix III). We understand that there are approximately 122 joints requiring testing.  METHODS OF INSPECTION Ultrasonic thickness testing was performed on safely accessible members using an Olympus, model 38DL Plus, ultrasonic thickness gage. Ultrasonic thickness testing was performed by Mr. Larry Jernigan, a certified ultrasonic thickness testing (UTT) level II. UT thickness measurements are annotated on the UTT reports in Appendix I of this Report of UT Thickness Testing of Existing Structural Steel Members Clearwater, Florida S&ME Project No. 23050318 November 6, 2023 2 report. Ultrasonic thickness testing was performed and interpreted in general conformance to ASTM E 797, and S&ME work instruction WI-TP-NDT-UT-02. Each location was tested from the inside of the structure from a scissor lift provided by McKim & Creed. Measurements were taken starting at the center line of the column and the node and radiating outward along the members at approximately 4-inch intervals at each node identified. Testing was limited to areas which were safe to access at the time of our site visit. A scissor lift was used for access to elevated locations during field examination activities. The lift was not able to safely access the entire structure due to conflict with the HVAC ducting support structure.  FINDINGS Ultrasonic thickness measurements were taken at safely accessible steel members identified on Structural Frame Repair sheets supplied by McKim & Creed prior to our testing. Complete thickness information is annotated in Appendix I of this report. The summary table below identifies the minimum thickness measurement recorded of all the members tested at each node. Many of the nodes appear to have been constructed using HSS members of different nominal wall thicknesses. The measurements in red below, and on the thickness data sheets in Appendix I, indicate a measurement > 0.050” below what appears to have been the original nominal thickness of the member based on the other thickness measurements of that particular member. This is for reporting purposes only and assumes the following commercially available HSS member nominal wall thicknesses: • 0.250” • 0.313” • 0.375” • 0.500” Minimum Measured Thickness at Each Node Node Mark Elevation 1 Elevation 2 Elevation 3 Elevation 4 Elevation 5 D-1.3-T1 0.202” NST NST 0.185” NST D-1-T2 0.229” 0.112” 0.205” 0.125” NST B-1-T2 0.137” 0.103” 0.105” NST NSA B-1.3-T1 0.070” 0.123” 0.200” NSA NST B-2-T1 0.218” 0.209” 0.201” NST NST B-2.3-T1 0.254” 0.163” 0.203” NST NST B-3-T1 NST 0.225” 0.113” NSA NSA B-3.3-T1 NST NST NST NSA NSA B-4-T1 0.113” NST 0.213” NSA NST B-4.3-T1 NST 0.222” 0.198” NSA NSA B-5-T1 0.118” 0.123” 0.250” NSA NSA B-5.3-T1 0.097” 0.222” 0.180” NSA NSA B-6-T1 0.114” 0.214” 0.211” NSA NSA B-6.3-T1 0.149” 0.203” 0.222” NSA NSA B-7-T1 0.186” 0.167” 0.201” NSA NSA Report of UT Thickness Testing of Existing Structural Steel Members Clearwater, Florida S&ME Project No. 23050318 November 6, 2023 3 B-7.3-T1 NST NST NST NSA NSA B-8-T1 0.226” NST NST NST NSA B-8.3-T1 0.223” 0.211” 0.223” NSA NSA B-9-T1 0.226” 0.117” 0.121” NSA NSA B-9.3-T1 0.221” 0.222” 0.229” NSA NSA B-10-T1 0.229” 0.208” 0.216” NSA NST B-10.3-T2 0.215” 0.229” 0.227” NSA NSA D-10.3-T2 0.228” 0.207” 0.231” 0.232” NST D-10-T1 0.228” 0.218” 0.217” 0.232” NST B.9-1-T2-S 0.433” 0.451” 0.445” NST NST B.9-1-T2-N 0.450” 0.440” 0.440” NST NST B.7-1-T2-S NST NST 0.440” NST NST B.7-1-T2-N 0.440” 0.452” NST NST NST B.5-1-T2-S 0.440” NST NST NST NST B.5-1-T2-N 0.440” NST NST NST NST B.4-1-T2-S 0.376” NST NST NST NST B.4-1-T2-N 0.457” NST NST NST NST B.2-1-T2-N 0.405” NST 0.440” NST NST B.2-10.3-T2-S NST NST NST NSA NST B.4-10.3-T2-N NST NST 0.491” NST NSA B.4-10.3-T2-S 0.485” 0.478” NST NSA NST B.5-10.3-T2-S 0.458” NST NST NSA NST B.7-10.3-T2-N NST NST 0.467” NST NST B.7-10.3-T2-S 0.455” NST NST NSA NST B.9-10.3-T2-N 0.328” 0.435” NST NST NST B.9-10.3-T2-S 0.443” 0.441” NST 0.229” NST  NST = Node not scheduled for testing.  NSA = Node could not be safely accessed for testing.  SUMMARY Significant material thickness loss due to corrosion appeared to be localized near the junction of the nodes tested. Material thickness readings appeared more consistent with less loss as distance increased from the center of the nodes. Location D-1-T2-3 had complete through wall loss due to corrosion (see images 8 & 9 in Appendix II). Measurements annotated at this node represent readings taken adjacent to the visible through wall loss. Report of UT Thickness Testing of Existing Structural Steel Members Clearwater, Florida S&ME Project No. 23050318 November 6, 2023 4  CLOSING S&ME appreciates the opportunity to be of service to you. If you have any questions regarding the information provided herein, please do not hesitate to contact us. Sincerely, S&ME, Inc. Russell Ogden, ASNT NDT Level III Perry R. Vezina, ASNT NDT Level III NDE Operations Manager NDE/NDT Service Line Leader Report of UT Thickness Testing of Existing Structural Steel Members Clearwater, Florida S&ME Project No. 23050318 November 6, 2023 i Appendices – UT Thickness Data Sheets A B C D E F G H I J K L M N O Aa Bb Cc Dd 0.463"0.464"0.461" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Client Name:McKim & Creed Project #:23050318 Report Date:10-9-23 Project Location:Clearwater, FL Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:bare Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Location: 28"32" 0.467"0.471"0.465" 6"8"12"16"20"24" West side view "1N"B.2-1-T2-1N Center:N/A 0.463"0.467"0.467" 0.405" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-9-23 Technician Name Level/Certification Signature Date surface area. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 4"8" 12" 16" A B C D E Clearwater NDT-UT_B.2-1-T2-1N.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc Dd 0.455"0.456"0.457" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Client Name:McKim & Creed Project #:23050318 Report Date:10-9-23 Project Location:Clearwater, FL Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:bare Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Location: 28"32"4"8"12"16"20"24" West side view "3N"B.2-1-T2-3N Center:N/A 0.440" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-9-23 Technician Name Level/Certification Signature Date surface area. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the D E 4"8" 12" 16" A B C Clearwater NDT-UT_B.2-1-T2-3N.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc Dd Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-9-23 Technician Name Level/Certification Signature Date surface area. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.460" Location: 28"32"4"8"12"16"20"24" "1S" West side view "1N"B.4-1-T2-1N&1S Center:N/A Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:bare Project #:23050318 Report Date:10-9-23 Project Location:Clearwater, FL Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Client Name:McKim & Creed 0.376" 0.460"0.457"0.462" 0.463"0.460"0.461"D E F E D 4"8" 12" 16" A B C 16"12" 8" 4" Clearwater NDT-UT_B.4-1-T2-1N&1S.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-12-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.511"0.511"0.508" 0.485" Location: 28"32"4"8"12"16"20"24" East view "1S" B.4-10.3-T2-1S Center:N/A Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-12-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.497"0.495"0.492" A B C O N F G H I D E F 4"8" 12" 16" A B C Clearwater NDT-UT_B.4-10.3-T2-1S.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-12-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.480" Location: 28"32"4"8"12"16"20"24" East view "2S" B.4-10.3-T2-2S Center:N/A Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-12-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.482"0.481"0.478"A B C O N F G H I D E F 4"8" 12" 16" A B C Clearwater NDT-UT_B.4-10.3-T2-2S.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc 0.491"0.501"0.496" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-12-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Location: 28"32" 0.508"0.502"0.504"0.505" 4"8"12"16"20"24" "3N East view B.4-10.3-T2-3N Center:N/A 0.495" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-12-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the O N F G H I D E F A B C 16"12" 8" 4" Clearwater NDT-UT_B.4-10.3-T2-3N.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc Dd Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-9-23 Technician Name Level/Certification Signature Date surface area. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.460"0.460"0.459 0.444"0.454"0.452"0.449" 0.440" Location: 28"32"4"8"12"16"20"24" "1S" West side view "1N"B.5-1-T2-1N&1S Center:N/A Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:bare Project #:23050318 Report Date:10-9-23 Project Location:Clearwater, FL Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Client Name:McKim & Creed 0.454"0.453"0.454" 0.442"0.440"0.440"D E 4"8" 12" 16" A B C F E D 16"12" 8" 4" Clearwater NDT-UT_B.5-1-T2-1N&1S.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc 0.493"0.487"0.485" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-12-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Location: 28"32"4"8"12"16"20"24" East view "1S" B.5-10.3-T2-1S Center:N/A 0.458"0.460"0.460"0.460" 0.489" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-12-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the O N F G H I D E F A B C 4"8" 12" 16" Clearwater NDT-UT_B.5-10.3-T2-1S.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc Dd Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-9-23 Technician Name Level/Certification Signature Date surface area. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.473"0.462"0.476" 0.440" Location: 28"32"4"8"12"16"20"24" West side view "1N"B.7-1-T2-1N Center:N/A Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name: Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:bare Project #:23050318 Report Date:10-9-23 Project Location:Clearwater, FL Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Client Name:McKim & Creed 0.449"0.454"0.449" D E 4"8" 12" 16" A B C Clearwater NDT-UT_B.7-1-T2-1N.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc Dd 0.467"0.468"0.468" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Client Name:McKim & Creed Project #:23050318 Report Date:10-9-23 Project Location:Clearwater, FL Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:bare Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Location: 28"32"4"8"12"16"20"24" West side view "2N"B.7-1-T2-2N Center:N/A 0.452" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-9-23 Technician Name Level/Certification Signature Date surface area. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the D E 4"8" 12" 16" A B C Clearwater NDT-UT_B.7-1-T2-2N.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc Dd 0.454"0.456"0.455" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Client Name:McKim & Creed Project #:23050318 Report Date:10-9-23 Project Location:Clearwater, FL Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:bare Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Location: 28"32"4"8"12"16"20"24" "3S" West side view B.7-1-T2-3S Center:N/A 0.440" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-9-23 Technician Name Level/Certification Signature Date surface area. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the D E A B C 16"12" 8" 4" Clearwater NDT-UT_B.7-1-T2-3S.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-12-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.460"0.460"0.460"0.460" 0.456" Location: 28"32"4"8"12"16"20"24" East view "1S" B.7-10.3-T2-1S Center:N/A Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-12-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.459"0.455"0.457" O N F G H I D E F 4"8" 12" 16" A B C Clearwater NDT-UT_B.7-10.3-T2-1S.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-12-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.467" Location: 28"32"4"8"12"16"20"24" "3N" East view B.7-10.3-T2-3N Center:N/A Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-12-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.472"0.470"0.468" O N F G H I D E F A B C 16"12" 8" 4" Clearwater NDT-UT_B.7-10.3-T2-3N.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc Dd Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-9-23 Technician Name Level/Certification Signature Date surface area. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.494"0.476"0.486" 0.440"0.458"0.455"0.455" 0.450" Location: 28"32"4"8"12"16"20"24" "1S" West side view "1N"B.9-1-T2-1N&S Center:N/A Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:bare Project #:23050318 Report Date:10-9-23 Project Location:Clearwater, FL Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Client Name:McKim & Creed 0.455"0.452"0.452" 0.433"0.438"0.434"D E 4"8" 12" 16" A B C F E D 16"12" 8" 4" Clearwater NDT-UT_B.9-1-T2-1N&S.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc Dd 0.442"0.445"0.441" 0.463"0.463"0.469" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Client Name:McKim & Creed 0.451" Project #:23050318 Report Date:10-9-23 Project Location:Clearwater, FL Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:bare Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Location: 28"32"4"8"12"16"20"24" "2S" West side view "2N"B.9-1-T2-2N&S Center:N/A 0.440" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-9-23 Technician Name Level/Certification Signature Date surface area. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the D E 4"8" 12" 16" A B C F E D 16"12" 8" 4" Clearwater NDT-UT_B.9-1-T2-2N&S.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc Dd 0.453"0.452"0.453" 0.453"0.453"0.452" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Client Name:McKim & Creed 0.445" Project #:23050318 Report Date:10-9-23 Project Location:Clearwater, FL Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:bare Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Location: 28"32"4"8"12"16"20"24" "3S" West side view "3N"B.9-1-T2-3N&S Center:N/A 0.440" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-9-23 Technician Name Level/Certification Signature Date surface area. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the D E 4"8" 12" 16" A B C F E D 16"12" 8" 4" Clearwater NDT-UT_B.9-1-T2-3N&S.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-13-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.443"0.452"0.453"0.452" 0.464"0.469"0.463"0.460" 0.463" Location: 28"32"4"8"12"16"20"24" "1N" East view "1S" B.9-10.3-T2-1N&1S Center:N/A Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-13-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.328" 0.462"0.464"0.465" 0.454"0.459"0.455" D E O N G H I D E F 4"8" 12" 16" A B C F E D 16"12" 8" 4" Clearwater NDT-UT_B.9-10.3-T2-1N&1S.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-13-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.469"0.470"0.468" 0.447" Location: 28"32"4"8"12"16"20"24" "2N" East view "2S" B.9-10.3-T2-2N&2S Center:N/A Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-13-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.439" 0.464"0.435"0.455" 0.456"0.449"0.441" 0.440"0.442"0.442" 0.464" D E O N G H I D E F 4"8" 12" 16" A B C F E D 16"12" 8" 4" Clearwater NDT-UT_B.9-10.3-T2-2N&2S.xlsx Page __ of ___ A B C D E F G H I J K L Aa Bb Cc Dd Ee Ff 0.236"0.235"0.236" South view Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-13-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.237"0.235" 0.233"0.234"0.234" 0.235"0.235"0.234"0.236" 0.235" 0.234"0.233"0.232"0.233" 0.234"0.229" 0.229" Location: 28"32" 0.232"0.233"0.230"0.229" 4"8"12"16"20"24" East view "4S" B.9-10.3-T2-4S Center:N/A Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-13-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.317" 0.230"0.230"0.231" 0.316"0.316"0.316" D E O N F E D G H I D E F Dd Ee Ff 1 6 " 1 2 " 8 " 4 " 16"12" 8" 4" 4"8" 12" 16"4"8" 12" 16"Clearwater NDT-UT_B.9-10.3-T2-4S.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.362"0.357" 0.070" 0.076" 0.352"0.358"0.360" 0.353"0.345"0.344" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-10-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:bareClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Location: 28"32" 0.366"0.361" 4"8"12"16"20"24" North view B-1.3-T1-1 Center:0.373" 0.357"0.357"0.358"0.361" 0.353" 0.233"0.234"0.234"0.234" 0.239" 0.228"0.231"0.231"0.231" 0.241"0.241" 0.212" 0.237"0.237"0.237" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-10-23 Technician Name Level/Certification Signature Date surface area. *Material was observed to be thin along the E and F face corners at connection joint Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.239"0.237"0.235" 0.352"0.351"0.351" 0.356" 0.234"0.234" 4" 8" 12" 16" 16"12" 8" 4" A B C O N M I H G D E F 16 " 12 " 8 " 4 "16"12" 8" 4"4"8" 12" 16" 16" 12" 8" 4" C Clearwater NDT-UT_B-1.3-T1-1.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-10-23 Technician Name Level/Certification Signature Date surface area. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.123" Location: 28"32"4"8"12"16"20"24" South side view B-1.3-T1-2 Center:N/A Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:bareClient Name:McKim & Creed Project #:23050318 Report Date:10-10-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.343"0.344"0.344"0.346" A B C 4"8" 12" 16" Clearwater NDT-UT_B-1.3-T1-2.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.200"0.341"0.344"0.338" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-10-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:bareClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Location: 28"32"4"8"12"16"20"24" North view B-1.3-T1-3 Center:0.353" 0.225"0.233"0.239"0.231" 0.237"0.236"0.236" 0.235"0.236" 0.232 Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-10-23 Technician Name Level/Certification Signature Date surface area. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.232"0.225"0.222" 0.352"0.351"0.352"0.352" 0.363"0.363 0.234"0.238" 4" 8" 12" 16" 16"12" 8" 4" A B C O N M I H G D E F 16 " 12 " 8 " 4 "16"12" 8" 4"4"8" 12" 16" Clearwater NDT-UT_B-1.3-T1-3.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc Dd 0.237"0.240"0.239" 0.202"0.248"0.242"0.238" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-9-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:bareClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Location: 28"32"4"8"12"16"20"24" North view B-1-T2-1 Center:N/A 0.359"0.365"0.359" 0.238"0.244"0.239" 0.202"0.212"0.205"0.228" 0.239"0.250"0.238" 0.360"0.365"0.367"0.362" 0.273" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-9-23 Technician Name Level/Certification Signature Date surface area. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.463"0.468"0.460" 0.137"0.236"0.239"0.232" West side view 4"8" 12" 16" 16" 12" 8" 4" 16"12" 8" 4" A B C O N M G H I Aa Bb Cc 4"8" 12" 16" 4" 8" 1 2 " 1 6 " 4" 8" 12" 16" Clearwater NDT-UT_B-1-T2-1.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc Dd 0.457"0.457"0.461"0.454"0.467" 0.115"0.238"0.239"0.241" 0.358"0.343" West side view Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-9-23 Technician Name Level/Certification Signature Date surface area. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.366" 0.362"0.368"0.362"0.362" 0.211"0.347 0.348"0.336" 0.355" 0.360" Location: 28"32"4"8"12"16"20"24" North view B-1-T2-2 Center:N/A Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:bareClient Name:McKim & Creed Project #:23050318 Report Date:10-9-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.103" 0.369"0.362"0.365" 0.235"0.237"0.235"4"8" 12" 16" 16" 12" 8" 4" 16"12" 8" 4" A B C O N M G H I Aa Bb Cc 4"8" 12" 16"4" 8" 1 2 " 1 6 " 4" 8" 12" 16" Clearwater NDT-UT_B-1-T2-2.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc Dd 0.455"0.469"0.455" 0.122"0.229"0.186"0.186"0.235" West side view Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-9-23 Technician Name Level/Certification Signature Date surface area. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.329" 0.366"0.357"0.365" 0.105"0.223"0.233"0.225"0.224" 0.231"0.232"0.233" 0.365"0.370"0.362" 0.248"0.252"0.239" Location: 28"32"4"8"12"16"20"24" North view B-1-T2-3 Center:N/A Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:bareClient Name:McKim & Creed Project #:23050318 Report Date:10-9-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.156" 0.263"0.244" 0.125" 0.254"0.252"0.232"0.231" 0.228"0.229"0.229" 0.231"0.237" Aa Bb Cc 4"8" 12" 16" 16" 12" 8" 4" 16"12" 8" 4" A B C O N M G H I Aa Bb Cc 4"8" 12" 16"4" 8" 1 2 " 1 6 " 4" 8" 12" 16" Clearwater NDT-UT_B-1-T2-3.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.267"0.269"0.262" 0.391"0.395"0.392" 0.381"0.379"0.379" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-10-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.269"0.268" 0.255"0.255" 0.266" 0.278" 0.271"0.261"0.259"0.259" 0.268"0.259"0.256"0.260" 0.256"0.254"0.258" 0.385"0.382"0.390" Location: 28"32"4"8"12"16"20"24" South side view B-2.3-T1-1 Center:0.331" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-10-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.389" 0.387"0.376"0.374" 0.382"0.376"0.369" 4" 8" 12" 16" 16"12" 8" 4" A B C O N M I H G D E F 16 " 12 " 8 " 4 "16"12" 8" 4"4"8" 12" 16" 16" 12" 8" 4" C Clearwater NDT-UT_B-2.3-T1-1.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.261"0.267"0.273" 0.370"0.389"0.374"0.375" 0.378"0.383" 0.267"0.270" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-10-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.273"0.264"0.258" 0.274" 0.266"0.265"0.269"0.257" 0.280"0.274" 0.253"0.261"0.264"0.268" 0.258"0.258"0.263" 0.270" 0.377"0.378" 0.393" Location: 28"32"4"8"12"16"20"24" South side view B-2.3-T1-2 Center:0.399" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-10-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.163" 0.379"0.375"0.372" 0.380"0.380"0.379" A B C O N M I H G D E F4" 8" 12" 16" 16"12" 8" 4" A B C I H G 16 " 12 " 8 " 4 "16"12" 8" 4"4"8" 12" 16" 16" 12" 8" 4" C Clearwater NDT-UT_B-2.3-T1-2.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.349"0.346"0.366"0.365" 0.348"0.348"0.349" 0.331 0.330"0.331" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-10-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Location: 28"32"4"8"12"16"20"24" South side view B-2.3-T1-3 Center:0.350" 0.361"0.362"0.347"0.347" 0.350"0.350"0.350" 0.348" 0.213"0.211"0.211"0.220"0.236" 0.232"0.232"0.233"0.223" 0.235"0.235" 0.231"0.237"0.235" 0.203" 0.243"0.242"0.240" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-10-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.249"0.249"0.249" 0.348"0.349"0.348"0.350" 0.236"0.223" 4" 8" 12" 16" 16"12" 8" 4" A B C O N M I H G D E F 16 " 12 " 8 " 4 "16"12" 8" 4"4"8" 12" 16" 16" 12" 8" 4" C Clearwater NDT-UT_B-2.3-T1-3.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.344"0.343"0.357" 0.218"0.231"0.247"0.247" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-10-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.357"0.359" 0.343" 0.349"0.349"0.364"0.364" 0.349"0.349"0.349" 0.237"0.237"0.247"0.247" 0.237"0.235"0.235" 0.219"0.231"0.233"0.233" 0.367" Location: 28"32" 0.356"0.356"0.359"0.359" 4"8"12"16"20"24" North side view B-2-T1-1 Center:0.353" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-10-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.368"0.367"0.367" 0.230"0.230"0.233"4"8" 12" 16"16"12" 8" 4" A B C O N M G H I I H G R Q P 16" 12" 8" 4"4"8" 12" 16"4" 8" 1 2 " 1 6 " 4" 8" 12" 16" C Clearwater NDT-UT_B-2-T1-1.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.342"0.342"0.342" 0.227"0.233"0.231"0.233" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-10-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.346"0.347"0.348"0.346" 0.355"0.355"0.346" 0.342" 0.348"0.348"0.348"0.349" 0.227"0.234"0.236"0.237" 0.236"0.238"0.240" 0.348"0.347"0.341" 0.240"0.243"0.209"0.246" 0.347" Location: 28"32"4"8"12"16"20"24" North view B-2-T1-2 Center:0.349" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name: Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-10-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.225" 0.325"0.349" 0.233"0.249"0.234" I H G4"8" 12" 16"16"12" 8" 4" A B C O N M G H I R Q P 16" 12" 8" 4"4"8" 12" 16"4" 8" 1 2 " 1 6 " 4" 8" 12" 16" Clearwater NDT-UT_B-2-T1-2.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.336"0.340"0.340" 0.214"0.207"0.232"0.230" 0.236" 0.236" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-10-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.350" 0.324"0.327"0.365"0.364" 0.348"0.353"0.355" 0.201"0.232"0.248"0.232" 0.235"0.235"0.236" 0.203"0.236" 0.347" Location: 28"32"4"8"12"16"20"24" South side view B-2-T1-3 Center:0.331" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-10-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.206" 0.349"0.350"0.350" 0.235"0.235"0.235" 0.235"0.238"0.238"I H G 4"8" 12" 16"16"12" 8" 4" A B C O N M G H I R Q P 16" 12" 8" 4"4"8" 12" 16" 4" 8" 1 2 " 1 6 " 4" 8" 12" 16" Clearwater NDT-UT_B-2-T1-3.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.231"0.232"0.233" 0.225" 0.367"0.352"0.352" 0.233"0.233"0.233" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-10-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Location: 28"32" 0.356"0.337"0.370"0.354" 4"8"12"16"20"24" North view B-3-T1-2 Center:352" 0.238"0.238"0.235" 0.353" 0.237"0.233"0.233"0.233" 0.231"0.232"0.232" 0.352"0.366"0.350"0.351" 0.355"0.355"0.354" 0.353"0.356"0.348" 0.342" 0.349"0.351"0.351" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-10-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.351"0.342"0.343" 0.237"0.232"0.232"0.230" 4"8" 12" 16"16"12" 8" 4" A B C O N M G H I R Q P 16" 12" 8" 4"4"8" 12" 16"4" 8" 1 2 " 1 6 " 4" 8" 12" 16" Clearwater NDT-UT_B-3-T1-2.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.236"0.236"0.236" 0.113" 0.368"0.368"0.352" 0.116"0.117"0.234" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-10-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Location: 28"32" 0.355"0.355"0.358" 4"8"12"16"20"24" North view B-3-T1-3 Center:0.352" 0.234"0.234"0.234" 0.368" 0.353" 0.230"0.210"0.225"0.230"0.231" 0.215"0.195"0.199"0.207"0.238"0.238" 0.352"0.352"0.352"0.352" 0.351"0.356"0.355" 0.347"0.355"0.335"0.358" 0.331" 0.347"0.348"0.350" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-10-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.311"0.340"0.347" 0.232"0.233"0.232"0.232" 4"8" 12" 16"16"12" 8" 4" A B C O N M G H I R Q P 16" 12" 8" 4"4"8" 12" 16"4" 8" 1 2 " 1 6 " 4" 8" 12" 16" Clearwater NDT-UT_B-3-T1-3.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.231"0.232"0.232" 0.351"0.351"0.351"0.351" 0.360"0.360"0.357" 0.235"0.234" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-10-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.235"0.233"0.233" 0.233"0.233"0.234" 0.228" 0.229"0.245"0.244"0.230" 0.222"0.248"0.249"0.249" 0.355"0.354"0.355"0.346" 0.352" Location: 28"32" 0.309"0.348"0.334" 4"8"12"16"20"24" North view B-4.3-T1-2 Center:0.353" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-11-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.322" 0.348"0.348"0.348" 0.352"0.350"0.351" 0.325"0.355"0.337" 0.339"0.365"0.350"0.366" 0.348"4" 8" 12" 16" 16"12" 8" 4" A B C O N M I H G D E F 16 " 12 " 8 " 4 "16"12" 8" 4"4"8" 12" 16" 16" 12" 8" 4" C Clearwater NDT-UT_B-4.3-T1-2.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.235"0.235"0.235" 0.351"0.350"0.327"0.351" 0.357"0.359"0.359" 0.238"0.236" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-11-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.238"0.238"0.232" 0.235"0.231"0.234" 0.228" 0.230"0.230"0.230"0.230" 0.231"0.231" 0.198"0.233"0.233"0.232" 0.236"0.236" 0.238" 0.351"0.351"0.352" 0.345"0.336"0.322"0.349" 0.351" Location: 28"32" 0.360"0.357"0.358" 4"8"12"16"20"24" South side view B-4.3-T1-3 Center:0.354" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-11-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.338" 0.357"0.351"0.350" 0.322"0.342"0.357" 0.350"0.352"0.353"4" 8" 12" 16" 16"12" 8" 4" A B C O N M I H G D E F 16 " 12 " 8 " 4 "16"12" 8" 4"4"8" 12" 16" 16" 12" 8" 4" Clearwater NDT-UT_B-4.3-T1-3.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.322"0.334"0.345" 0.231"0.232"0.232"0.232" 0.234"0.237" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-10-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.113" 0.352"0.352"0.352"0.352" 0.355"0.355"0.355" 0.230"0.245"0.245"0.245" 0.240"0.238" 0.236" 0.351"0.351"0.351" 0.243"0.242"0.244" 0.351" Location: 28"32"4"8"12"16"20"24" North view B-4-T1-1 Center:0.352" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-11-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.228" 0.235"0.235" 0.352 0.352"0.351" 0.235"0.249"0.249" 0.234"0.235"0.234" 0.236" 4"8" 12" 16"16"12" 8" 4" A B C O N M G H I R Q P 16" 12" 8" 4"4"8" 12" 1 6" 4" 8" 1 2 " 1 6 " 4" 8" 12" 16" C Clearwater NDT-UT_B-4-T1-1.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.341"0.342"0.343" 0.232"0.231"0.231"0.231" 0.232"0.233" 0.236"0.236" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-11-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.341" 0.330"0.330"0.332"0.333" 0.329"0.338 0.213"0.213"0.233"0.232" 0.231"0.231" 0.229"0.235" 0.351"0.356"0.356" 0.241"0.240"0.241" 0.352" Location: 28"32"4"8"12"16"20"24" North view B-4-T1-3 Center:0.353" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-11-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.240" 0.241"0.241" 0.352"0.352"0.351" 0.233"0.235"0.235" 0.237"0.235"0.234" 0.241"4"8" 12" 16"16"12" 8" 4" A B C O N M G H I R Q P 16" 12" 8" 4"4"8" 12" 16" 4" 8" 1 2 " 1 6 " 4" 8" 12" 16" C Clearwater NDT-UT_B-4-T1-3.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.279"0.272"0.264" 0.374"0.389"0.378"0.376" 0.268"0.258" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-11-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. *Center and E Face was observed to have a thin wall along the its joint, additional readings along the other sides could not be taken due to window framing covering the surfaces. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.286"0.278"0.276" 0.268"0.264"0.263" 0.275" 0.267"0.268"0.268"0.263" 0.267"0.259"0.254"0.260" 0.275"0.264"0.267"0.263" 0.277" 0.398" 0.395" Location: 28"32" 0.383"0.398" 4"8"12"16"20"24" North view B-5.3-T1-1 Center:0.135" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-11-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.097" 0.390"0.386"0.386" 0.377"0.376"0.377" 4" 8" 12" 16" 16"12" 8" 4" A B C O N M I H G D E F 16 " 12 " 8 " 4 "16"12" 8" 4"4"8" 12" 16" 16" 12" 8" 4" Clearwater NDT-UT_B-5.3-T1-1.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.359"0.359"0.360"0.359" 0.320" 0.351"0.348" 0.321"0.359"0.359" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-11-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Location: 28"32"4"8"12"16"20"24" North view B-5.3-T1-2 Center:0.348" 0.351"0.351" 0.358"0.357" 0.351" 0.239"0.226"0.222"0.242" 0.234"0.235"0.235" 0.235"0.235"0.235"0.236" 0.237"0.239" 0.229" 0.234"0.235"0.233"0.234" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-11-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.249"0.247"0.247" 0.354"0.368"0.353" 0.366"0.363"0.362" 4" 8" 12" 16" 16"12" 8" 4" A B C O N M I H G D E F 16 " 12 " 8 " 4 "16"12" 8" 4"4"8" 12" 16" 16" 12" 8" 4" Clearwater NDT-UT_B-5.3-T1-2.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.235"0.235"0.236" 0.338"0.335"0.335"0.335" 0.339"0.337"0.350" 0.236"0.238" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-11-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.236"0.237"0.236" 0.239"0.236"0.237" 0.231" 0.250"0.235"0.234" 0.180"0.207"0.225"0.225" 0.231"0.231"0.231" 0.236" 0.360"0.337"0.324"0.346" 0.356" Location: 28"32"4"8"12"16"20"24" North view B-5.3-T1-3 Center:0.353" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-11-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.342" 0.353"0.355"0.354" 0.344"0.344"0.344" 4" 8" 12" 16" 16"12" 8" 4" A B C O N M I H G D E F 16 " 12 " 8 " 4 "16"12" 8" 4"4"8" 12" 16" 16" 12" 8" 4" Clearwater NDT-UT_B-5.3-T1-3.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.418"0.372"0.365"0.371"0.373" 0.288"0.260"0.262"0.262" 0.264" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-11-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.378"0.374"0.378" 0.405"0.399"0.371"0.376" 0.420" 0.349"0.352"0.351"0.326" 0.253"0.267"0.257"0.267" 0.263" 0.352"0.354"0.356" 0.278"0.288"0.287" 0.349" Location: 28"32" 0.355"0.355"0.435" 4"8"12"16"20"24" North view B-5-T1-1 Center:0.350" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-11-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.118" 0.267" 0.348"0.347"0.347" 0.270"0.279"0.269"0.273" 0.274"0.260" 0.269"4"8" 12" 16"16"12" 8" 4" A B C O N M G H I R Q P 16" 12" 8" 4"4"8" 12" 16" 4" 8" 1 2 " 1 6 " 4" 8" 12" 16" C Clearwater NDT-UT_B-5-T1-1.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.263"0.269" 0.254" 0.247" 0.257"0.254" 0.387"0.385"0.376"0.378" 0.253"0.253" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-11-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Location: 28"32" 0.365"0.385"0.388"0.390" 4"8"12"16"20"24" North view B-5-T1-2 Center:0.123" 0.262"0.266"0.260"0.266" 0.365" 0.155"0.274"0.276"0.268" 0.269"0.278"0.275" 0.381"0.388"0.364"0.346"0.371" 0.395"0.398"0.392"0386" 0.373" 0.395"0.383"0.386" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-11-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.373"0.374"0.369" 0.273"0.268"0.261"0.264" 4"8" 12" 16"16"12" 8" 4" A B C O N M G H I R Q P 16" 12" 8" 4"4"8" 12" 16"4" 8" 1 2 " 1 6 " 4" 8" 12" 16" C Clearwater NDT-UT_B-5-T1-2.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.285"0.273" 0.269" 0.393"0.381"0.376"0.380" 0.272"0.267"0.266" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-11-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Location: 28"32" 0.392"0.404" 4"8"12"16"20"24" North view B-5-T1-3 Center:0.390" 0.404"0.404"0.405" 0.274"0.273" 0.391" 0.389 0.269"0.272"0.265"0.258" 0.280"0.264"0.257" 0.380"0.386"0.365"0.385"0.384" 0.357"0.390"0.371"0.396" 0.389"0.388" 0.377"0.398"0.379"0.379" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-11-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.379"0.378"0.379"0.371" 0.277"0.285"0.266"0.273"0.271" 0.260"0.250"0.269" 0.265"0.266" 4"8" 12" 16"16"12" 8" 4" A B C O N M G H I R Q P 16" 12" 8" 4"4"8" 12" 16" 4" 8" 1 2 " 1 6 " 4" 8" 12" 16" C Clearwater NDT-UT_B-5-T1-3.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.340"0.341" 0.320"0.350" 0.339" 0.318"0.312" 0.353"0.353"0.353" 0.344"0.345"0.345" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-11-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Location: 28"32" 0.357"0.357"0.354" 4"8"12"16"20"24" North view B-6.3-T1-1 Center:0.149" 0.354"0.355" 0.355" 0.251"0.235"0.235"0.235" 0.241"0.241"0.239"0.234" 0.234"0.236"0.235"0.235" 0.238"0.237"0.237" 0.243"0.242"0.241" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-11-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.236"0.238"0.237"0.232"0.234" 0.354"0.354"0.354"0.354" 4" 8" 12" 16" 16"12" 8" 4" A B C O N M I H G D E F 16 " 12 " 8 " 4 "16"12" 8" 4"4"8" 12" 16" 16" 12" 8" 4" C Clearwater NDT-UT_B-6.3-T1-1.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.359"0.358"0.358"0.358" 0.317"0.328"0.322" 0.343" 0.318"0.320"0.319" 0.355"0.354"0.354" 0.346"0.345"0.341" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-11-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Location: 28"32" 0.358" 4"8"12"16"20"24" North view B-6.3-T1-2 Center:0.356" 0.357"0.360"0.359"0.358" 0.355" 0.230"0.230"0.230"0.231" 0.232"0.231"0.234" 0.231" 0.203"0.246"0.245"0.249" 0.238"0.240"0.242"0.241" 0.242"0.240"0.242"0.241" 0.231"0.235" 0.228" 0.238"0.235"0.236"0.233" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-11-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.225"0.233"0.233" 0.355"0.355"0.355"0.354" 0.231"0.233" 4" 8" 12" 16" 16"12" 8" 4" A B C O N M I H G D E F 16 " 12 " 8 " 4 "16"12" 8" 4"4"8" 12" 16" 16" 12" 8" 4" C Clearwater NDT-UT_B-6.3-T1-2.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.335"0.327"0.357"0.350" 0.322" 0.355"0.354"0.354" 0.342"0.340"0.341" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-11-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Location: 28"32" 0.359" 4"8"12"16"20"24" North view B-6.3-T1-3 Center:0.254" 0.357"0.357"0.357" 0.355" 0.222"0.224"0.227"0.226" 0.223"0.234"0.231" 0.234"0.234"0.234"0.234" 0.234"0.234"0.235" 0.229" 0.236"0.234"0.235" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-11-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.234"0.234"0.234" 0.355"0.354"0.354"0.354" 0.357"0.357"0.357" 4" 8" 12" 16" 16"12" 8" 4" A B C O N M I H G D E F 16 " 12 " 8 " 4 "16"12" 8" 4"4"8" 12" 16" 16" 12" 8" 4" C Clearwater NDT-UT_B-6.3-T1-3.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.239"0.239" 0.220" 0.354"0.354"0.355" 0.225"0.225"0.227"0.226" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-11-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Location: 28"32"4"8"12"16"20"24" North view B-6-T1-1 Center:0.114" 0.358"0.353"0.337"0.363" 0.227"0.223"0.233" 0.355" 0.233"0.233"0.234"0.236" 0.236"0.240" 0.237"0.238" 0.353"0.353"0.354"0.354" 0.335"0.320"0.327" 0.354"0.345"0.349"0.348" 0.239" 0.335"0.336"0.334"0.352" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-11-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.336"0.346"0.346" 0.235"0.235"0.235"0.235" 0.240"0.238" I H G 4"8" 12" 16"16"12" 8" 4" A B C O N M G H I R Q P 16" 12" 8" 4"4"8" 12" 16"4" 8" 1 2 " 1 6 " 4" 8" 12" 16" C Clearwater NDT-UT_B-6-T1-1.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.342"0.342"0.342" 0.231"0.231"0.231"0.231" 0.231"0.231"0.232" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-11-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0353"0.355"0.353" 0.340" 0.353"0.352"0.353"0.352" 0.340"0.349"0.349" 0.236"0.234"0.234"0.239" 0.240"0.236"0.239" 0.334" Location: 28"32" 0.353"0.354"0.359"0.358" 4"8"12"16"20"24" North view B-6-T1-2 Center:0.333" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-11-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.214" 0.234"0.234" 0.329"0.333"0.335" 0.234"0.234"0.234" 0.237"0.236"0.238" 0.233" I H G 4"8" 12" 16"16"12" 8" 4" A B C O N M G H I R Q P 16" 12" 8" 4"4"8" 12" 16" 4" 8" 1 2 " 1 6 " 4" 8" 12" 16" C Clearwater NDT-UT_B-6-T1-2.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.343"0.343"0.343" 0.232"0.232"0.233"0.233" 0.232"0.231"0.231" 0.236"0.236" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-11-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.359"0.357"0.359" 0.330" 0.353"0.354"0.354"0.354" 0.355"0.357" 0.211"0.234"0.234"0.234" 0.236"0.240"0.239" 0.236" 0.358"0.359"0.357" 0.225"0.227"0.227" 0.353" Location: 28"32"4"8"12"16"20"24" North view B-6-T1-3 Center:0.352" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-11-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.232" 0.233" 0.355"0.354"0.354" 0.233"0.233"0.233" 0.239"0.238"0.239"I H G 4"8" 12" 16"16"12" 8" 4" A B C O N M G H I R Q P 16" 12" 8" 4"4"8" 12" 16"4" 8" 1 2 " 1 6 " 4" 8" 12" 16" C Clearwater NDT-UT_B-6-T1-3.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.232"0.233"0.234" 0.242" 0.186" 0.246"0.241" 0.354"0.353"0.353" 0.231"0.233"0.233" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-11-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Location: 28"32" 0.359"0.359"0.359" 4"8"12"16"20"24" North view B-7-T1-1 Center:0.364" 0.358" 0.347" 0.236"0.235"0.235"0.235" 0.236"0.236" 0.354"0.356"0.353"0.353" 0.357"0.357"0.356" 0.350"0.348"0.333"0.344" 0.336" 0.346" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-11-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.322"0.344"0.344" 0.229"0.219"0.222"0.233" 0.232" 0.236"0.236" I H G 4"8" 12" 16"16"12" 8" 4" A B C O N M G H I R Q P 16" 12" 8" 4"4"8" 12" 16" 4" 8" 1 2 " 1 6 " 4" 8" 12" 16" C Clearwater NDT-UT_B-7-T1-1.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.235"0.234"0.234" 0.239" 0.213" 0.240"0.242" 0.330"0.328"0.353"0.354" 0.234"0.234"0.234" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-11-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Location: 28"32"4"8"12"16"20"24" North view B-7-T1-2 Center:0.331" 0.357"0.359" 0.243"0.242" 0.329" 0.233"0.237"0.238"0.241" 0.232"0.237"0.236" 0.241"0.240" 0.354"0.353"0.353"0.353" 0.356"0.356"0.356" 0.354"0.358"0.357" 0.167" 0.346" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-11-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.344 0.344"0.343" 0.227"0.230"0.230"0.230" 0.231"0.232"0.231" 0.240"0.240" I H G 4"8" 12" 16"16"12" 8" 4" A B C O N M G H I R Q P 16" 12" 8" 4"4"8" 12" 16"4" 8" 1 2 " 1 6 " 4" 8" 12" 16" C Clearwater NDT-UT_B-7-T1-2.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.238"0.236" 0.232" 0.201" 0.230" 0.355"0.354"0.354" 0.226"0.226"0.226" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-11-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Location: 28"32" 0.360"0.360"0.360" 4"8"12"16"20"24" North view B-7-T1-3 Center:0.331" 0.358"0.358"0.358" 0.229"0.228"0.229" 0.355" 0.226"0.234"0.234"0.234" 0.238"0.237" 0.354"0.354"0.354"0.353" 0.357"0.330"0.329" 0.325"0.327"0.325" 0.334" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-11-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.340"0.341"0.342" 0.230"0.233"0.233"0.233" 0.240"0.240"0.242" 0.237"0.238" I H G 4"8" 12" 16"16"12" 8" 4" A B C O N M G H I R Q P 16" 12" 8" 4"4"8" 12" 16"4" 8" 1 2 " 1 6 " 4" 8" 12" 16" C Clearwater NDT-UT_B-7-T1-3.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.341"0.344"0.344" 0.223"0.233"0.233"0.233" 0.244"0.234"0.234" 0.239"0.240" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-12-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.358"0.358"0.342"0.342" 0.352"0.347"0.354"0.354" 0.343" 0.353"0.354"0.354"0.354" 0.230"0.231"0.230"0.230" 0.238" 0.363"0.362"0.363"0.363" 0.240"0.247"0.246" 0.353" Location: 28"32"4"8"12"16"20"24" North view B-8.3-T1-1 Center:0.353" Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-12-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.232" 0.353"0.353"0.355" 0.232"0.233"0.233" R Q P 4" 8" 12" 16" 16"12" 8" 4" A B C O N M I H G D E F 16 " 12 " 8 " 4 "16"12" 8" 4"4"8" 12" 16" 16" 12" 8" 4" Clearwater NDT-UT_B-8.3-T1-1.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.228"0.229"0.222"0.232"0.232" 0.351"0.352"0.351"0.352" 0.356"0.357"0.357"0.356" 0.234"0.234" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-12-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.242"0.242"0.240" 0.238"0.238"0.238" 0.211" 0.234"0.233"0.233"0.233" 0.233"0.232"0.233"0.233" 0.236"0.238"0.238" 0.353"0.352"0.353"0.353" 0.351" Location: 28"32"4"8"12"16"20"24" North view B-8.3-T1-2 Center:0.351" Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-12-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.300" 0.350"0.350"0.351" 0.341"0.342"0.343" R Q P 4" 8" 12" 16" 16"12" 8" 4" A B C O N M I H G D E F 16 " 12 " 8 " 4 "16"12" 8" 4"4"8" 12" 16" 16" 12" 8" 4" Clearwater NDT-UT_B-8.3-T1-2.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.231"0.223"0.234"0.232"0.232" 0.351"0.350"0.351"0.352" 0.237"0.234" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-12-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.240"0.238" 0.236" 0.232 0.231"0.241"0.242" 0.233"0.241"0.241"0.241" 0.233"0.235"0.236"0.235" 0.237" 0.353"0.355"0.355" 0.325"0.330"0.352"0.355"0.350" 0.351" Location: 28"32"4"8"12"16"20"24" North view B-8.3-T1-3 Center:0.351" Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-12-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.325" 0.351"0.352"0.352" 0.339"0.325"0.331"0.330" R Q P 4" 8" 12" 16" 16"12" 8" 4" A B C O N M I H G D E F 16 " 12 " 8 " 4 "16"12" 8" 4"4"8" 12" 16" 16" 12" 8" 4" Clearwater NDT-UT_B-8.3-T1-3.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.236"0.236"0.235" 0.251"0.251"0.250"0.250" 0.254"0.253"0.255" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-12-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.238"0.238"0.236" 0.235"0.235" 0.240"0.238"0.236" 0.235" 0.232"0.233"0.233"0.232" 0.226"0.232"0.232"0.232" 0.243"0.242"0.243" 0.355"0.355"0.355" 0.351" Location: 28"32" 0.358"0.357"0.356" 4"8"12"16"20"24" North view B-8-T1-1 Center:0.350" Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-12-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.336" 0.349"0.346"0.348" 0.351"0.351"0.351" 0.337"0.333"0.327" 0.255"0.258"0.256"0.256" 0.350"I H G4"8" 12" 16"16"12" 8" 4" A B C O N M G H I R Q P 16" 12" 8" 4"4"8" 12" 16"4" 8" 1 2 " 1 6 " 4" 8" 12" 16" C Clearwater NDT-UT_B-8-T1-1.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.230"0.231"0.231" 0.349"0.349"0.348"0.346" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-12-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.237"0.234" 0.231"0.241" 0.225" 0.232"0.233"0.234"0.233" 0.221"0.238"0.237" 0.222"0.230"0.235"0.233" 0.239"0.230"0.230" 0.355"0.355"0.355"0.355" 0.348" Location: 28"32"4"8"12"16"20"24" North view B-9.3-T1-1 Center:0.295" Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-12-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.334" 0.349"0.329"0.338" 0.348"0.348"0.348" 0.344"0.344"0.344" 0.354"0.355"0.355" 0.349" R Q P 4" 8" 12" 16" 16"12" 8" 4" A B C O N M I H G D E F 16 " 12 " 8 " 4 "16"12" 8" 4"4"8" 12" 16" 16" 12" 8" 4" C Clearwater NDT-UT_B-9.3-T1-1.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.357"0.352"0.353" 0.325" 0.345"0.345"0.345" 0.335"0.336"0.334" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-12-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Location: 28"32"4"8"12"16"20"24" North view B-9.3-T1-2 Center:0.347" 0.353"0.353"0.352"0.352" 0.345" 0.228"0.229"0.222"0.234" 0.231"0.233"0.230" 0.233"0.232"0.233"0.233" 0.237"0.239" 0.237" 0.233" 0.240"0.241" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-12-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.232"0.233"0.232" 0.345"0.345"0.346"0.346" R Q P 4" 8" 12" 16" 16"12" 8" 4" A B C O N M I H G D E F 16 " 12 " 8 " 4 "16"12" 8" 4"4"8" 12" 16" 16" 12" 8" 4" Clearwater NDT-UT_B-9.3-T1-2.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.349"0.351"0.351"0.351" 0.344" 0.346"0.345"0.345" 0.345"0.345"0.344" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-12-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Location: 28"32"4"8"12"16"20"24" North view B-9.3-T1-3 Center:0.345" 0.352"0.351"0.350"0.352" 0.345" 0.236"0.238" 0.235"0.238"0.239"0.232" 0.233"0.232" 0.232"0.234"0.235"0.233" 0.237"0.238" 0.229" 0.240"0.240"0.239" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-12-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.231"0.232"0.232" 0.344"0.346"0.345"0.344" 0.231"0.232" R Q P 4" 8" 12" 16" 16"12" 8" 4" A B C O N M I H G D E F 16 " 12 " 8 " 4 "16"12" 8" 4"4"8" 12" 16" 16" 12" 8" 4" Clearwater NDT-UT_B-9.3-T1-3.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.340"0.341"0.340" 0.226"0.231"0.230"0.231" 0.234" 0.236"0.237"0.238" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-12-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.358"0.352"0.351" 0.345"0.355"0.350"0.345" 0.302" 0.349"0.346"0.348"0.348" 0.231"0.231"0.231"0.231" 0.238" 0.236"0.230"0.231" 0.349" Location: 28"32" 0.347"0.358"0.345" 4"8"12"16"20"24" North view B-9-T1-1 Center:0.348" Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-12-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.239" 0.230" 0.349"0.349"0.349" 0.231"0.232"0.230" 0.236"0.234" 0.230" I H G 4"8" 12" 16"16"12" 8" 4" A B C O N M G H I R Q P 16" 12" 8" 4"4"8" 12" 16" 4" 8" 1 2 " 1 6 " 4" 8" 12" 16" C Clearwater NDT-UT_B-9-T1-1.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.233" 0.239" 0.235" 0.350"0.350"0.350" 0.230"0.230"0.230" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-12-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Location: 28"32" 0.359"0..361"0.360" 4"8"12"16"20"24" North view B-9-T1-2 Center:0.350" 0.237"0.235"0.236" 0.350" 0.231"0.229"0.231"0.231" 0.238" 0.350"0.348"0.349"0.351" 0.360"0.359"0.359"0.356" 0.117" 0.346"0.346"0.346" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-12-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.341"0.339"0.340"0.340" 0.234"0.234"0.233"0.233" 0.237"0.238" 0.234"0.238" I H G 4"8" 12" 16"16"12" 8" 4" A B C O N M G H I R Q P 16" 12" 8" 4"4"8" 12" 16" 4" 8" 1 2 " 1 6 " 4" 8" 12" 16" C Clearwater NDT-UT_B-9-T1-2.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.121" 0.349"0.349"0.349 0.232"0.230"0.232" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-12-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Location: 28"32" 0.354" 4"8"12"16"20"24" North view B-9-T1-3 Center:0.350" 0.349"0.348" 0.235"0.235"0.234" 0.348" 0.219"0.231"0.232"0.232" 0.232"0.232"0.232" 0.233" 0.349"0.349"0.349"0.349" 0.358"0.358"0.354"0.354" 0.315" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-12-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.333"0.327"0.326" 0.230"0.230"0.235"0.232" 0.232"0.232"0.232" 0.233"0.232" I H G 4"8" 12" 16"16"12" 8" 4" A B C O N M G H I R Q P 16" 12" 8" 4"4"8" 12" 16"4" 8" 1 2 " 1 6 " 4" 8" 12" 16" C Clearwater NDT-UT_B-9-T1-3.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc 0.222"0.218"0.223" 0.354" 0.359"0.359"0.359" 0.355"0.356"0.356" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-12-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Location: 28"32"4"8"12"16"20"24" South side view B-10.3-T2-1 Center:N/A 0.355" 0.356"0.356" 0.359" 0.235"0.234"0.234"0.233" 0.235"0.235"0.235" 0.236" 0.232"0.232"0.232"0.232" 0.239"0.239"0.240"0.240" 0.450" 0.455"0.455"0.455"0.455" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-12-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.450"0.450"0.442" 0.215"0.231"0.231"0.230" 0.235"0.235" East view 4 " 8" 12" 16" 16"12" 8" 4" A B C L K J O N F E D G H I Aa Bb Cc D E F 4 " 8" 1 2 " 1 6 "16"12" 8" 4"16" 12" 8" 4" 4 " 8" 12" 16" Clearwater NDT-UT_B-10.3-T1-1.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc 0.238"0.238"0.239" 0.356" 0.359" 0.359" 0.355"0.357"0.357" 0.359"0.362"0.359" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-12-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Location: 28"32"4"8"12"16"20"24" North view B-10.3-T2-2 Center:N/A 0.341" 0.229"0.231"0.230"0.231" 0.234"0.234" 0.236"0.233"0.232"0.232" 0.239"0.238"0.239" 0.457" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-12-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.460"0.460"0.459" 0.236"0.236"0.235"0.235" East view O N G H I D E F 4 " 8" 12" 16" 16"12" 8" 4" A B C L K J F E D Aa Bb Cc 4 " 8" 1 2 " 1 6 "16"12" 8" 4"16" 12" 8" 4" 4 " 8" 12" 16" Clearwater NDT-UT_B-10.3-T1-2.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc 0.366" 0.359"0.359"0.359" 0.337"0.336"0.356" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-12-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name: Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Location: 28"32"4"8"12"16"20"24" North view B-10.3-T2-3 Center:N/A 0.359" 0.227"0.233"0.232"0.233" 0.231"0.231"0.233" 0.238" 0.233"0.233"0.233"0.233" 0.240"0.241"0.240" 0.422" 0.478"0.478"0.478"0.476" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-12-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.447"0.466"0.448" 0.231"0.231"0.231"0.230" 0.231"0.237"0.235" 0.232"0.232" East view O N G H I D E F 4 " 8" 12" 16" 16"12" 8" 4" A B C L K J F E D Aa Bb Cc 4 " 8 " 1 2 " 1 6 "16"12" 8" 4"16" 12" 8" 4" 4 " 8" 12" 16" Clearwater NDT-UT_B-10.3-T1-3.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.344"0.344"0.344" 0.233"0.233"0.233"0.233" 0.234"0.234" 0.238"0.235" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-12-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.345"0.343"0.346"0.346" 0.251"0.251"0.252"0.252" 0.344" 0.249"0.250"0.249"0.248" 0.229"0.232"0.232"0.232" .0.233" 0.354"0.356"0.354" 0.238"0.238" 0.329" Location: 28"32"4"8"12"16"20"24" North view B-10-T1-1 Center:0.350" Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-12-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.234" 0.350"0.350"0.350" 0.239"0.235"0.235"4"8" 12" 16"16"12" 8" 4" A B C O N M G H I R Q P 16" 12" 8" 4"4"8" 12" 16" 4" 8" 1 2 " 1 6 " 4" 8" 12" 16" C Clearwater NDT-UT_B-10-T1-1.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.323"0.329"0.325" 0.229"0.231"0.231"0.231" 0.235"0.234" 0.235"0.238" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-12-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.353"0.356"0.354" 0.330" 0.349"0.348"0.349"0.349" 0.208"0.234"0.234"0.232" 0.230"0.230" .0.240" 0.354"0.354" 0.239"0.238" 0.349" Location: 28"32" 0.354"0.353" 4"8"12"16"20"24" North view B-10-T1-2 Center:0.347" Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-12-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.228" 0.236"0.236" 0.350"0.350"0.350" 0.220"0.231"0.233" 0.237"4"8" 12" 16"16"12" 8" 4" A B C O N M G H I R Q P 16" 12" 8" 4"4"8" 12" 16"4" 8" 1 2 " 1 6 " 4" 8" 12" 16" C Clearwater NDT-UT_B-10-T1-2.xlsx Page __ of ___ A B C D E F G H I J K L M N O P Q R 0.342"0.345"0.345" 0.231"0.233"0.233"0.233" 0.231"0.231" 0.234"0.236" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-12-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.352" 0.345" 0.347"0.347"0.347"0.348" 0.352"0.354" 0.231"0.232"0.231"0.232" 0.240"0.240"0.242" . 0.216"0.244" 0.347" Location: 28"32" 0.354"0.353" 4"8"12"16"20"24" North view B-10-T1-3 Center:0.347" Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-12-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.234" 0.347"0.349"0.349" 0.221"0.233"0.234"4"8" 12" 16"16"12" 8" 4" A B C O N M G H I R Q P 16" 12" 8" 4"4"8" 12" 16"4" 8" 1 2 " 1 6 " 4" 8" 12" 16" C Clearwater NDT-UT_B-10-T1-3.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc Dd (A)0.371" 0.353"0.352"0.353" 0.202"0.210"0.243" 0.363"0.366" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Client Name:McKim & Creed 0.202" Project #:23050318 Report Date:10-9-23 Project Location:Clearwater, FL Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:bare Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Location: 28"32" 0.356"0.356"0.355"0.356" 4"8"12"16"20"24" South side view D-1.3-T1-1 Center:(B)0.359" 0.371"0.375" 0.238"0.235"0.237" 0.363" 0.353"0.357"0.351"0.351" 0.356"0.362" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-9-23 Technician Name Level/Certification Signature Date surface area. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.249"0.233"0.233"0.233" 16" 12" 8" 4" A B C L K J G H I 4"8" 12" 16"4"8" 12" 16"4" 8" 12" 16" Clearwater NDT-UT_D-1.3-T1-1.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc Dd 0.239" 0.355"0.356"0.355" 0.234"0.236"0.235" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-9-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:bareClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Location: 28"32"4"8"12"16"20"24" South side view D-1.3-T1-4 Center:N/A 0.357" 0.227"0.229"0.228"0.224" 0.355"0.356"0.357"0.356" 0.256"0.302"0.299" 0.280" 0.294"0.300"0.315"0.332" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-9-23 Technician Name Level/Certification Signature Date surface area. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.299"0.295"0.328" 0.185"0.231"0.222"0.224" East side view Aa Bb Cc 4"8" 12" 16" 16" 12" 8" 4" 16"12" 8" 4" A B C O N M G H I Aa Bb Cc 4"8" 12" 16"4" 8" 1 2 " 1 6 " 4" 8" 12" 16" Clearwater NDT-UT_D-1.3-T1-4.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc Dd 0.436"0.439"0.439"0.452" 0.232"0.245"0.245" West side view Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-9-23 Technician Name Level/Certification Signature Date surface area. Repiar plate present along the connection, plate thickness 0.375". Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.449"0.449"0.460"0.460" 0.229"0.232"0.230"0.229" 0.241"0.247" Location: 28"32"4"8"12"16"20"24" South side view D-1-T2-1 Center:N/A Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:bareClient Name:McKim & Creed Project #:23050318 Report Date:10-9-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.363"0.365"0.365" 0.360"0.356"0.352" O N G H I 4 " 8" 12" 16" 16"12" 8" 4" A B C L K J F E D Aa Bb Cc 4 " 8 " 1 2 " 1 6 "16"12" 8" 4"16" 12" 8" 4" 4 " 8" 12" 16" Clearwater NDT-UT_D-1-T2-1.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc Dd 0.448"0.449"0.450" 0.130"0.232"0.230"0.227" West side view Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-9-23 Technician Name Level/Certification Signature Date surface area. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.450" 0.430" 0.126"0.198"0.199"0.198" 0.112"0.229"0.228"0.226" Location: 28"32"4"8"12"16"20"24" South side view D-1-T2-2 Center:N/A Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:bareClient Name:McKim & Creed Project #:23050318 Report Date:10-9-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME O N G H I Aa Bb Cc 16"12" 8" 4" A B C L K J F E D Aa Bb Cc 4 " 8" 1 2 " 1 6 "16"12" 8" 4"4 " 8" 12" 16" Clearwater NDT-UT_D-1-T2-2.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc Dd 0.464"0.444"0.439" 0.206"0.230"0.229"0.230" West side view Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-9-23 Technician Name Level/Certification Signature Date surface area. *H&K surfaces has a 1"x3" thourgh wall hole along it corners. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.381" 0.212"0.220"0.224"0.223" 0.205"0.229"0.237"0.236" Location: 28"32"4"8"12"16"20"24" South side view D-1-T2-3 Center:N/A Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:bareClient Name:McKim & Creed Project #:23050318 Report Date:10-9-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME O N G H I4" 8" 12" 16" 16"12" 8" 4" A B C L K J F E D Aa Bb Cc 4 " 8" 1 2 " 1 6 "16"12" 8" 4"16" 12" 8" 4" 4 " 8" 12" 16" Clearwater NDT-UT_D-1-T2-3.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc Dd Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-9-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:bareClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D7908 Serial No:988285 1 0.100" Serial No:110194505 Serial No.:1159629 5 0.500" Cable Length:48"Size:0.25" Cable Type:N/A Frequency:7.5 Location: 28"32"4"8"12"16"20"24" South side view D-1-T2-4 Center:N/A 0.230"0.140"0.208"0.210"0.199"0.230" 0.125"0.229"0.229"0.229" 0.240" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-9-23 Technician Name Level/Certification Signature Date surface area. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.293"0.275"0.326"0.336" 0.162"0.228"0.228"0.228" West side view O N G H I 4 " 8" 12" 16" 16"12" 8" 4" A B C L K J F E D Aa Bb Cc 4 " 8" 1 2 " 1 6 "16"12" 8" 4"16" 12" 8" 4" 4 " 8" 12" 16" Clearwater NDT-UT_D-1-T2-4.xlsx Page __ of ___ A B C D E F G H I J K L East view M N O Aa Bb Cc 0.462"0.461"0.461" 0.228"0.231"0.233"0.232" 0.231"0.235"0.230"0.240" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-13-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.443"0.433"0.459"0.447" 0.460" 0.354"0.354"0.355" 0.241"0.243"0.242" Location: 28"32"4"8"12"16"20"24" South view D-10.3-T2-1 Center:N/A Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-13-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.236"0.236"0.235"0.235" D E O N 4"8" 12" 16" 16" 12" 8" 4" 16"12" 8" 4" A B C O N G H I Aa Bb Cc 4"8" 12" 16" Clearwater NDT-UT_D-10.3-T2-1.xlsx Page __ of ___ A B C D E F G H I J K L East view M N O Aa Bb Cc 0.452"0.463"0.468" 0.232"0.233"0.233"0.233" 0.243"0.242" 0.236"0.236" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-13-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.358"0.356"0.357"0.357" 0.463" 0.364"0.362" 0.220"0.231"0.231"0.231" 0.233"0.233" 0.234" 0.361"0.362"0.364"0.364" 0.237"0.238"0.238" Location: 28"32"4"8"12"16"20"24" South view D-10.3-T2-2 Center:N/A Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-13-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.207"0.230"0.232"0.232" 0.233"0.233" D E 4"8" 12" 16" 16" 12" 8" 4" 16"12" 8" 4" A B C O N M G H I Aa Bb Cc 4"8" 12" 16"4" 8" 1 2 " 1 6 " 4" 8" 12" 16" Clearwater NDT-UT_D-10.3-T2-2.xlsx Page __ of ___ A B C D E F G H I J K L East view M N O Aa Bb Cc 0.237" 0.358"0.358"0.359" 0.237"0.237"0.238" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-13-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Location: 28"32"4"8"12"16"20"24" South view D-10.3-T2-3 Center:N/A 0.243"0.244"0.231" 0.358" 0.235"0.236"0.236"0.235" 0.456" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-13-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.454"0.461"0.463" 0.234"0.233"0.234"0.234" 0.238"0.237"0.236" 0.242"0.243"0.247" D E 4"8" 12" 16" 16" 12" 8" 4" 16"12" 8" 4" A B C O N M G H I Aa Bb Cc 4"8" 12" 16" 4" 8" 1 2 " 1 6 " 4" 8" 12" 16" Clearwater NDT-UT_D-10.3-T2-3.xlsx Page __ of ___ A B C D E F G H I J K L East view M N O Aa Bb Cc 0.294"0.295"0.315"0.313" 0.232"0.235"0.235"0.234" 0.233"0.233"0.233" 0.249"0.246" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-13-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.299"0.298"0.317"0.322" 0.294" 0.361"0.363"0.363"0.359" 0.239"0.238"0.239"0.239" 0.249"0.239" 0.237" 0.360" Location: 28"32"4"8"12"16"20"24" South view D-10.3-T2-4 Center:N/A Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-13-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.232" 0.360"0.360"0.360" 0.233"0.232"0.234" D E 4"8" 12" 16" 16" 12" 8" 4" 16"12" 8" 4" A B C O N M G H I Aa Bb Cc 4"8" 12" 16"4" 8" 1 2 " 1 6 " 4" 8" 12" 16" Clearwater NDT-UT_D-10.3-T2-4.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc 0.231"0.231"0.233"0.232" 0.235"0.237" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-13-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.283"0.234"0.232"0.233" 0.238" 0.352"0.351"0.350"0.350" 0.348" Location: 28"32"4"8"12"16"20"24" South view D-10-T1-1 Center:0.347" Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-13-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.347" 0.349"0.352"0.352" 0.349"0.349"0.348" 0.348"0.348"0.349" 0.228"0.232"0.231" 0.352" 4 8 12 16 16 12 8 4 16 12 8 4 1 6 1 2 8 4 A B C D E O N F E D G H I I H G D E F Clearwater NDT-UT_D-10-T1-1.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc 0.234"0.236"0.234"0.234" 0.243"0.243" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-13-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.237"0.236"0.235" 0.231"0.218"0.234"0.232" 0.230"0.231"0.232"0.232" 0.235"0.235"0.235" 0.242" 0.351"0.351"0.351"0.352" 0.349"0.349"0.350"0.350" 0.348" Location: 28"32"4"8"12"16"20"24" South view D-10-T1-2 Center:0.347" Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-13-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.346" 0.348"0.349"0.348" 0.347"0.343"0.348" 0.237"0.236"0.234" D E O N G H I D E F 4 " 8" 12" 16" 16"12" 8" 4" A B C L K J F E D 4 " 8 " 1 2 " 1 6 "16"12" 8" 4"16" 12" 8" 4" Clearwater NDT-UT_D-10-T1-2.xlsx Page __ of ___ A B C D E F G H I J K L M N O Aa Bb Cc 0.224"0.232"0.235"0.234" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-13-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.245"0.244"0.239" 0.217"0.234"0.234"0.232" 0.232"0.234"0.234"0.235" 0.237"0.236"0.236" 0.348"0.350"0.352"0.350" 0.349"0.350"0.350"0.351" 0.347" Location: 28"32"4"8"12"16"20"24" South view D-10-T1-3 Center:0.347" Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Project #:23050318 Report Date:10-13-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME 0.348" 0.347"0.347"0.347" 0.348"0.349"0.349" 0.231"0.230"0.230" D E O N G H I D E F 4" 8" 12" 16" 16"12" 8" 4" A B C O N M I H G D E F 16 " 12 " 8 " 4 "16"12" 8" 4"4"8" 12" 16" 16" 12" 8" 4" C Clearwater NDT-UT_D-10-T1-3.xlsx Page __ of ___ A B C D E F G H I J K west view L M N O Aa Bb Cc 0.245"0.243"0.244" 0.347" 0.348"0.349"0.349"0.349" 0.347"0.348"0.348" Form No TR-NDT-UT ULTRASONIC EXAMINATION THICKNESS REPORTRevision No. 0 ASME Project #:23050318 Report Date:10-13-23 Project Location:Clearwater, FL S&ME, Inc. Raleigh: 3201 Spring Forest Road, Raleigh, NC 27616 Project Name:Clearwater Natatorium UTT of structure framing Procedure No.TR-NDT-UT-2 Material Type:CS Surface Condition:PaintedClient Name:McKim & Creed Manufacturer: Ultrasonic Flaw Detector Search Unit(s)Calibration Standard(s) Manufacturer:Olympus Panmetric Material:CS Step #Thickness Model No.:DL38 Model No.:D790-SM Serial No:988285 1 0.100" Serial No:110194505 Serial No.:754080 5 0.500" Cable Length:48"Size:7.9mm Cable Type:N/A Frequency:5 MHz Location: 28"32"4"8"12"16"20"24" South view D-10-T1-4 Center:(C)0.352" 0.355"0.352"0.352"0.352" 0.352"0.357"0.352"0.352"0.352" 0.233"0.233"0.234"0.234" 0.235"0.235" 0.233"0.233"0.232"0.232" 0.241"0.241"0.240" 0.292"0.294"0.287"0.309" 0.295" 0.282"0.282"0.304"0.307" Disclaimer: The presence of S&ME at the project site shall not be construed as an acceptance or approval of activities at the site. S&ME is at the project site to perform specific services and has certain responsibilities which are limited to those specifically authorized in our agreement with our client. In no event shall S&ME be responsible for the safety or means and methods of other parties at the project site. The information presented in this field report has not been reviewed by an engineer and is to be considered preliminary. Larry Jernigan UT Level II 10-13-23 Technician Name Level/Certification Signature Date and/or due to thickness of epoxy coating along the surface areas. Notes:Some faces of the HSS members could not have thicknesses retrieved due to window framing covering the 0.294"0.309"0.306" 0.240"0.241"0.241"0.241" 0.235" D E O N G H I D E F 4 " 8" 12" 16" 16"12" 8" 4" A B C L K J F E D Aa Bb Cc 4 " 8" 1 2 " 1 6 "16"12" 8" 4"16" 12" 8" 4" 4 " 8" 12" 16" C Clearwater NDT-UT_D-10-T1-4.xlsx Page __ of ___ – Photolog NDE Inspection Clearwater Natatorium Project #: 23050318 Sheet 1 of 6 Date: 10-11-23 Photographer: Larry Jernigan 1 Location / Orientation West wall Remarks Date: 10-11-23 Photographer: Larry Jernigan 2 Location / Orientation North wall Remarks NDE Inspection Clearwater Natatorium Project #: 23050318 Sheet 2 of 6 Date: 10-11-23 Photographer: Larry Jernigan 3 Location / Orientation East Wall Remarks Date: 10-9-23 Photographer: Larry Jernigan 4 Location / Orientation B-1 corner Remarks NDE Inspection Clearwater Natatorium Project #: 23050318 Sheet 3 of 6 Date: 10-9-23 Photographer: Larry Jernigan 5 Location / Orientation B-1-T2-1 Remarks Date: 10-9-23 Photographer: Larry Jernigan 6 Location / Orientation D-1-T2-1 Remarks NDE Inspection Clearwater Natatorium Project #: 23050318 Sheet 4 of 6 Date: 10-9-23 Photographer: Larry Jernigan 7 Location / Orientation D-1-T2-2 Remarks Date: 10-9-23 Photographer: Larry Jernigan 8 Location / Orientation D-1-T2-3 Remarks NDE Inspection Clearwater Natatorium Project #: 23050318 Sheet 5 of 6 Date: 10-9-23 Photographer: Larry Jernigan 9 Location / Orientation D-1-T2-3 Remarks Hole Date: 10-12-23 Photographer: Larry Jernigan 10 Location / Orientation B-9.3-T1-1 Remarks NDE Inspection Clearwater Natatorium Project #: 23050318 Sheet 6 of 6 Date: 10-12-23 Photographer: Larry Jernigan 11 Location / Orientation B-10_10.3 truss joints Remarks Date: 10-12-23 Photographer: Larry Jernigan 12 Location / Orientation B-10_10.3 truss joints Remarks – Structural Frame Repair Drawings City Project No. 21-0026-PRCity Plan Set No. 2021017CITY OFFICIALSFrank HibbardMayorMark BunkerCouncilmemberKathleen BeckmanCouncilmemberDavid AllbrittonCouncilmemberLina TeixeiraCouncilmemberJon JenningsCity ManagerTara L. Kivett, P.E.City EngineerApproved ForConstructionDate ApprovedCITY ENGINEER Tara L. Kivett, P.E. #86611LONG CENTER NATATORIUMSTRUCTURAL FRAME REPAIRSSHEET #SHEET DESCRIPTIONGENERALCOVERSHEETS0.00GENERAL NOTES, DESIGN LOADS, DESIGN CRITERIA & LEGENDSHEET INDEXProjectLocationNSEWFINAL DESIGNRELEASED FOR BIDS1.00EXIST BLDG. A ROOF & EXTERIOR WALL FRAMING LAYOUTS1.01EXIST. BLDG. A ROOF & EXTR. WALL FRMG. ELEVATIONS (SHT. 1 OF 2)S1.02EXIST. BLDG. A ROOF & EXTR. WALL FRMG. ELEVATIONS (SHT. 2 OF 2)S1.03EXIST. BLDG. A TRUSS CONDITIONS & REPAIRS (SHT. 1 OF 11)S1.04EXIST. BLDG. A TRUSS CONDITIONS & REPAIRS (SHT. 2 OF 11)S1.05EXIST. BLDG. A TRUSS CONDITIONS & REPAIRS (SHT. 3 OF 11)S1.06EXIST. BLDG. A TRUSS CONDITIONS & REPAIRS (SHT. 4 OF 11)S1.07EXIST. BLDG. A TRUSS CONDITIONS & REPAIRS (SHT. 5 OF 11)S1.08EXIST. BLDG. A TRUSS CONDITIONS & REPAIRS (SHT. 6 OF 11)S1.09EXIST. BLDG. A TRUSS CONDITIONS & REPAIRS (SHT. 7 OF 11)S1.10EXIST. BLDG. A TRUSS CONDITIONS & REPAIRS (SHT. 8 OF 11)S1.11EXIST. BLDG. A TRUSS CONDITIONS & REPAIRS (SHT. 9 OF 11)S1.12EXIST. BLDG. A TRUSS CONDITIONS & REPAIRS (SHT. 10 OF 11)S1.13EXIST. BLDG. A TRUSS CONDITIONS & REPAIRS (SHT. 11 OF 11)PROFESSIONAL ENGINEER WILLIAM F. BANDLICENSENo 67838STATE OFFLORIDA 1.1 ALL WORK IS TO BE PERFORMED IN A GOOD, WORKMANLIKE ANDPROFESSIONAL MANNER.1.2 ALL CONSTRUCTION SHALL BE IN STRICT COMPLIANCE w/ THEREQUIREMENTS OF THE FLORIDA STATE BUILDING CODE (FBC), 2020EDITION, OR LOCAL BUILDING CODE REQUIREMENTS IF MORESTRINGENT.1.3 THESE DRAWINGS DO NOT SHOW PROVISIONS FOR SAFETY DURINGCONSTRUCTION. IT IS THE RESPONSIBILITY OF THE GENERALCONTRACTOR TO PROVIDE THE REQUIRED BRACING, SHORING, ANDSAFETY DEVICES THROUGHOUT THE CONSTRUCTION OF THIS PROJECT.NOT APPLICABLE.2.1 STRUCTURAL DRAWINGS SHALL BE USED IN CONJUNCTION w/ &COORDINATED w/ EXISTING ARCHITECTURAL, CIVIL, ELECTRICAL,MECHANICAL AND PLUMBING DRAWINGS, INCLUDING VENDORSUBMITTAL DRAWINGS AND OTHER CONTRACT DOCUMENTS.2.2 ANY DISCREPANCIES BETWEEN ACTUAL CONDITIONS AND THOSESHOWN ON THESE DRAWINGS ARE TO BE BROUGHT TO THE ATTENTIONOF THE STRUCTURAL ENGINEER BEFORE WORK PROCEEDS, INCLUDINGORDERING AND FABRICATING MATERIALS.2.3 INDEPENDENT TESTING / REVIEW OF MATERIALS SHALL BEPROVIDED AS DEFINED IN PROJECT SPECIFICATIONS IF APPLICABLE. INGENERAL PROJECT INVOLVES THE FOLLOWING: A. STRUCTURAL STEEL. B. FIELD WELDING.2.4 IF COORDINATION OF INFORMATION PRESENTED CONFLICTS w/ THEPROJECT SPECIFICATIONS, THE DRAWINGS WILL TAKE PRECEDENCE.2.5 IN GENERAL CALL-OUTS ARE FOR NEW CONSTRUCTION U.N.O..EXISTING CONSTRUCTION CALL-OUTS, ELEVATIONS AND DIMENSIONSOF EXISTING STRUCTURES ARE BASED ON EXISTING RECORDDRAWINGS PROVIDED TO McKIM & CREED. THE (*) SYMBOL ONINDIVIDUAL FACILITY "STRUCTURAL" DRAWINGS INDICATES EXISTINGCONSTRUCTION CALL-OUTS, CONDITIONS, ELEVATIONS ANDDIMENSIONS TO BE FIELD VERIFIED BY THE GENERAL CONTRACTORU.N.O. PRIOR TO CONSTRUCTION, INCLUDING ORDERING ANDFABRICATING MATERIALS. RECORD DRAWINGS PROVIDED BY THE CITYOF CLEARWATER UTILIZED INCLUDES: A. "CENTER FOUNDATION, INC. FOR EDUCATION, TRAINING AND, RECREATION" BY MUDANO ASSOCIATES ARCHITECTS, INC.(DTD. MARCH 1989).2.6 SPECIAL INSPECTIONS (IF APPLICABLE): STRUCTURAL STEEL WORKSHALL BE REVIEWED AS STATED IN CONJUNCTION w/ THEIRRESPECTIVE NOTES BELOW.2.7 CONTRACTOR SHALL COORDINATE ALL DEMOLITION ACTIVITIES OFEXISTING CONSTRUCTION IN PLACE w/ THE OWNER. CONTRACTOR TONOTE THE OWNER HAS THE RIGHT OF FIRST REFUSAL FOR ALLREMOVED AND / OR SCRAPPED MATERIALS AND EQUIPMENT.6.1 GROUT WHERE REQUIRED SHALL BE NON-SHRINK GROUT INCONFORMANCE TO ASTM C1107.6.2 GROUT SHALL BE NON-METALLIC AND NON-STAINING AND HAVE AMINIMUM COMPRESSIVE STRENGTH OF 5,000 PSI.8.1 STEEL SHALL CONFORM TO "STANDARD SPECIFICATION FORSTRUCTURAL STEEL," ASTM A36 (Fy=36 ksi) FOR ANGLES, PLATES &CHANNELS. WIDE FLANGE SECTIONS SHALL CONFORM TO ASTM A992(Fy=50 ksi). HOLLOW STEEL SECTIONS (HSS) SHALL CONFORM TO ASTMA500, GRADE B (Fy=46 ksi). STEEL PIPE SHALL CONFORM TO ASTM A53,GRADE B, (Fy=35 ksi).8.2 STEEL WORK SHALL CONFORM TO "SPECIFICATION FOR THE DESIGN,FABRICATION AND ERECTION OF STRUCTURAL STEEL BUILDINGS", OFTHE AMERICAN INSTITUTE OF STEEL CONSTRUCTION, INC., (2016EDITION), INCLUDING ALL SUPPLEMENTS AND THE "CODE OF STANDARDPRACTICE FOR STEEL BUILDINGS AND BRIDGES", (LATEST EDITION).8.3 CONNECTION BOLTS SHALL BE 3/4 INCH DIAMETER CONFORMING TO"STANDARD SPECIFICATION FOR HIGH-STRENGTH BOLTS FORSTRUCTURAL STEEL JOINTS", ASTM F3125, GRADE A325, GROUP ACRITERIA. UNLESS NOTED OTHERWISE CONNECTIONS ARE BEARINGTYPE WITH THREADS EXCLUDED FROM SHEAR PLANES.8.4 WELDING SHALL BE IN ACCORDANCE WITH THE LATEST EDITION OFTHE AMERICAN WELDING SOCIETY AWS D1.1 "STRUCTURAL WELDINGCODE". WELDING SHALL BE PERFORMED BY CERTIFIED PERSONNELWHO HAVE BEEN PREVIOUSLY QUALIFIED BY TEST PRESCRIBED IN THEAWS "STRUCTURAL WELDING CODE". ELECTRODES SHALL CONFORM TOAWS 5.5, E7018 CRITERIA.8.5 THE CONTRACTOR SHALL PROVIDE ADEQUATE TEMPORARYBRACING, SHORING, AND GUYING OF STEEL FRAMING AGAINST WIND,CONSTRUCTION LOADS, AND OTHER TEMPORARY FORCES UNTIL SUCHPROTECTION IS NO LONGER REQUIRED FOR THE SAFE SUPPORT OFTHE FRAMING.8.6 ALL COPES, BLOCKS, CUTS, CUT-OFFS AND OTHER CUTTING OFSTRUCTURAL MEMBERS SHALL HAVE ALL RE-ENTRANT CORNERSSHAPED, AND NOTCH-FREE TO A RADIUS OF AT LEAST 1/2 INCH. THEFILLET AND ITS CONTIGUOUS CUTS SHALL MEET WITHOUT OFFSET ORCUTTING PAST THE POINT OF TANGENCY.8.7 ANCHOR BOLTS SHALL BE ASTM F1554 OR ASTM A36 & SHALL BEEITHER HEADED w/ NUTS TACK WELDED TO BOLTS OR NON-HEADED w/HOOKS AS REQUIRED BY THE DRAWINGS. PROVIDE (2) NUTS ANDWASHERS WITH EACH ANCHOR BOLT AT COLUMNS UNLESS NOTEDOTHERWISE. ANCHOR BOLTS FOR EQUIPMENT & OTHER ASSEMBLIESMAY BE POST APPLIED ANCHOR ASSEMBLIES AS INDICATED ON THEDRAWINGS.8.8 OVERSIZED AND SLOTTED HOLES SHALL NOT BE USED FOR BOLTEDCONNECTIONS ON THIS PROJECT EXCEPT AT LOCATIONS NOTED ONDRAWINGS.8.9 SPLICING OF STRUCTURAL STEEL MEMBERS IS PROHIBITEDWITHOUT THE APPROVAL OF THE STRUCTURAL ENGINEER, AS TOLOCATION AND TYPE OF SPLICE. ANY MEMBER HAVING A SPLICE NOTSHOWN AND DETAILED ON THE SHOP DRAWINGS WILL BE REPLACED.8.10 PRE-GROUTING BASE PLATES IS NOT PERMITTED.8.11 ALL HOLES IN STRUCTURAL STEEL ARE TO BE PUNCHED ORDRILLED. FLAME CUTTING OF STEEL IS STRICTLY PROHIBITED.8.12 ALL DESIGN, DETAILING, FABRICATION AND ERECTION SHALL BE INACCORDANCE WITH THE LATEST EDITION OF THE AMERICAN INSTITUTEOF STEEL CONSTRUCTION (AISC) MANUAL OF STEEL CONSTRUCTION.8.14 FABRICATOR / CONTRACTOR SHALL SUBMIT SHOP DRAWINGS FOROWNER / ENGINEER APPROVAL PRIOR TO FABRICATION. ALL SHOPDRAWINGS MAY BE EXPEDITED IF THE FABRICATOR ADHERES CLOSELYTO THE DETAILS, NOTES, AND INSTRUCTIONS, SHOWN ON THEDRAWINGS.8.15 ALL GALVANIZED MATERIALS THAT ARE FIELD CUT, FIELD WELDEDOR DAMAGED IN SURFACE FINISH SHALL BE CLEANED AND RE-COATEDw/ A 98% ZINC RICH OXIDE AND IN CONFORMANCE w/ THE PROJECTSPECIFICATIONS.8.16 STRUCTURAL STEEL FRAMING ERECTION TO BE REVIEWED BY THETHE OWNER'S CONSTRUCTION REPRESENTATIVE THROUGHOUT STEELCONSTRUCTION OF THE PROJECT.NOT APPLICABLE.NOT APPLICABLE.NOT APPLICABLE.13.1 ALL MISCELLANEOUS MATERIALS ARE TO BE DELIVERED TO SITE &STAGED ON SITE PRIOR TO INSTALLATION. STORE ON SITE ASREQUIRED BY THE MATERIAL MANUFACTURER TO AVOID DAMAGEPRIOR TO INSTALLATION.13.2 CAULK & SEALANT MATERIAL SHALL BE MASTERSEAL"NP 1" ONE COMPONENT, MOISTURE CURING HIGH PERFORMANCEPOLY-URETHANE SEALANT, OR AN APPROVED EQUAL.13.3 FINISH COATING SYSTEM SHALL UTILIZE PRODUCTSMANUFACTURED BY PPG INDUSTRIES & TO INCLUDE THE FOLLOWING:a.) PRIMER COAT = SPEEDHIDE 6-208 SERIES 2.0 MIL DFT THK.b.) INTERMEDIATE COAT = 7-LINE 7-282 SERIES INDUSTRIAL GLASS OIL ALKYD 3.0 MIL DFT. THK. (MIN.).c.) TOP COAT = 7-LINE 7-282 SERIES INDUSTRIAL GLASS OIL ALKYD 3.0 MIL DFT. THK. (MIN.).14.1 THE FOLLOWING LIST OF ABBREVIATIONS IS NOT INTENDEDTO REPRESENT ALL THOSE USED ON THE DRAWINGS, BUT TOSUPPLEMENT THE MORE COMMON ABBREVIATIONS USED.NOT APPLICABLE.NOT APPLICABLE.NOT APPLICABLE.NOT APPLICABLE.S0.00ADD'LALALT.BLDG.BLK.BM.B.O.BRG.C.I.P.CLR.CMUC.O.COL.CONC.CONN.CONST.CONT.COORD.CTR.CTR'D.DBL.DIR.DWG.DWG.'s.EA.ELE.O.EQ.EQUIP.EXIST.EXP.FLG.FDN.F.S.FT.FTG.GA.GALV.GALV'DHORZ.H.P.HRS.I/FINFO.INTR.JST.JT.KBLCSLLHLLVL.P.LSLMAS.MAT'L.MFG.MIN.MTL.N/ANANOM.N.S.N.T.S.O.C.O/FO/HO/OOPNG.OPP.ORIENT.PLCS.P.P.RAD.REF.REINF.REQ'D.RET.ROT.SIM.SPA.SPECS.S.S.SSLSTD.STL.T&BT/DTHK.THK'DT.O.T.O.STYP.U.N.O.XBVERT.W.P.================================================================================================ADDITIONALALUMINUMALTERNATEBUILDINGBLOCKBEAMBOTTOM OFBEARINGCAST-IN-PLACECLEARCONC. MAS. UNITCLEAN OUTCOLUMNCONCRETECONNECTIONCONSTRUCTIONCONTINUOUSCOORDINATECENTERCENTEREDDOUBLEDIRECTIONDRAWINGDRAWINGSEACHELEVATIONEDGE OFEQUALEQUIPMENTEXISTINGEXPANSIONFLANGEFOUNDATIONFAR SIDEFEETFOOTINGGAGEGALVANIZEDGALVANIZEDHORIZONTALHIGH POINTHOURSINSIDE FACEINFORMATIONINTERIORJOISTJOINTKNEE BRACELIQUID CONTAINMENTSTRUCTURESLONG LEG HORIZONTALLONG LEG VERTICALLOW POINTLONG SLOTTEDMASONRYMATERIALMANUFACTURERMINIMUMMETALNOT APPLICABLENOT APPLICABLENOMINALNEAR SIDENOT TO SCALEON CENTEROUTSIDE FACEOVERHANGOUT TO OUTOPENINGOPPOSITEORIENTATIONPLACESPUMP PADRADIUSREFERENCEREINFORCINGREQUIREDRETAININGROTATESIMILARSPACEDSPECIFICATIONSSTAINLESS STEELSHORT SLOTTEDSTANDARDSTEELTOP & BOTTOMTURN DOWNTHICKTHICKENEDTOP OFTOP OF STEELTYPICALUNLESS NOTEDOTHERWISECROSS OR "X"-BRACEVERTICALWORK POINTGENERAL NOTES1COORDINATION2FOUNDATIONS3REINFORCING STEEL4CONCRETE5STRUCTURAL STEEL8ALUMINUM9PRECAST CONCRETE10PRE-ENGR. TIMBER TRUSS11PRE-ENGR. METAL BLDGS.12MISC. BUILDING MATERIALS13MASONRY7ABBREVIATIONS14DESIGN LOADS BASIS OF DESIGN:FLORIDA BUILDING CODE (FBC) - EDITIONMINIMUM DESIGN LOADS FOR BUILDINGS & OTHER STRUCTURES - ASCE 7-88EQUIP. LOAD:N/ALIVE LOAD:N/AROOF LOAD: 20 PSFSNOW LOAD:N/AWIND LOAD:110 mi/hr, EXPOSURE C, OCCUPANCY / RISK CATEGORY IIICALCULATED WIND BASE SHEARS:Vx = N/A & Vy = N/A COMPONENTS & CLADDING WIND PRESSURES:ZONE 1, ZONE 2 & ZONE 3 ROOF PRESSURES = N/AZONE 4 & ZONE 5 WALL PRESSURES = N/ASEISMIC:N/ASOIL BEARING: FIELD TEST PER PROJECT GEOTECH REPORT = N/A REF. "FOUNDATIONS" NOTE 3.1 DWG. S0.00 ... N/ACONCRETE 28 DAY COMPRESSIVE STRENGTH:SLABS-ON-GRADE & NON LCS SLABSf'c = 4,000 PSI ... N/APIPE ENCASEMENTS:f'c = 3,000 PSI ... N/ASLABS & WALLS OF LCS:f'c = 4,500 PSI ... N/ABEAMS & COLUMNS OF LCS:f'c = 4,500 PSI ... N/ANON-LCS FOOTINGS & PIERS:f'c = 4,000 PSI ... N/ABELOW GRADE & RETAINING WALLS:f'c = 4,000 PSI ... N/ASIDEWALK, DRIVEWAY, CURB & GUTTER:f'c = 3,000 PSI ... N/AREINFORCING STEEL:ASTM A615, GRADE 60 ... N/AWELDED WIRE FABRIC:ASTM A1064 ... N/ASTRUCTURAL STEEL:REF. STRUCTURAL NOTE 8.1ALUMINUM:REF. STRUCTURAL NOTE 9.2 ... N/ABOLTS SHALL BE 3/4"Ø ASTM A325 ORREF. STRUCTURAL NOTES 8.3 & 9.2.d ... N/ATYPE 316 S.S.:ANCHOR BOLTS SHALL BE 3/4"Ø ASTM F-1554 ORASTM A36 (STEEL); TYPE 316 S.S. (ALUMINUM):STEEL ELECTRODES SHALL CONFORM TO:AWS 5.5 E7018ALUMINUM WELD FILLERS ALLOYS SHALL CONFORM TO:AWS A5.10 ... N/ASOIL BEARING CAPACITY: REF. "DESIGN LOADS" TABLEENLARGED PLAN AREA, DETAILCONC. MASONRY BLOCKBRICK VENEERCONC. WALL, SLAB, ETC.GROUTGRATINGDETAIL OR SECTIONNO./SHEET NO. REFERENCEPROJECT NORTHELEVATION DATUMELEVATION NO./SHEET NO.REFERENCEELEVATIONS X'-X" (Y.YY')STEP IN FOOTING ELEVATIONSTL. FRAMING COL./BM.MOMENT CONNECTION=============X-SY.YYNORTHX-SY.YYX'-X" = DISTANCE TO / FROM FACILITY REFERENCE EL 0'-0"Y.YY'= EQUIVALENT SITE EL VERTICAL DATUM$DESIGN LOADS15DESIGN CRITERIA16LEGEND17(EXISTING)(EXISTING)(EXISTING)(EXISTING)X-SY.YY(EXISTING)GENERAL NOTES, DESIGN LOADS,DESIGN CRITERIA & LEGENDGROUT6DESCRIPTIONDATEREVISIONSSCALEHORIZONTAL:VERTICAL:STATUS:DRAWNPROJ. MGR. DESIGNEDCHECKEDPROJ. START DATE:MCE PROJ. #REV.NO.2021.NOV00992-0261LONG CENTER NATATORIUMSTRUCTURAL FRAME REPAIRSREVISIONDRAWING NUMBERwww.mckimcreed.comCA Lic. No. 29588Phone: (727) 442-7196, Fax: (727) 461-3827Clearwater, Florida 33756-33311365 Hamlet AvenueWFBWFBWFB / AEAAAHNA02 MAR 202290% DESIGN - NOT FOR CONSTRUCTIONA18 MAR 2022100% DESIGN - NOT FOR CONSTRUCTIONB09 MAY 2022FINAL DESIGN - FINAL REVIEW NOT FOR CONSTRUCTIONC23 MAY 2022FINAL DESIGN - RELEASED FOR BIDDRELEASED FOR BIDNASTRUCTURALFINAL DESIGN SUBMITTALD 16'-8"(*)1BAB.2DEB.4B.5B.7B.91.322.333.344.355.366.377.388.399.31010.37'-4"(*)16'-8"(*)7'-4"(*)16'-8"(*)7'-4"(*)16'-8"(*)7'-4"(*)16'-8"(*)7'-4"(*)16'-8"(*)7'-4"(*)16'-8"(*)7'-4"(*)16'-8"(*)7'-4"(*)16'-8"(*)7'-4"(*)7'-4"(*)20'-0"(*)6'-8"(*)20'-0"(*)20'-0"(*)20'-0"(*)20'-0"(*)20'-0"(*)6'-8"(*)EXIST. TRUSS "T2"EXIST. TRUSS "T1"EXIST. TRUSS "T1"EXIST. TRUSS "T1"EXIST. TRUSS "T1"EXIST. TRUSS "T1" EXIST. TRUSS "T1" EXIST. TRUSS "T1" EXIST. TRUSS "T1" EXIST. TRUSS "T1" EXIST. TRUSS "T1" EXIST. TRUSS "T1" EXIST. TRUSS "T1" EXIST. TRUSS "T1" EXIST. TRUSS "T1" EXIST. TRUSS "T1" EXIST. TRUSS "T1" EXIST. TRUSS "T1" EXIST. TRUSS "T1" EXIST. TRUSS "T2"2-S1.023-S1.011-S1.012-S1.011-S1.021-S1.031-S1.10 2-S1.10 3-S1.10 1-S1.11 2-S1.11 3-S1.111-S1.122-S1.121-S1.132-S1.131-S1.091-S1.042-S1.041-S1.052-S1.051-S1.062-S1.061-S1.072-S1.071-S1.082-S1.08S1.00STRUCTURALEXIST BLDG. A ROOF & EXTERIOR WALLFRAMING LAYOUT1 - PLAN - EXIST. BUILDING "A" ROOF & EXTERIOR WALL FRAMING LAYOUTSCALE: 1/8" = 1'-0"1. TRUE NORTH VARIES FROM PLAN NORTH INDICATED. COORDINATE w/ CIVIL & SITE RECORD DWG.'sAS REQUIRED FOR THE DIRECTION OF TRUE NORTH2. REFERENCE ELEVATION FOR BUILDING "A" OF THE LONG CENTER FACILITY IS THE POOL DECK SLABT.O. CONC. "H.P." EL 0'-0" = EL 43'-0" (43.00'). CONTRACTOR SHALL VERIFY THE CORRESPONDINGN.A.V.D. INDICATED AS REQUIRED. REFERENCE CIVIL AND / OR SITE RECORD DRAWINGS FORADDITIONAL INFORMATION.3. GRADE ELEVATION AROUND THIS STRUCTURE IS 42.50'(±)[*]. REFERENCE CIVIL AND / OR SITERECORD DRAWINGS FOR ADDITIONAL INFORMATION.FRAMING PLAN NOTES:DESCRIPTIONDATEREVISIONSSCALEHORIZONTAL:VERTICAL:STATUS:DRAWNPROJ. MGR. DESIGNEDCHECKEDPROJ. START DATE:MCE PROJ. #REV.NO.2021.NOV00992-0261LONG CENTER NATATORIUMSTRUCTURAL FRAME REPAIRSREVISIONDRAWING NUMBERwww.mckimcreed.comCA Lic. No. 29588Phone: (727) 442-7196, Fax: (727) 461-3827Clearwater, Florida 33756-33311365 Hamlet AvenueWFBWFBWFB / AEAAAHNAAS NOTED02 MAR 202290% DESIGN - NOT FOR CONSTRUCTIONA18 MAR 2022100% DESIGN - NOT FOR CONSTRUCTIONB09 MAY 2022FINAL DESIGN - FINAL REVIEW NOT FOR CONSTRUCTIONC23 MAY 2022FINAL DESIGN - RELEASED FOR BIDDRELEASED FOR BIDSTRUCTURALFINAL DESIGN SUBMITTALDNORTH (PLAN)[REF. NOTE 1]CTD. ...4. EXISTING RECORD DRAWING's REVIEWED INDICATED & SITE VISITS CONFIRMED THE EXISTINGTRUSS ASSEMBLIES CONSTRUCTED OF HSS 6x6 STRUCTURAL STEEL & NOTE THE FOLLOWING:a.) DWG.'s INDICATED HSS's ARE EITHER 38", 516" OR 14" THICK SECTIONS.b.) BASED UPON YEAR CONSTRUCTED IT IS ESTIMATED STEEL SECTIONS IN CONFORMANCE w/ ASTM A500.5. REFERENCE DWG. S0.00 FOR ADDITIONAL GENERAL NOTES, MATERIAL SPECIFICATIONS &REQUIREMENTS, DESIGN CRITERIA AND LEGEND. C EXIST. TRUSS "T2"L1.317'-4"(*)6'-8"(*)T.O.S. BASE PLATEEL 2'-0" (45.00')[*][TYP.]6'-8"(*)6'-8"(*)6'-8"(*)6'-8"(*)C EXIST. TRUSS "T1"L[REF. PLAN]T.O. CONC. SLAB "H.P."EL 0'-0" (43.00')[*][REF. NOTE 1 - TYP.]EXIST. CONC. SLAB-ON-GRADE(REF. NOTE 1)EXIST. DOOR & STOREFRONTWINDOW ASSEMBLIES NOTSHOWN FOR CLARITYEXIST. CONC. PIER (TYP.)[REF. NOTE 2]EXIST. MAS. KNEE WALL (TYP.)[REF. NOTE 3]02345REF. NOTE 41HSS 6x6 TRUSS. COL. (TYP.)[REF. NOTE 5a]HSS 6x6 X.B. (TYP.)[REF. NOTE 5c]HSS 6x6 BM.'s (TYP.)[REF. NOTE 6a]ROOF TRUSS HSS 6x6 T&B CHORDSN.S. VERT. TRUSS COL. SECTIONS@ COL. LINE "D" (TYP.)[REF. NOTE 5d]HSS 6x6 HORZ. BM. (TYP.)[REF. NOTE 5b]FOR REPAIRS TO EXIST. TRUSSESREF. DETAIL 1-S1.03HSS 6x4 GIRT FRMG. N.S. VERT.TRUSS COL. (REF. NOTE 6b)HSS 6x4 GIRT FRMG. N.S. VERT.TRUSS COL. (REF. NOTE 6b)C TRUSS HSS'sLED6'-8"(*)6'-8"(*)6'-8"(*)6'-8"(*)6'-8"(*)6'-8"(*)C TRUSS HSS'sLBA6'-8"(*)B.920'-0"(*)B.720'-0"(*)B.520'-0"(*)B.420'-0"(*)B.220'-0"(*)[REF. PLAN][REF. PLAN][REF. PLAN][REF. PLAN][REF. PLAN][REF. PLAN]20'-0"(*)[REF. PLAN][REF. PLAN]C TRUSS HSS'sLC TRUSS HSS'sL[REF. PLAN]T.O.S. BASE PLATEEL 2'-0" (45.00')[*][TYP.]T.O. CONC. SLAB "H.P."EL 0'-0" (43.00')[*][REF. NOTE 1 - TYP.]023451EXIST. CONC. SLAB-ON-GRADE(REF. NOTE 1)EXIST. DOOR & STOREFRONTWINDOW ASSEMBLIES NOTSHOWN FOR CLARITYEXIST. CONC. PIER (TYP.)[REF. NOTE 2]EXIST. MAS. KNEE WALL (TYP.)[REF. NOTE 3]REF. NOTE 4(TYP.)ROOF TRUSS HSS 6x6 T&B CHORDSN.S. VERT. TRUSS COL. SECTIONS@ COL. LINE "D" (TYP.)[REF. NOTE 5d]HSS 6x6 HORZ. BM. (TYP.)[REF. NOTE 5b]HSS 6x6 TRUSS. COL. (TYP.)[REF. NOTE 5a]W12x40 STL. COL.'s (TYP. 5 PLCS.)[REF. NOTE 8]ROOF TRUSS HSS 6x6 T&B CHORDSN.S. VERT. TRUSS COL. SECTIONS@ COL. LINE "D" (TYP.)[REF. NOTE 5d]HSS 6x6 HORZ. BM. (TYP.)[REF. NOTE 5b]HSS 6x6 TRUSS. COL. (TYP.)[REF. NOTE 5a]HSS 6x4 (LLH) GIRT FRMG.BTWN. COL.'s (TYP.)[REF. NOTE 6b]FOR REPAIRS TO EXIST. FRMG.REF. DETAIL 1-S1.10FOR REPAIRS TO EXIST. FRMG.REF. DETAIL 2-S1.10FOR REPAIRS TO EXIST. FRMG.REF. DETAIL 3-S1.10FOR REPAIRS TO EXIST. FRMG.REF. DETAIL 1-S1.11FOR REPAIRS TO EXIST. FRMG.REF. DETAIL 2-S1.1110.3107'-4"(*)[REF. PLAN]C EXIST. TRUSS "T1"L6'-8"(*)6'-8"(*)6'-8"(*)6'-8"(*)6'-8"(*)C EXIST. TRUSS "T2"LT.O.S. BASE PLATEEL 2'-0" (45.00')[*][TYP.]T.O. CONC. SLAB "H.P."EL 0'-0" (43.00')[*][REF. NOTE 1 - TYP.]023451EXIST. CONC. SLAB-ON-GRADE(REF. NOTE 1)EXIST. DOOR & STOREFRONTWINDOW ASSEMBLIES NOTSHOWN FOR CLARITYEXIST. CONC. PIER (TYP.)[REF. NOTE 2]EXIST. MAS. KNEE WALL (TYP.)[REF. NOTE 3]REF. NOTE 4HSS 6x6 TRUSS. COL. (TYP.)[REF. NOTE 5a]HSS 6x6 X.B. (TYP.)[REF. NOTE 5c]HSS 6x6 BM.'s (TYP.)[REF. NOTE 6a]HSS 6x6 HORZ. BM. (TYP.)[REF. NOTE 5b]ROOF TRUSS HSS 6x6 T&B CHORDSN.S. VERT. TRUSS COL. SECTIONS@ COL. LINE "D" (TYP.)[REF. NOTE 5d]HSS 6x4 GIRT FRMG. N.S. VERT.TRUSS COL. (REF. NOTE 6b)HSS 6x4 GIRT FRMG. N.S. VERT.TRUSS COL. (REF. NOTE 6b)FOR REPAIRS TO EXIST. TRUSSESREF. DETAIL 1-S1.09S1.01STRUCTURALEXIST. BLDG. A ROOF & EXTR. WALLFRMG. ELEVATIONS (SHT. 1 OF 2)1. REGARDING THE EXISTING SLAB-ON-GRADE FLOOR CONSTRUCTION RECORD DRAWING's REVIEWEDINDICATED THE FOLLOWING:a.) SLAB CONSTRUCTED 4" THK. (MIN.).b.) SLAB REINFORCED w/ 6x6 - W1.4 x W1.4 WELDED WIRE FABRIC @ MID-DEPTH OF THE SLAB.2. RECORD DRAWINGS REVIEWED INDICATED EXISTING C.I.P. REINFORCED CONCRETE PIERASSEMBLIES TRANSFER LOADS FROM THE THE EXISTING VERTICAL TRUSS COLUMNS TO EXISTINGSHALLOW FOUNDATION C.I.P. REINFORCED CONCRETE FOOTINGS. REGARDING THE EXISTING PIERASSEMBLIES CONSTRUCTION NOTE THE FOLLOWING:a.) PIER DIM.'s = 1'-4" SQUARE.b.) PIER REINF. = (8) #7 VERT. BARS INSTALLED (3) EA. FACE & #3 TIES SPA. @ 1'-0" O.C..3. REGARDING THE EXISTING MASONRY KNEE WALL AROUND THE NORTH, SOUTH & WEST SIDEEXTERIOR WALLS, RECORD DRAWINGS REVIEWED INDICATED THE FOLLOWING:a.) EXTERIOR SIDE FINISHES = 4" THK. SPLIT-FACE TYPE CMU.b.) INTERIOR SIDE FINISHES = 4" THK. SMOOTH FACED TYPE CMU.c.) TOP FINISHES = 4" THK. SOLID CMU COPING BLOCK.d.) WALL THK. = 1'-8"(*) THK. ASSEMBLY CONSISTING OF (1) 12" THK. INTERIOR COURSE BLOCK, (1) INTERIOR COURSE BLOCK & (1) EXTERIOR COURSE BLOCK AS PREVIOUSLY NOTED.e.) MASONRY THICKNESS DIM.'s INDICATED ARE NOMINAL.4. EXISTING ROOF DECK & ROOFING ASSEMBLIES NOT SHOWN FOR CLARITY. FIELD COORDINATEEXISTING MATERIALS AND DIMENSIONAL INFORMATION AS REQUIRED.5. REGARDING THE EXISTING STRUCTURAL STEEL TRUSS ASSEMBLIES RECORD DWG.'s REVIEWEDINDICATED THE FOLLOWING:a.) VERTICAL COLUMN SECTIONS @ COL. LINES "B" & "D" = HSS 6x6x38.b.) HORIZONTAL BEAM SECTIONS BTWN. TRUSSES = HSS 6x6x14.c.) DIAGONAL X-BRACE SECTIONS = HSS 6x6x14.d.) ROOF TRUSS CHORD SECTIONS = HSS 6x6x516.6. REGARDING THE EXISTING STRUCTURAL STEEL SECONDARY FRAMING SPANNING BETWEEN THETRUSSES AND THE BUILDING COL.'s AT THE EAST AND WEST WALLS, RECORD DRAWINGS REVIEWEDINDICATED THE FOLLOWING:a.) HSS BEAM SECTIONS BETWEEN THE TRUSS PAIRINGS = HSS 6x6x516.b.) HSS BEAM SECTIONS BETWEEN THE TRUSSES / COLUMNS = HSS 6x4x12 (LLH).7. " X " SYMBOL ON STEEL FRAMING ELEVATIONS INDICATES THE HEIGHT LEVEL IN THE REPAIR MARK#'s TO BE COORDINATED w/ THE REPAIR PROCEDURES ON DWG.'s S-1.03 TO S1.13.8. REGARDING THE STRUCTURAL STEEL W12 COL. ASSEMBLIES RECORD DWG.'s DID NOT APPEAR TOINDICATE A SEPARATE STEEL SECTION CONNECTING TO THE O/F OF THE EXTR. FLANGE OF THEW12. SITE REVIEWS APPEARED TO INDICATE THIS SECTION MAY BE AN HSS. FIELD COORDINATE ASREQUIRED FOR REPAIRING STEEL SECTIONS AT THESE COLUMN LOCATIONS.9. REFERENCE DWG. S0.00 FOR ADDITIONAL GENERAL NOTES, MATERIAL SPECIFICATIONS & REQUIREMENTS, DESIGN CRITERIA AND LEGEND.NOTES:DESCRIPTIONDATEREVISIONSSCALEHORIZONTAL:VERTICAL:STATUS:DRAWNPROJ. MGR. DESIGNEDCHECKEDPROJ. START DATE:MCE PROJ. #REV.NO.2021.NOV00992-0261LONG CENTER NATATORIUMSTRUCTURAL FRAME REPAIRSREVISIONDRAWING NUMBERwww.mckimcreed.comCA Lic. No. 29588Phone: (727) 442-7196, Fax: (727) 461-3827Clearwater, Florida 33756-33311365 Hamlet AvenueWFBWFBWFB / AEAAAHNAAS NOTED02 MAR 202290% DESIGN - NOT FOR CONSTRUCTIONA18 MAR 2022100% DESIGN - NOT FOR CONSTRUCTIONB09 MAY 2022FINAL DESIGN - FINAL REVIEW NOT FOR CONSTRUCTIONC23 MAY 2022FINAL DESIGN - RELEASED FOR BIDDRELEASED FOR BIDSTRUCTURALFINAL DESIGN SUBMITTALD1 - ELEVATION - TRUSS "T1" & "T2" SUPPT. FRMG. @ COL. LINE "D"SCALE: 3/16" = 1'-0"2 - ELEVATION - TRUSS "T1" & "T2" SUPPT. FRMG. @ COL. LINE "D"SCALE: 3/16" = 1'-0"3 - ELEVATION - TRUSS "T2" SUPPT. FRMG. @ COL. LINE "1"SCALE: 3/16" = 1'-0" C TRUSS HSS'sLAB6'-8"(*)6'-8"(*)6'-8"(*)6'-8"(*)6'-8"(*)6'-8"(*)C TRUSS HSS'sLDE6'-8"(*)B.220'-0"(*)B.420'-0"(*)B.520'-0"(*)B.720'-0"(*)B.920'-0"(*)[REF. PLAN][REF. PLAN][REF. PLAN][REF. PLAN][REF. PLAN][REF. PLAN]20'-0"(*)[REF. PLAN][REF. PLAN]C TRUSS HSS'sLC TRUSS HSS'sL[REF. PLAN]T.O.S. BASE PLATEEL 2'-0" (45.00')[*][TYP.]T.O. CONC. SLAB "H.P."EL 0'-0" (43.00')[*][REF. NOTE 1 - TYP.]EXIST. MAS. KNEE WALL (TYP.)[REF. NOTE 3]EXIST. CONC. SLAB-ON-GRADE(REF. NOTE 1)EXIST. CONC. PIER (TYP.)[REF. NOTE 2]ROOF TRUSS HSS 6x6 T&B CHORDSN.S. VERT. TRUSS COL. SECTIONS@ COL. LINE "D" (TYP.)[REF. NOTE 5d]HSS 6x6 HORZ. BM. (TYP.)[REF. NOTE 5b]HSS 6x6 TRUSS. COL. (TYP.)[REF. NOTE 5a]W12x40 STL. COL.'s (TYP. 5 PLCS.)[REF. NOTE 8]ROOF TRUSS HSS 6x6 T&B CHORDSN.S. VERT. TRUSS COL. SECTIONS@ COL. LINE "D" (TYP.)[REF. NOTE 5d]HSS 6x6 HORZ. BM. (TYP.)[REF. NOTE 5b]HSS 6x6 TRUSS. COL. (TYP.)[REF. NOTE 5a]023451HSS 6x4 (LLH) GIRT FRMG.BTWN. COL.'s (TYP.)[REF. NOTE 6b]FOR REPAIRS TO EXIST. FRMG.REF. DETAIL 3-S1.11FOR REPAIRS TO EXIST. FRMG.REF. DETAIL 1-S1.12FOR REPAIRS TO EXIST. FRMG.REF. DETAIL 2-S1.12FOR REPAIRS TO EXIST. FRMG.REF. DETAIL 1-S1.13FOR REPAIRS TO EXIST. FRMG.REF. DETAIL 2-S1.13C EXIST. TRUSS "T1"L1.317'-4"(*)6'-8"(*)6'-8"(*)6'-8"(*)6'-8"(*)6'-8"(*)C EXIST. TRUSS "T2"L[REF. PLAN]22.37'-4"(*)[REF. PLAN]16'-8"(*)[REF. PLAN]7'-4"(*)[REF. PLAN]16'-8"(*)[REF. PLAN]7'-4"(*)[REF. PLAN]16'-8"(*)[REF. PLAN]7'-4"(*)[REF. PLAN]16'-8"(*)[REF. PLAN]7'-4"(*)[REF. PLAN]16'-8"(*)[REF. PLAN]7'-4"(*)[REF. PLAN]16'-8"(*)[REF. PLAN]7'-4"(*)[REF. PLAN]16'-8"(*)[REF. PLAN]7'-4"(*)[REF. PLAN]16'-8"(*)[REF. PLAN]7'-4"(*)[REF. PLAN]C EXIST. TRUSS "T2"L16'-8"(*)[REF. PLAN]33.344.355.366.377.388.399.31010.3C EXIST. TRUSS "T1"LC EXIST. TRUSS "T1"LC EXIST. TRUSS "T1"LC EXIST. TRUSS "T1"LC EXIST. TRUSS "T1"LC EXIST. TRUSS "T1"LC EXIST. TRUSS "T1"LC EXIST. TRUSS "T1"LT.O. CONC. SLAB "H.P."EL 0'-0" (43.00')[*][REF. NOTE 1 - TYP.]EXIST. CONC. SLAB-ON-GRADE(REF. NOTE 1)EXIST. DOOR & STOREFRONTWINDOW ASSEMBLIES NOTSHOWN FOR CLARITYEXIST. CONC. PIER (TYP.)[REF. NOTE 2]EXIST. MAS. KNEE WALL(TYP.)[REF. NOTE 3]REF. NOTE 4HSS 6x6 TRUSS. COL.(TYP.)[REF. NOTE 5a]HSS 6x6 X.B. (TYP.)[REF. NOTE 5c]ROOF TRUSS HSS 6x6 T&B CHORDSN.S. VERT. TRUSS COL. SECTIONS@ COL. LINE "D" (TYP.)[REF. NOTE 5d]HSS 6x6 HORZ. BM. (TYP.)[REF. NOTE 5b]HSS 6x6 BM.'s (TYP.)[REF. NOTE 6a]T.O.S. BASE PLATEEL 2'-0" (45.00')[*][TYP.]023451FOR REPAIRS TO EXIST. TRUSSESREF. DETAILS 1 & 2 DWG.'s S1.04,S-1.05FOR REPAIRS TO EXIST. TRUSSESREF. DETAILS 1-S1.04 & 2-S1.04FOR REPAIRS TO EXIST. TRUSSESREF. DETAILS 1-S1.05 & 2-S1.05FOR REPAIRS TO EXIST. TRUSSESREF. DETAILS 1-S1.06 & 2-S1.06FOR REPAIRS TO EXIST. TRUSSESREF. DETAILS 1-S1.07 & 2-S1.07FOR REPAIRS TO EXIST. TRUSSESREF. DETAILS 1-S1.08 & 2-S1.08HSS 6x4 (LLH) GIRT FRMG.BTWN. COL.'s (TYP.)[REF. NOTE 6b]S1.02STRUCTURALEXIST. BLDG. A ROOF & EXTR. WALLFRMG. ELEVATIONS (SHT. 2 OF 2)1. FOR ELEVATION CALL-OUTS REFERENCING NOTES COORDINATE w/ THE DRAWING NOTES ONDRAWING S-1.01 FOR INFORMATION.2. REFERENCE DWG. S0.00 FOR ADDITIONAL GENERAL NOTES, MATERIAL SPECIFICATIONS &REQUIREMENTS, DESIGN CRITERIA AND LEGEND.NOTES:DESCRIPTIONDATEREVISIONSSCALEHORIZONTAL:VERTICAL:STATUS:DRAWNPROJ. MGR. DESIGNEDCHECKEDPROJ. START DATE:MCE PROJ. #REV.NO.2021.NOV00992-0261LONG CENTER NATATORIUMSTRUCTURAL FRAME REPAIRSREVISIONDRAWING NUMBERwww.mckimcreed.comCA Lic. No. 29588Phone: (727) 442-7196, Fax: (727) 461-3827Clearwater, Florida 33756-33311365 Hamlet AvenueWFBWFBWFB / AEAAAHNAAS NOTED02 MAR 202290% DESIGN - NOT FOR CONSTRUCTIONA18 MAR 2022100% DESIGN - NOT FOR CONSTRUCTIONB09 MAY 2022FINAL DESIGN - FINAL REVIEW NOT FOR CONSTRUCTIONC23 MAY 2022FINAL DESIGN - RELEASED FOR BIDDRELEASED FOR BIDSTRUCTURALFINAL DESIGN SUBMITTALD1 - ELEVATION - TRUSS "T2" SUPPT. FRMG. @ COL. LINE "10.3"SCALE: 3/16" = 1'-0"2 - ELEVATION - TRUSS "T1" & TRUSS "T2" SUPPT. FRMG. @ COL. LINE "B"SCALE: 1/8" = 1'-0" C EXIST. TRUSS "T2"L1.31C EXIST. TRUSS "T1"LEXIST. HSS BM.C HSS & L5LEXIST. HSS COL.EXIST. TRUSS BTM.CHORD (N.S. COL.)(TYP.)3/163/16(TYP.)3/16L5x5x14 x 412" LONG(TYP.)3/163/163/16(TYP.)EXIST. HSS BRACE(TYP.)EXIST. HSS BM.C HSS & BENT PLEXIST. HSS COL.EXIST. TRUSS BTM.CHORD (N.S. COL.)1'-3"x9"x14" THK. x 412" LONGBENT P3/16LL9"C HSS & PLLC HSS & PLL14" THK. WING P(T&B)L4 "( T Y P . ) 2 1/4" (TYP.)PLATE LAYOUTBENT. PTO CHORD(TYP.)3/163/163/16WELD REQ.'sL3/163 SIDES(TYP.)P TO P(TYP.)LLBENT. PTO CHORD(TYP.)L3 3/4"(TYP.)3 SIDES(TYP.)EXIST. HSS BRACE(TYP.)EXIST. HSS BM.C HSS & L5LC HSS & PLLC HSS & PLL14" THK. WING P's (T&B)[REF. DETAIL 3-S1.03(SIM.)]LEXIST. HSS COL.EXIST. HSS BM.(N.S. COL.)REF. NOTE 4(TYP.)L5 (REF. DETAIL 2-S1.03)[SIM.]EXIST. HSS BRACE(TYP.)EXIST. HSS BM.EXIST. HSS COL.EXIST. HSS BRACEREMOVE EXIST. SURFACERUST, PREP STL. & APPLYNEW COATING (REF. NOTE 6)EXIST. HSS BM.C HSS & PLC HSS & PLL14" THK. WING P(REF. DETAIL 3-S1.03)[SIM.]LEXIST. HSS COL.EXIST. HSS BM.(N.S. COL.)REF. NOTE 414" THK. BENT P(REF. DETAIL 4-S1.03)[SIM.]LREF. NOTE 5 FOR REPAIROF EXIST. HOLE PRIOR TOPLATE INSTALLATIONSLWELD CONN. P TO BM.(REF. DETAIL 4-S1.03)[SIM.]LEXIST. HSS BRACE(TYP.)EXIST. HSS BM.C HSS & PLL14" THK. WING P's (T&B)[REF. DETAIL 3-S1.03][SIM.]LEXIST. HSS COL.EXIST. HSS BM.(N.S. COL.)REF. NOTE 49"x5"x14" THK. x 412" LONGBENT PL9"C HSS & PLLC HSS & PLLWELD CONN. P TO BM.(REF. DETAIL 3-S1.03)[SIM.]LEXIST. HSS BRACE(TYP.)S1.03STRUCTURALEXIST. BLDG. A TRUSS CONDITIONS &REPAIRS (SHT. 1 OF 11)1. IN GENERAL REPAIR OF THE EXISTING STRUCTURAL STEEL TRUSSES AND THE SECONDARYEXTERIOR WALL BEAMS INVOLVES REPAIRS TO INTERIOR VERTICAL, HORIZONTAL & DIAGONALSURFACES OF THE TRUSSES, COLUMNS, CONNECTION PLATES OR ANGLES, BASE PLATES ANDANCHOR BOLTS AND HARDWARE U.N.O.. IN GENERAL REPAIR WORK INCLUDES THE FOLLOWING:a.) REMOVING EXISTING COATINGS TO BARE METAL.b.) REMOVING SURFACE RUST OR THRU WALL RUST AND CLEANING SURFACES TO BARE METAL.c.) PREPARING BARE METAL SURFACES TO SSPC-SP6 "COMMERCIAL BLAST CLEANING" CRITERIA.d.) WELDING NEW STEEL PLATE OR ANGLE SECTIONS TO THE EXISTING STEEL SECTIONS.REGARDING FIELD WELDING AND PREPARATION TO SSPC-SP6 CRITERIA, THE MAXIMUM BASEMETAL TEMPERATURE AT DEMARCATION BETWEEN BRIGHT METAL AND THE EXISTING COATINGSTO BE CONFIRMED w/ THE USE OF 182° F TEMPILSTIK's BETWEEN WELD PASSES.e.) INSTALL NEW COATING SYSTEM ON THE REPAIRED AREAS TO MATCH2. CODE FOR UTILIZING TRUSS CONNECTION LOCATIONS MARK NUMBERS AS FOLLOWS:a.) COL. ID E/W DIRECTION - COL. ID N/S DIRECTION - TRUSS TYPE - ELEVATION ABOVE BASE PLATE.b.) COORDINATE w/ TRUSS ELEVATIONS DWG.'s S-1.01 & S-1.02 FOR HEIGHT CODES 0 TO 5.c.) COORDINATE w/ THE "TRUSS CONN. LOCATION MK. # LEGEND EXAMPLE" THIS DWG. FORADDITIONAL INFORMATION.NOTES:DESCRIPTIONDATEREVISIONSSCALEHORIZONTAL:VERTICAL:STATUS:DRAWNPROJ. MGR. DESIGNEDCHECKEDPROJ. START DATE:MCE PROJ. #REV.NO.2021.NOV00992-0261LONG CENTER NATATORIUMSTRUCTURAL FRAME REPAIRSREVISIONDRAWING NUMBERwww.mckimcreed.comCA Lic. No. 29588Phone: (727) 442-7196, Fax: (727) 461-3827Clearwater, Florida 33756-33311365 Hamlet AvenueWFBWFBWFB / AEAAAHNAAS NOTED02 MAR 202290% DESIGN - NOT FOR CONSTRUCTIONA18 MAR 2022100% DESIGN - NOT FOR CONSTRUCTIONB09 MAY 2022FINAL DESIGN - FINAL REVIEW NOT FOR CONSTRUCTIONC23 MAY 2022FINAL DESIGN - RELEASED FOR BIDDRELEASED FOR BIDSTRUCTURALFINAL DESIGN SUBMITTALD1 - DETAIL - TRUSS "T1" & "T2" @ COL. LINE "D"SCALE: 1/4" = 1'-0"RUST / CORROSION @WEST FACE OF TRUSSBTM. CHORDRUST / CORROSION @NORTH FACE OF HORZ.BM.MK. D-1.3-T1-4VERIFY CONDITION OFT.O. CHORD DOES NOTREQUIRE REPAIR(REF. NOTE ?)MK. D-1-T2-4RUST / CORROSION @EAST FACE OF TRUSSBTM. CHORDRUST / CORROSION @NORTH FACE OF HORZ BM.RUST / CORROSIONNORTH FACE OFDIAGONALS (T&B)MK. D-1-T2-2RUST / CORROSION @EAST FACE OF HSS BM.RUST / CORROSION @NORTH FACE OF HORZ. BM.RUST / CORROSIONNORTH FACE OFDIAGONALS (T&B)REF. DETAIL 2-S1.03REF. DETAIL 3-S1.03REF. DETAIL 5-S1.03RUST / CORROSION @NORTH FACE OF HORZ.BM. TOP RADIUSMK. D-1.3-T1-1RUST / CORROSION @NORTH FACE OFDIAGONAL ALONG BTM.RADIUSREF. DETAIL 6-S1.03REF. DETAIL 7-S1.03RUST / CORROSION @NORTH FACE OF HORZ. BM.& EAST FACE OF COL. @THRU WALL HOLE @ B.O. BM.RUST / CORROSION @EAST FACE OF HSS BM.RUST / CORROSIONNORTH FACE OFDIAGONALS (T&B)2 - DETAIL - D-1.3-T1-4 REPAIRSCALE: 3/4" = 1'-0"3 - DETAIL - D-1-T2-4 REPAIRSCALE: 3/4" = 1'-0"NOTES CTD. ...3. REGARDING VERIFYING CONDITION OF EXISTING STEEL, NOTE THE FOLLOWING:a.) DURING SITE VISITS NOT ALL AREAS OF THE EXISTING FACILITY COULD BE EASILY ACCESSED SAFELY w/ THE LIFT.b.) CONTRACTOR TO VERIFY IF EXISTING TOP CHORDS EXHIBITING SIGNS OF RUST, CORROSION OR LOSS OF COATING.c.) NOTIFY ENGINEER OF AREAS THAT ARE NOT CURRENTLY INDICATED BUT DISPLAY RUST,CORROSION, AND / OR COATING PEELING OR LOSS FOR DIRECTIONS HOW TO PROCEED.4. COORDINATE w/ DETAILS REFERENCED FOR ANGLE / PLATE LAYOUT DIM.'s & WELD REQ.'s. U.N.O..5. IN GENERAL REPAIR THE EXISTING HOLE BY PREPARING THE HOLE EDGES TO NON-CORRODEDSTEEL, FILLING THE INTERNAL VOLUME OF THE HSS w/ GROUT & INSTALLING STEEL PLATE REPAIRS.NOTE THE FOLLOWING:a.) REMOVE ALL LOOSE SURFACE RUST & CORROSION FROM THE HSS BEAM.b.) ENLARGE EXISTING HOLE BY GRINDING EXIST. HSS WALL BACK TO FULL THK. OF THE HSS WALL.c.) CUT CARDBOARD GROUT DAM SECTIONS TO THE INTERIOR PROFILE OF THE HSS BEAMS &COLUMN RESPECTIVELY. USE THE CARDBOARD GROUT DAMS w/ EXPANSION FOAM TO SEAL THEINTERNAL VOLUME OF THE BEAMS & COLUMN TO BE GROUTED. POSITION DAMS TO 4" (MIN.)FROM THE EDGE OF THE HOLE. FILL THE INTERNAL VOLUME BETWEEN THE DAMS w/ NON-SHRINKGROUT, CURE & FINISH SMOOTH TO THE O/F OF THE HSS STEEL WALLS.d.) INSTALL THE PLATE REPAIRS INDICATED.5 - DETAIL - D-1-T2-2 REPAIRSCALE: 3/4" = 1'-0"6 - DETAIL - D-1.3-T1-1 REPAIRSCALE: 3/4" = 1'-0"7 - DETAIL - D-1-T2-1 REPAIRSCALE: 3/4" = 1'-0"MK. D-1-T2-1MK. D-1-T2-3RUST / CORROSION @EAST FACE OF HSS BM.RUST / CORROSIONNORTH FACE OFDIAGONALS (T&B)RUST / CORROSION @NORTH FACE OF HSS BM.& DIAGONAL & ALONGBTM. RADIUS4 - DETAIL - D-1-T2-3 REPAIRSCALE: 3/4" = 1'-0"REF. DETAIL 4-S1.03NOTES CTD. ...6. PLATE OR ANGLE ASSEMBLIES NOT REQUIRED PROVIDED REMOVAL OF THE EXISTINGCOATING / CORROSION & SURFACE PREP DOES NOT YIELD UNEXPECTED RESULTS & REPAIRSCANNOT BE INSTALLED AS NOTED.7. " " SYMBOL ON DRAWING INDICATES MARK NO. FOR BASE PLATE REPAIRS. REFERENCEDRAWING S-1.09 "KEY NOTES - COLUMN BASE PLATE REPAIRS" AND APPLICABLE SECTIONS& DETAILS AS REQUIRED.8. REFERENCE DWG. S0.00 FOR ADDITIONAL GENERAL NOTES, MATERIAL SPECIFICATIONS &REQUIREMENTS, DESIGN CRITERIA AND LEGEND.ESTIMATED BILL OF MATERIALS ... S1.03ITEM #01COMPONENTANGLE SECTION0203NOTESQTY.DESCRIPTIONL5x5x14" x 412"BENT PLATE1'-3"x9"x14" x 412"FILLET WELD316" EFF. THROAT040607WING PLATE0'-4"x0'-334"x14"BUTT WELDCOMPLETE PEN.FLARE BEVEL WELDPARTIAL PEN.BENT PLATE0'-9"x5"x14" x 412"VERIFY CONDITION OFT.O. CHORD DOES NOTREQUIRE REPAIR(REF. NOTE 3) [TYP.]1X1TRUSS CONN. LOCATION MK. # LEGEND EXAMPLE:TRUSS CONNECTION LOCATION MK. # = D-1.3-T1-4D = EAST / WEST ORIENTED COLUMN LINE DIRECTION ON PLAN 1-S1.00.1.3 = NORTH / SOUTH ORIENTED COLUMN LINE DIRECTION ON PLAN 1-S1.00.T1= EXISTING TRUSS TYPE T1 OR T2 AS NOTED ON PLAN 1-S1.00 & TRUSS DETAIL ELEVATIONS.4= ELEVATION ABOVE THE EXISTING SLAB-ON-GRADE AS INDICATED w/ " X " SYMBOL ON DWG.'s S1.01 & S1.02.S / N= SOUTH / NORTH SIDE OF THE EXISTING COLUMN.052127225"20"30" C EXIST. TRUSS "T1"L11.3C EXIST. TRUSS "T2"L22.3C EXIST. TRUSS "T1"LC EXIST. TRUSS "T1"LEXIST. HSS BM.EXIST. HSS COL.EXIST. HSS BRACEREMOVE EXIST. SURFACERUST, PREP STL. & APPLYNEW COATING (REF. NOTE 6)EXIST. TRUSS HSS TOPCHORD (N.S. COL.).EXIST. HSS BM.REMOVE EXIST. COATING,SURFACE RUST, PREP STL. &APPLY NEW COATING(REF. NOTES 5 & 6)EXIST. HSS COL.EXIST. HSS BRACEEXIST. TRUSS HSS BTM.CHORD (N.S. COL.).REMOVE EXIST. COATING,SURFACE RUST, PREP STL. &APPLY NEW COATING(REF. NOTE 5)[2'-0" (MIN.) LENGTH]EXIST. HSS BRACEEXIST. HSS BM.EXIST. HSS BM.EXIST. HSS COL.EXIST. HSS BRACEEXIST. PIPE SUPPT.BRACKET (N.S. COL.).EXIST. HSS BRACEEXIST. HSS BM.6"2 1/2"1 3/4"L812"x212"x14" THK. PL(2) 4"x134"x14" THK. WING P's(1 N.S. & 1 F.S.)P TO P(TYP.)LL3/163 SIDESEA. P(TYP.)LC HSS & PLLREF. NOTE 714" THK. WING P's (T&B)[REF. DETAIL 4-S1.03][SIM.]LEXIST. HSS BM.EXIST. HSS COL.EXIST. HSS BRACEEXIST. HSS BRACEEXIST. HSS BM.(N.S. COL.)C HSS & L5LC HSS & PLLC HSS & PLLREF. NOTE 4L5 (REF. DETAILS 2-S1.03 & 5-S1.03)[SIM.]REMOVE EXIST. SURFACERUST, PREP STL. & APPLYNEW COATING @COL. / DIAGONAL BRACE(REF. NOTE 6)14" THK. WING P's (T&B)[REF. DETAIL 4-S1.03][SIM.]LEXIST. HSS BM.EXIST. HSS COL.EXIST. HSS BRACEEXIST. HSS BRACEEXIST. HSS BM.(N.S. COL.)C HSS & L5LC HSS & PLLC HSS & PLLREF. NOTE 4L5 (REF. DETAILS 2-S1.03 & 5-S1.03)[SIM.]REMOVE EXIST. SURFACERUST, PREP STL. & APPLYNEW COATING @COL. / DIAGONAL BRACE(REF. NOTES 6 & 7)14" THK. WING P's (T&B)[REF. DETAIL 4-S1.03][SIM.]LEXIST. HSS BM.EXIST. HSS COL.EXIST. HSS BRACEEXIST. HSS BRACEEXIST. HSS BM.(N.S. COL.)C HSS & BENT PLC HSS & PLLC HSS & PLLREF. NOTE 49"x5"x14" x 412" LONG BENT P(REF. DETAILS 3-S1.03 & 5-S1.03)[SIM.]LL5"REF. NOTE 7EXIST. HSS BM.EXIST. HSS COL.EXIST. HSS BRACEEXIST. PIPE SUPPT.BRACKET (N.S. COL.).EXIST. HSS BRACEEXIST. HSS BM.C HSS & PLLREF. NOTE 7P's (REF. DETAIL 5-S1.04)[SIM.]REF. NOTE 4LS1.04STRUCTURALEXIST. BLDG. A TRUSS CONDITIONS &REPAIRS (SHT. 2 OF 11)1. IN GENERAL REPAIR OF THE EXISTING STRUCTURAL STEEL TRUSSES AND THE SECONDARYEXTERIOR WALL BEAMS INVOLVES REPAIRS TO INTERIOR VERTICAL, HORIZONTAL & DIAGONALSURFACES OF THE TRUSSES, COLUMNS, CONNECTION PLATES OR ANGLES, BASE PLATES ANDANCHOR BOLTS AND HARDWARE U.N.O.. IN GENERAL REPAIR WORK INCLUDES THE FOLLOWING:a.) REMOVING EXISTING COATINGS TO BARE METAL.b.) REMOVING SURFACE RUST OR THRU WALL RUST AND CLEANING SURFACES TO BARE METAL.c.) PREPARING BARE METAL SURFACES TO SSPC-SP6 "COMMERCIAL BLAST CLEANING" CRITERIA.d.) WELDING NEW STEEL PLATE OR ANGLE SECTIONS TO THE EXISTING STEEL SECTIONS.REGARDING FIELD WELDING AND PREPARATION TO SSPC-SP6 CRITERIA, THE MAXIMUM BASEMETAL TEMPERATURE AT DEMARCATION BETWEEN BRIGHT METAL AND THE EXISTING COATINGSTO BE CONFIRMED w/ THE USE OF 182° F TEMPILSTIK's BETWEEN WELD PASSES.e.) INSTALL NEW COATING SYSTEM ON THE REPAIRED AREAS TO MATCH2. CODE FOR UTILIZING TRUSS CONNECTION LOCATIONS MARK NUMBERS AS FOLLOWS:a.) COL. ID E/W DIRECTION - COL. ID N/S DIRECTION - TRUSS TYPE - ELEVATION ABOVE BASE PLATE.b.) COORDINATE w/ TRUSS ELEVATIONS DWG.'s S-1.01 & S-1.02 FOR HEIGHT CODES 0 TO 5.c.) COORDINATE w/ THE "TRUSS CONN. LOCATION MK. # LEGEND EXAMPLE" DWG. S1.03 FORADDITIONAL INFORMATION.NOTES:DESCRIPTIONDATEREVISIONSSCALEHORIZONTAL:VERTICAL:STATUS:DRAWNPROJ. MGR. DESIGNEDCHECKEDPROJ. START DATE:MCE PROJ. #REV.NO.2021.NOV00992-0261LONG CENTER NATATORIUMSTRUCTURAL FRAME REPAIRSREVISIONDRAWING NUMBERwww.mckimcreed.comCA Lic. No. 29588Phone: (727) 442-7196, Fax: (727) 461-3827Clearwater, Florida 33756-33311365 Hamlet AvenueWFBWFBWFB / AEAAAHNAAS NOTED02 MAR 202290% DESIGN - NOT FOR CONSTRUCTIONA18 MAR 2022100% DESIGN - NOT FOR CONSTRUCTIONB09 MAY 2022FINAL DESIGN - FINAL REVIEW NOT FOR CONSTRUCTIONC23 MAY 2022FINAL DESIGN - RELEASED FOR BIDDRELEASED FOR BIDSTRUCTURALFINAL DESIGN SUBMITTALD1 - DETAIL - TRUSS "T1" & "T2" @ COL. LINE "B"SCALE: 1/4" = 1'-0"RUST / CORROSION @SOUTH FACE OFDIAGONALRUST / CORROSION @SOUTH FACE OF HORZ.BM.MK. B-1-T2-5VERIFY CONDITION OFT.O. CHORD DOES NOTREQUIRE REPAIR(REF. NOTE 3)MK. B-1.3-T1-4RUST / CORROSION @WEST FACE & BTM. FACEOF TRUSS BTM. CHORDRUST / CORROSION @SOUTH FACE OF HORZ BM.UNDER BLISTERED COATINGVERIFY CONDITION OFT.O. CHORD & EAST FACEOF CHORD REQUIREREPAIR (REF. NOTE 3)REF. DETAIL 4-S1.04RUST / CORROSION @SOUTH FACE OF HORZ.BM. UNDER BLISTEREDCOATINGREF. DETAIL 9-S1.04RUST / CORROSION @ SOUTH FACE OF HORZ. BM.& @ BTM. RADIUS2 - DETAIL - TRUSS "T1" @ COL. LINE "B"SCALE: 1/4" = 1'-0"NOTES CTD. ...3. REGARDING VERIFYING CONDITION OF EXISTING STEEL, NOTE THE FOLLOWING:a.) DURING SITE VISITS NOT ALL AREAS OF THE EXISTING FACILITY COULD BE EASILY ACCESSED SAFELY w/ THE LIFT.b.) CONTRACTOR TO VERIFY IF EXISTING TOP CHORDS EXHIBITING SIGNS OF RUST, CORROSION OR LOSS OF COATING.c.) NOTIFY ENGINEER OF AREAS THAT ARE NOT CURRENTLY INDICATED BUT DISPLAY RUST,CORROSION, AND / OR COATING PEELING OR LOSS FOR DIRECTIONS HOW TO PROCEED.4. COORDINATE w/ DETAILS REFERENCED FOR ANGLE / PLATE LAYOUT DIM.'s & WELD REQ.'s. U.N.O..5. IF COATING REMOVAL YIELDS SURFACE PITTING GRIND SMOOTH & TO SURFACE PREP. REQ.'s.6. PLATE OR ANGLE ASSEMBLIES NOT REQUIRED PROVIDED REMOVAL OF THE EXISTINGCOATING / CORROSION & SURFACE PREP DOES NOT YIELD UNEXPECTED RESULTS & REPAIRSCANNOT BE INSTALLED AS NOTED.7. REMOVE & REINSTALL EXIST. WINDOW GLASS & FRAME TO REPAIR IF REQ'D.8. REFERENCE DWG. S1.09 FOR "ESTIMATED BILL OF MATERIALS" TABLE.9. " " SYMBOL ON DRAWING INDICATES MARK NO. FOR BASE PLATE REPAIRS. REFERENCEDRAWING S-1.09 "KEY NOTES - COLUMN BASE PLATE REPAIRS" AND APPLICABLE SECTIONS& DETAILS AS REQUIRED.10. REFERENCE DWG. S0.00 FOR ADDITIONAL GENERAL NOTES, MATERIAL SPECIFICATIONS & REQUIREMENTS, DESIGN CRITERIA AND LEGEND.REF. DETAIL 3-S1.04RUST / CORROSION @SOUTH FACE & ALONGBTM. RADIUS OFHORZ. BM.3 - DETAIL - B-1-T2-5 REPAIRSCALE: 3/4" = 1'-0"4 - DETAIL - B-1.3-T1-4 REPAIRSCALE: 3/4" = 1'-0"REF. DETAIL 5-S1.04MK. B-1.3-T1-3RUST / CORROSION @SOUTH FACE OF THECOL. UNDER THEBLISTERED COATING5 - DETAIL - B-1.3-T1-3 REPAIRSCALE: 3/4" = 1'-0"RUST / CORROSION @EAST FACE OF HORZ. BM.RUST / CORROSION @SOUTH FACE OFCOL. / DIAGONALINTERSECT & RADIUSMK. B-1-T2-3REF. DETAIL 6-S1.046 - DETAIL - B-1-T2-3 REPAIRSCALE: 3/4" = 1'-0"REF. DETAIL 7-S1.04MK. B-1-T2-2RUST / CORROSION @SOUTH FACE OF HORZ.BM. & T.O. DIAGONALINTERSECTRUST / CORROSION @EAST FACE OF HORZ. BM.RUST / CORROSION @SOUTH FACE OFDIAGONAL (T&B)7 - DETAIL - B-1-T2-2 REPAIRSCALE: 3/4" = 1'-0"REF. DETAIL 8-S1.04MK. B-1-T2-1RUST / CORROSION @EAST FACE OF HORZ. BM.RUST / CORROSION @SOUTH FACE OF HORZ.BM.RUST / CORROSION @SOUTH FACE OFBM. / DIAGONALINTERSECT8 - DETAIL - B-1-T2-1 REPAIRSCALE: 3/4" = 1'-0"MK. B-1.3-T1-19 - DETAIL - B-1.3-T1-1 REPAIRSCALE: 3/4" = 1'-0"REF. DETAIL 9-S1.04(SIM.)[ORIENT. w/ WING PLATE UP]MK. B-2-T1-3REF. DETAIL 9-S1.04(SIM.)[REF. NOTES 5 & 6]RUST / CORROSION @SOUTH FACE OF COL.RUST / CORROSION @TOP RADIUS OF THE BM.BLISTERED COATINGMK. B-2-T1-1MK. B-2.3-T1-3BLISTERED COATINGSOUTH FACE OF COL. &HORZ. BM.RUST / CORROSION @SOUTH FACE OF HORZ.BM. UNDER BLISTEREDCOATINGRUST / CORROSION @COL. RADIUS UNDER THEBLISTERED COATINGREF. DETAIL 5-S1.04(SIM.)RUST / CORROSION @COL. RADIUSREF. DETAIL 5-S1.04MK. B-2.3-T1-2(SIM.)RUST / CORROSION @SOUTH FACE OF HORZ.BM. UNDER BLISTEREDCOATINGRUST / CORROSION @COL. RADIUS UNDER THEBLISTERED COATINGRUST / CORROSION @COL. RADIUS (T&B)REF. DETAIL 5-S1.04(SIM.)MK. B-2.3-T1-1RUST / CORROSION @COL. RADIUS (T&B)RUST / CORROSION @SOUTH FACE OF HORZ.BM. UNDER BLISTEREDCOATINGVERIFY CONDITION OFT.O. CHORD DOES NOTREQUIRE REPAIR(REF. NOTE 3) [TYP.]3X444ESTIMATED BILL OF MATERIALS ... S1.04ITEM #01COMPONENTANGLE SECTION020304NOTESQTY.DESCRIPTIONL5x5x14" x 412"PLATE0'-812"x212"x14"FILLET WELD316" EFF. THROAT050607WING PLATE0'-4"x334"x14"BUTT WELDCOMPLETE PEN.FLARE BEVEL WELDPARTIAL PEN.BENT PLATE0'-9"x5"x14" x 4 12"271WING PLATE0'-4"x134"x14"08610335"40"80"BENT PLATE0'-6"x212"x38" x 212"1BENT PLATE0'-6"x212"x38" x 512"611120910FILLET WELD14" EFF. THROAT15"FILLET WELD516" EFF. THROAT20" 33.3C EXIST. TRUSS "T1"LC EXIST. TRUSS "T1"L44.3C EXIST. TRUSS "T1"LC EXIST. TRUSS "T1"LEXIST. HSS BM.REMOVE EXIST. COATING,SURFACE RUST, PREP STL. &APPLY NEW COATING(REF. NOTE 6)EXIST. HSS COL.EXIST. HSS BRACEEXIST. TRUSS HSS BTM.CHORD (N.S. COL.).REMOVE EXIST. COATING,SURFACE RUST, PREP STL. &APPLY NEW COATING(REF. NOTE 5)[2'-0" (MIN.) LENGTH]EXIST. HSS BRACEEXIST. HSS BM.EXIST. HSS BM.EXIST. HSS COL.EXIST. HSS BRACEEXIST. TRUSS HSS BTM.CHORD (N.S. COL.).REMOVE EXIST. COATING,SURFACE RUST, PREP STL. &APPLY NEW COATING(REF. NOTE 5)[2'-0" (MIN.) LENGTH]EXIST. HSS BRACEEXIST. HSS BM.L5x5x14 x 412" LONG(TYP. 3 SIDES BTM. CHORD)[REF. NOTE 8]C HSS & L5LC HSS & L5'sLREF. NOTE 7S1.05STRUCTURALEXIST. BLDG. A TRUSS CONDITIONS &REPAIRS (SHT. 3 OF 11)1. IN GENERAL REPAIR OF THE EXISTING STRUCTURAL STEEL TRUSSES AND THE SECONDARYEXTERIOR WALL BEAMS INVOLVES REPAIRS TO INTERIOR VERTICAL, HORIZONTAL & DIAGONALSURFACES OF THE TRUSSES, COLUMNS, CONNECTION PLATES OR ANGLES, BASE PLATES ANDANCHOR BOLTS AND HARDWARE. IN GENERAL REPAIR WORK INCLUDES THE FOLLOWING:a.) REMOVING EXISTING COATINGS TO BARE METAL.b.) REMOVING SURFACE RUST OR THRU WALL RUST AND CLEANING SURFACES TO BARE METAL.c.) PREPARING BARE METAL SURFACES TO SSPC-SP6 "COMMERCIAL BLAST CLEANING" CRITERIA.d.) WELDING NEW STEEL PLATE OR ANGLE SECTIONS TO THE EXISTING STEEL SECTIONS.REGARDING FIELD WELDING AND PREPARATION TO SSPC-SP6 CRITERIA, THE MAXIMUM BASEMETAL TEMPERATURE AT DEMARCATION BETWEEN BRIGHT METAL AND THE EXISTING COATINGSTO BE CONFIRMED w/ THE USE OF 182° F TEMPILSTIK's BETWEEN WELD PASSES.e.) INSTALL NEW COATING SYSTEM ON THE REPAIRED AREAS TO MATCH2. CODE FOR UTILIZING TRUSS CONNECTION LOCATIONS MARK NUMBERS AS FOLLOWS:a.) COL. ID E/W DIRECTION - COL. ID N/S DIRECTION - TRUSS TYPE - ELEVATION ABOVE BASE PLATE.b.) COORDINATE w/ TRUSS ELEVATIONS DWG.'s S-1.01 & S-1.02 FOR HEIGHT CODES 0 TO 5.c.) COORDINATE w/ THE "TRUSS CONN. LOCATION MK. # LEGEND EXAMPLE" DWG. S1.03 FORADDITIONAL INFORMATION.NOTES:DESCRIPTIONDATEREVISIONSSCALEHORIZONTAL:VERTICAL:STATUS:DRAWNPROJ. MGR. DESIGNEDCHECKEDPROJ. START DATE:MCE PROJ. #REV.NO.2021.NOV00992-0261LONG CENTER NATATORIUMSTRUCTURAL FRAME REPAIRSREVISIONDRAWING NUMBERwww.mckimcreed.comCA Lic. No. 29588Phone: (727) 442-7196, Fax: (727) 461-3827Clearwater, Florida 33756-33311365 Hamlet AvenueWFBWFBWFB / AEAAAHNAAS NOTED02 MAR 202290% DESIGN - NOT FOR CONSTRUCTIONA18 MAR 2022100% DESIGN - NOT FOR CONSTRUCTIONB09 MAY 2022FINAL DESIGN - FINAL REVIEW NOT FOR CONSTRUCTIONC23 MAY 2022FINAL DESIGN - RELEASED FOR BIDDRELEASED FOR BIDSTRUCTURALFINAL DESIGN SUBMITTALD1 - DETAIL - TRUSS "T1" COL. LINE "B"SCALE: 1/4" = 1'-0"RUST / CORROSION @SOUTH FACE OF HORZ.BM. & BTM. RADIUSVERIFY CONDITION OFT.O. CHORD DOES NOTREQUIRE REPAIR(REF. NOTE 3)RUST / CORROSION @SOUTH FACE OF COL. &TRUSS BTM. CHORDINTERSECT (4) SIDESRUST / CORROSIONSOUTH FACE OF BM. &COL. INTERSECTREF. DETAIL 3-S1.05REF. DETAIL 3-S1.05RUST / CORROSION @SOUTH FACE OF COL. &COL. RADIUS2 - DETAIL - TRUSS "T1" @ COL. LINE "B"SCALE: 1/4" = 1'-0"NOTES CTD. ...3. REGARDING VERIFYING CONDITION OF EXISTING STEEL, NOTE THE FOLLOWING:a.) DURING SITE VISITS NOT ALL AREAS OF THE EXISTING FACILITY COULD BE EASILY ACCESSED SAFELY w/ THE LIFT.b.) CONTRACTOR TO VERIFY IF EXISTING TOP CHORDS EXHIBITING SIGNS OF RUST, CORROSION OR LOSS OF COATING.c.) NOTIFY ENGINEER OF AREAS THAT ARE NOT CURRENTLY INDICATED BUT DISPLAY RUST,CORROSION, AND / OR COATING PEELING OR LOSS FOR DIRECTIONS HOW TO PROCEED.4. COORDINATE w/ DETAILS REFERENCED FOR ANGLE / PLATE LAYOUT DIM.'s & WELD REQ.'s. U.N.O..5.IF COATING REMOVAL YIELDS SURFACE PITTING GRIND SMOOTH & TO SURFACE PREP. REQ.'s.6.PLATE OR ANGLE ASSEMBLIES NOT REQUIRED PROVIDED REMOVAL OF THE EXISTINGCOATING / CORROSION & SURFACE PREP DOES NOT YIELD UNEXPECTED RESULTS & REPAIRSCANNOT BE INSTALLED AS NOTED.7. REMOVE & REINSTALL EXIST. WINDOW GLASS & FRAME TO REPAIR IF REQ'D.8. WELD L5's TO HSS TRUSS CHORD, COL. & HORZ. BM. REF. DETAIL 2-S1.03 FOR WELD REQ.'s & INFO.9. REFERENCE DWG. S0.00 FOR ADDITIONAL GENERAL NOTES, MATERIAL SPECIFICATIONS &REQUIREMENTS, DESIGN CRITERIA AND LEGEND.MK. B-3-T1-5VERIFY CONDITION OFT.O. CHORD DOES NOTREQUIRE REPAIR(REF. NOTE 3)MK. B-3-T1-4MK. B-3.3-T1-5RUST / CORROSION @ B.O.TRUSS BTM. CHORDUNDER BLISTEREDCOATINGRUST / CORROSION @SOUTH FACE OF HORZ. BM.UNDER BLISTERED COATINGREF. DETAIL 3-S1.05MK. B-3-T1-2(SIM.)[NOTE 6 ONLY]3 - DETAIL - B-3-T1-4 REPAIRSCALE: 3/4" = 1'-0"(SIM.)MK. B-3.3-T1-4REF. DETAIL 4-S1.05MK. B-4-T1-4RUST / CORROSION @ B.O.TRUSS BTM. CHORD UNDERBLISTERED COATINGRUST / CORROSION @SOUTH FACE OF COL. / HORZ. BM. & T.O. BTM.CHORDMK. B-4-T1-3RUST / CORROSION @SOUTH FACE OF HORZ.BM. & T&B RADIUSRUST / CORROSION @SOUTH FACE OF COL.RADIUSRUST / CORROSION @SOUTH FACE OF COL. &COL. RADIUS4 - DETAIL - B-4-T1-4 REPAIRSCALE: 3/4" = 1'-0"REF. DETAIL 5-S1.04(SIM.)REF. DETAIL 5-S1.04MK. B-4-T1-1RUST / CORROSION @SOUTH FACE OF HORZ.BM. & T&B RADIUSRUST / CORROSION @SOUTH FACE OF COL.RADIUSRUST / CORROSION @SOUTH FACE OF COL. &COL. RADIUS(SIM.)VERIFY CONDITION OFT.O. CHORD DOES NOTREQUIRE REPAIR(REF. NOTE 3)MK. B-4.3-T1-5MK. B-4.3-T1-4RUST / CORROSION @ B.O.TRUSS BTM. CHORD UNDERBLISTERED COATINGRUST / CORROSION @SOUTH FACE OF HORZ. BM.UNDER BLISTEREDCOATINGREF. DETAIL 3-S1.05(SIM.)MK. B-4.3-T1-3RUST / CORROSION @SOUTH FACE OF HORZ. BM.& BTM. RADIUSREF. DETAIL 3-S1.04(SIM.)MK. B-4.3-T1-2RUST / CORROSION @SOUTH FACE OF HORZ. BM.& COL. INTERSECT & ALONGTHE COL. & BM.RUST / CORROSION @ COL.& BM. TOP RADIUSRUST / CORROSION @ PIPESUPPT. BRACKET & SOUTHFACE OF COL.REF. DETAIL 9-S1.04(SIM.)[ORIENT. WING PLATE UP]ESTIMATED BILL OF MATERIALS ... S1.05ITEM #01COMPONENTANGLE SECTION020304NOTESQTY.DESCRIPTIONL5x5x14" x 412"PLATE0'-812"x212"x14"FILLET WELD316" EFF. THROAT050609WING PLATEBUTT WELDCOMPLETE PEN.FLARE BEVEL WELDPARTIAL PEN.4444NOTES CTD. ...9. " " SYMBOL ON DRAWING INDICATES MARK NO. FOR BASE PLATE REPAIRS. REFERENCEDRAWING S-1.09 "KEY NOTES - COLUMN BASE PLATE REPAIRS" AND APPLICABLE SECTIONS& DETAILS AS REQUIRED.10. REFERENCE DWG. S0.00 FOR ADDITIONAL GENERAL NOTES, MATERIAL SPECIFICATIONS & REQUIREMENTS, DESIGN CRITERIA AND LEGEND.X30'-6"x212"x38" x 512"BENT PLATE0708FILLET WELD14" EFF. THROATFILLET WELD516" EFF. THROAT350'-4"x134"x14"8195"10"50"210"20" 55.3C EXIST. TRUSS "T1"LC EXIST. TRUSS "T1"L66.3C EXIST. TRUSS "T1"LC EXIST. TRUSS "T1"LEXIST. HSS BM.REMOVE EXIST. COATING,SURFACE RUST, PREP STL. &APPLY NEW COATING(REF. NOTE 6)EXIST. HSS COL.EXIST. HSS BRACEREMOVE EXIST. COATING,SURFACE RUST, PREP STL. &APPLY NEW COATING(REF. NOTE 5)[1'-0" (MIN.) LENGTH]EXIST. HSS BM.EXIST. TRUSS HSS TOPCHORD / WEB DIAGONAL(N.S. COL.) [REF. NOTE 9]EXIST. HSS BM.REMOVE EXIST. COATING, SURFACERUST, PREP STL. & APPLY NEWCOATING @ TOP SURFACE IF FIELDVERIFICATION YIELDS REQ.'DEXIST. HSS COL.EXIST. HSS BRACEREMOVE EXIST. COATING,SURFACE RUST, PREP STL. &APPLY NEW COATING(REF. NOTE 5)[1'-0" (MIN.) LENGTH]EXIST. HSS BM.EXIST. TRUSS HSS TOPCHORD / WEB DIAGONAL(N.S. COL.) [REF. NOTE 9]C HSS's & L5'sLL5 (N.S. & F.S.)[REF. DETAIL 2-S1.03 (SIM.)]REF. NOTE 4EXIST. HSS BM.C HSS's & L5'sLEXIST. HSS COL.EXIST. TRUSS BTM.CHORDC HSS's & L5'sLEXIST. HSS BRACEEXIST. HSS BRACEL5 (TYP. EA. SIDE BTM. CHORD)[REF. DETAIL 4-S1.05 (SIM.)][REF. NOTE 8]REF. NOTE 4S1.06STRUCTURALEXIST. BLDG. A TRUSS CONDITIONS &REPAIRS (SHT. 4 OF 11)1. IN GENERAL REPAIR OF THE EXISTING STRUCTURAL STEEL TRUSSES AND THE SECONDARYEXTERIOR WALL BEAMS INVOLVES REPAIRS TO INTERIOR VERTICAL, HORIZONTAL & DIAGONALSURFACES OF THE TRUSSES, COLUMNS, CONNECTION PLATES OR ANGLES, BASE PLATES ANDANCHOR BOLTS AND HARDWARE. IN GENERAL REPAIR WORK INCLUDES THE FOLLOWING:a.) REMOVING EXISTING COATINGS TO BARE METAL.b.) REMOVING SURFACE RUST OR THRU WALL RUST AND CLEANING SURFACES TO BARE METAL.c.) PREPARING BARE METAL SURFACES TO SSPC-SP6 "COMMERCIAL BLAST CLEANING" CRITERIA.d.) WELDING NEW STEEL PLATE OR ANGLE SECTIONS TO THE EXISTING STEEL SECTIONS.REGARDING FIELD WELDING AND PREPARATION TO SSPC-SP6 CRITERIA, THE MAXIMUM BASEMETAL TEMPERATURE AT DEMARCATION BETWEEN BRIGHT METAL AND THE EXISTING COATINGSTO BE CONFIRMED w/ THE USE OF 182° F TEMPILSTIK's BETWEEN WELD PASSES.e.) INSTALL NEW COATING SYSTEM ON THE REPAIRED AREAS TO MATCH2. CODE FOR UTILIZING TRUSS CONNECTION LOCATIONS MARK NUMBERS AS FOLLOWS:a.) COL. ID E/W DIRECTION - COL. ID N/S DIRECTION - TRUSS TYPE - ELEVATION ABOVE BASE PLATE.b.) COORDINATE w/ TRUSS ELEVATIONS DWG.'s S-1.01 & S-1.02 FOR HEIGHT CODES 0 TO 5.c.) COORDINATE w/ THE "TRUSS CONN. LOCATION MK. # LEGEND EXAMPLE" DWG. S1.03 FORADDITIONAL INFORMATION.NOTES:DESCRIPTIONDATEREVISIONSSCALEHORIZONTAL:VERTICAL:STATUS:DRAWNPROJ. MGR. DESIGNEDCHECKEDPROJ. START DATE:MCE PROJ. #REV.NO.2021.NOV00992-0261LONG CENTER NATATORIUMSTRUCTURAL FRAME REPAIRSREVISIONDRAWING NUMBERwww.mckimcreed.comCA Lic. No. 29588Phone: (727) 442-7196, Fax: (727) 461-3827Clearwater, Florida 33756-33311365 Hamlet AvenueWFBWFBWFB / AEAAAHNAAS NOTED02 MAR 202290% DESIGN - NOT FOR CONSTRUCTIONA18 MAR 2022100% DESIGN - NOT FOR CONSTRUCTIONB09 MAY 2022FINAL DESIGN - FINAL REVIEW NOT FOR CONSTRUCTIONC23 MAY 2022FINAL DESIGN - RELEASED FOR BIDDRELEASED FOR BIDSTRUCTURALFINAL DESIGN SUBMITTALD1 - DETAIL - TRUSS "T1" COL. LINE "B"SCALE: 1/4" = 1'-0"2 - DETAIL - TRUSS "T1" @ COL. LINE "B"SCALE: 1/4" = 1'-0"NOTES CTD. ...3. REGARDING VERIFYING CONDITION OF EXISTING STEEL, NOTE THE FOLLOWING:a.) DURING SITE VISITS NOT ALL AREAS OF THE EXISTING FACILITY COULD BE EASILY ACCESSED SAFELY w/ THE LIFT.b.) CONTRACTOR TO VERIFY IF EXISTING TOP CHORDS EXHIBITING SIGNS OF RUST, CORROSION OR LOSS OF COATING.c.) NOTIFY ENGINEER OF AREAS THAT ARE NOT CURRENTLY INDICATED BUT DISPLAY RUST,CORROSION, AND / OR COATING PEELING OR LOSS FOR DIRECTIONS HOW TO PROCEED.4. COORDINATE w/ DETAILS REFERENCED FOR ANGLE / PLATE LAYOUT DIM.'s & WELD REQ.'s. U.N.O..5. IF COATING REMOVAL YIELDS SURFACE PITTING GRIND SMOOTH & TO SURFACE PREP. REQ.'s.6. PLATE OR ANGLE ASSEMBLIES NOT REQUIRED PROVIDED REMOVAL OF THE EXISTINGCOATING / CORROSION & SURFACE PREP DOES NOT YIELD UNEXPECTED RESULTS & REPAIRSCANNOT BE INSTALLED AS NOTED.7. REMOVE & REINSTALL EXIST. WINDOW GLASS & FRAME TO REPAIR IF REQ'D.8. WELD L5's TO HSS TRUSS CHORD, COL. & HORZ. BM. REF. DETAIL 2-S1.03 FOR WELD REQ.'s & INFO.9. TRUSS WEB DIAGONAL SHOWN UNDERSIDE OF TOP CHORD FOR CLARITY.RUST / CORROSION @SOUTH FACE OF HORZ.BM. TOP RADIUSREF. DETAIL 4-S1.05RUST / CORROSION @SOUTH FACE OF COL. &COL. RADIUSRUST / CORROSION @SOUTH FACE OF HORZ. BM.& T&B RADIUSREF. DETAIL 5-S1.04(SIM.)VERIFY CONDITION OF T.O. CHORDDOES NOT REQUIRE REPAIR(REF. NOTE 3)RUST / CORROSION @ T.O.TRUSS TOP CHORDRUST / CORROSION @SOUTH FACE OF HORZ.BM. / COL. INTERSECTRUST / CORROSION @ B.O.TRUSS DIAGONAL WEBUNDER BLISTEREDCOATINGREF. DETAIL 3-S1.06MK. B-5-T1-53 - DETAIL - B-5-T1-5 REPAIRSCALE: 3/4" = 1'-0"MK. B-5-T1-4RUST / CORROSION @SIDES & B.O. TRUSS BTM.CHORD UNDER BLISTEREDCOATINGRUST / CORROSION @SOUTH FACE OF COL. / HORZ. BM. & T.O. BTM.CHORD(SIM.)MK. B-5-T1-3RUST / CORROSION @SOUTH FACE OF COL. &COL. RADIUS (T&B)REF. DETAIL 5-S1.04(SIM.)MK. B-5-T1-2REF. DETAIL 5-S1.04(SIM.)MK. B-5-T1-1RUST / CORROSION @SOUTH FACE OF HORZ.BM. & T&B RADIUS UNDERBLISTERED COATINGRUST / CORROSION @SOUTH FACE OF COL. &COL. RADIUS UNDERBLISTERED COATINGMK. B-5.3-T1-5RUST / CORROSION @ T.O.TRUSS TOP CHORDRUST / CORROSION @SOUTH FACE OF HORZ.BM. / COL. INTERSECTRUST / CORROSION @ B.O.TRUSS DIAGONAL WEBUNDER BLISTEREDCOATINGREF. DETAIL 3-S1.06(SIM.)MK. B-5.3-T1-4RUST / CORROSION @ B.O.TRUSS BTM. CHORD UNDERBLISTERED COATINGRUST / CORROSION @SOUTH FACE OF COL. & T.O.TRUSS BTM. CHORDREF. DETAIL 4-S1.04(SIM.)MK. B-5.3-T1-3RUST / CORROSION @SOUTH FACE OF COL. &HORZ. BM. INTERSECTUNDER BLISTEREDCOATINGREF. DETAIL 9-S1.04(SIM.)[REF.NOTES 5 & 6]MK. B-5.3-T1-2RUST / CORROSION @ SOUTHFACE OF COL. UNDERBLISTERED COATINGRUST / CORROSION @ SOUTHFACE OF HORZ. BM. UNDERBLISTERED COATINGRUST / CORROSION @ COL. &HORZ. BM. T&B RADIUSREF. DETAIL 5-S1.04(SIM.)[REF. NOTE 5 @ COL. FACE]RUST / CORROSION @ SOUTHFACE OF COL. UNDERBLISTERED COATINGRUST / CORROSION @ SOUTHFACE OF HORZ. BM. UNDERBLISTERED COATINGRUST / CORROSION @ COL. &HORZ. BM. T&B RADIUSMK. B-5.3-T1-1REF. DETAIL 5-S1.04(SIM.)RUST / CORROSION @ B.O.TRUSS DIAGONAL WEBUNDER BLISTEREDCOATINGMK. B-6-T1-5VERIFY CONDITION OFT.O. CHORD DOES NOTREQUIRE REPAIR(REF. NOTE 3)REF. DETAIL 3-S1.06(SIM.)MK. B-6-T1-4RUST / CORROSION @SIDES, T&B OF TRUSS BTM.CHORD UNDER BLISTEREDCOATINGRUST / CORROSION @SOUTH FACE OF COL. / HORZ. BM. & T.O. BTM.CHORDREF. DETAIL 3-S1.05(SIM.)RUST / CORROSION @SOUTH FACE OF HORZ. BM.& T&B RADIUS UNDERBLISTERED COATINGRUST / CORROSION @SOUTH FACE OF COL. &COL. RADIUS (T&B) UNDERBLISTERED COATINGMK. B-6-T1-3REF. DETAIL 5-S1.04(SIM.)REF. DETAIL 6-S1.03 (SIM.)[REF. NOTE 7]RUST / CORROSION @SOUTH FACE OFDIAGONAL ALONG BTM.RADIUSMK. B-6-T1-3MK. B-6-T1-2RUST / CORROSION @SOUTH FACE OF HORZ.BM. TOP RADIUSRUST / CORROSION @SOUTH FACE OF COL. &COL. RADIUSREF. DETAIL 5-S1.04(SIM.)MK. B-6-T1-1RUST / CORROSION @SOUTH FACE OF HORZ.BM. & T&B RADIUSRUST / CORROSION @SOUTH FACE OF COL. &COL. RADIUSREF. DETAIL 5-S1.04(SIM.)RUST / CORROSION @ SOUTH FACEOF HORZ. BM. / COL. INTERSECTRUST / CORROSION @ B.O. TRUSSDIAGONAL WEB UNDER BLISTEREDCOATINGREF. DETAIL 4-S1.064 - DETAIL - B-6.3-T1-5 REPAIRSCALE: 3/4" = 1'-0"MK. B-6.3-T1-5MK. B-6.3-T1-4RUST / CORROSION @ SOUTH FACEOF HORZ. BM. / COL. INTERSECT &BM. T&B RADIUSRUST / CORROSION @ TRUSS BTM.CHORD ALL SIDES UNDERBLISTERED COATINGRUST / CORROSION @ SOUTH FACEOF COL. & RADIUS (T&B)REF. DETAIL 5-S1.065 - DETAIL - B-6.3-T1-4 REPAIRSCALE: 3/4" = 1'-0"MK. B-6.3-T1-3RUST / CORROSION @ SOUTH FACEOF COL. & RADIUSRUST / CORROSION @ SOUTH FACEOF HORZ. BM. & T&B RADIUSRUST / CORROSION @ SOUTH FACEOF COL. UNDER BLISTERED COATINGREF. DETAIL 5-S1.04(SIM.)[REF. NOTE 5 @ COL. FACE]MK. B-6.3-T1-2RUST / CORROSION @ SOUTH FACEOF COL. & RADIUS (T&B)RUST / CORROSION @ SOUTH FACEOF HORZ. BM. & T&B RADIUSRUST / CORROSION @ SOUTH FACEOF COL. UNDER BLISTERED COATINGREF. DETAIL 5-S1.04(SIM.)[REF. NOTE 5 @ COL. FACE]MK. B-6.3-T1-1RUST / CORROSION @ SOUTH FACEOF COL. & RADIUS (T&B)RUST / CORROSION @ SOUTH FACEOF HORZ. BM. & T&B RADIUSRUST / CORROSION @ SOUTH FACEOF COL. UNDER BLISTERED COATINGREF. DETAIL 5-S1.04(SIM.)[REF. NOTE 5 @ COL. FACE]X4NOTES CTD. ...10. " " SYMBOL ON DRAWING INDICATES MARK NO. FOR BASE PLATE REPAIRS. REFERENCE DRAWING S-1.09 "KEY NOTES - COLUMN BASE PLATE REPAIRS" AND APPLICABLE SECTIONS& DETAILS AS REQUIRED.11. REFERENCE DWG. S0.00 FOR ADDITIONAL GENERAL NOTES, MATERIAL SPECIFICATIONS & REQUIREMENTS, DESIGN CRITERIA AND LEGEND.444ESTIMATED BILL OF MATERIALS ... S1.06ITEM #01COMPONENTANGLE SECTION020304NOTESQTY.DESCRIPTIONL5x5x14" x 412"PLATE0'-812"x212"x14"FILLET WELD316" EFF. THROAT050609WING PLATEBUTT WELDCOMPLETE PEN.FLARE BEVEL WELDPARTIAL PEN.90'-6"x212"x38" x 512"BENT PLATE0708FILLET WELD14" EFF. THROATFILLET WELD516" EFF. THROAT12220'-4"x134"x14"8675"40"50"210"20" 77.3C EXIST. TRUSS "T1"LC EXIST. TRUSS "T1"L88.3C EXIST. TRUSS "T1"LC EXIST. TRUSS "T1"LS1.07STRUCTURALEXIST. BLDG. A TRUSS CONDITIONS &REPAIRS (SHT. 5 OF 11)1. IN GENERAL REPAIR OF THE EXISTING STRUCTURAL STEEL TRUSSES AND THE SECONDARYEXTERIOR WALL BEAMS INVOLVES REPAIRS TO INTERIOR VERTICAL, HORIZONTAL & DIAGONALSURFACES OF THE TRUSSES, COLUMNS, CONNECTION PLATES OR ANGLES, BASE PLATES ANDANCHOR BOLTS AND HARDWARE. IN GENERAL REPAIR WORK INCLUDES THE FOLLOWING:a.) REMOVING EXISTING COATINGS TO BARE METAL.b.) REMOVING SURFACE RUST OR THRU WALL RUST AND CLEANING SURFACES TO BARE METAL.c.) PREPARING BARE METAL SURFACES TO SSPC-SP6 "COMMERCIAL BLAST CLEANING" CRITERIA.d.) WELDING NEW STEEL PLATE OR ANGLE SECTIONS TO THE EXISTING STEEL SECTIONS.REGARDING FIELD WELDING AND PREPARATION TO SSPC-SP6 CRITERIA, THE MAXIMUM BASEMETAL TEMPERATURE AT DEMARCATION BETWEEN BRIGHT METAL AND THE EXISTING COATINGSTO BE CONFIRMED w/ THE USE OF 182° F TEMPILSTIK's BETWEEN WELD PASSES.e.) INSTALL NEW COATING SYSTEM ON THE REPAIRED AREAS TO MATCH2. CODE FOR UTILIZING TRUSS CONNECTION LOCATIONS MARK NUMBERS AS FOLLOWS:a.) COL. ID E/W DIRECTION - COL. ID N/S DIRECTION - TRUSS TYPE - ELEVATION ABOVE BASE PLATE.b.) COORDINATE w/ TRUSS ELEVATIONS DWG.'s S-1.01 & S-1.02 FOR HEIGHT CODES 0 TO 5.c.) COORDINATE w/ THE "TRUSS CONN. LOCATION MK. # LEGEND EXAMPLE" DWG. S1.03 FORADDITIONAL INFORMATION.NOTES:DESCRIPTIONDATEREVISIONSSCALEHORIZONTAL:VERTICAL:STATUS:DRAWNPROJ. MGR. DESIGNEDCHECKEDPROJ. START DATE:MCE PROJ. #REV.NO.2021.NOV00992-0261LONG CENTER NATATORIUMSTRUCTURAL FRAME REPAIRSREVISIONDRAWING NUMBERwww.mckimcreed.comCA Lic. No. 29588Phone: (727) 442-7196, Fax: (727) 461-3827Clearwater, Florida 33756-33311365 Hamlet AvenueWFBWFBWFB / AEAAAHNAAS NOTED02 MAR 202290% DESIGN - NOT FOR CONSTRUCTIONA18 MAR 2022100% DESIGN - NOT FOR CONSTRUCTIONB09 MAY 2022FINAL DESIGN - FINAL REVIEW NOT FOR CONSTRUCTIONC23 MAY 2022FINAL DESIGN - RELEASED FOR BIDDRELEASED FOR BIDSTRUCTURALFINAL DESIGN SUBMITTALD1 - DETAIL - TRUSS "T1" COL. LINE "B"SCALE: 1/4" = 1'-0"2 - DETAIL - TRUSS "T1" @ COL. LINE "B"SCALE: 1/4" = 1'-0"NOTES CTD. ...3. REGARDING VERIFYING CONDITION OF EXISTING STEEL, NOTE THE FOLLOWING:a.) DURING SITE VISITS NOT ALL AREAS OF THE EXISTING FACILITY COULD BE EASILY ACCESSED SAFELY w/ THE LIFT.b.) CONTRACTOR TO VERIFY IF EXISTING TOP CHORDS EXHIBITING SIGNS OF RUST, CORROSION OR LOSS OF COATING.c.) NOTIFY ENGINEER OF AREAS THAT ARE NOT CURRENTLY INDICATED BUT DISPLAY RUST,CORROSION, AND / OR COATING PEELING OR LOSS FOR DIRECTIONS HOW TO PROCEED.4. COORDINATE w/ DETAILS REFERENCED FOR ANGLE / PLATE LAYOUT DIM.'s & WELD REQ.'s. U.N.O..5.IF COATING REMOVAL YIELDS SURFACE PITTING GRIND SMOOTH & TO SURFACE PREP. REQ.'s.6.PLATE OR ANGLE ASSEMBLIES NOT REQUIRED PROVIDED REMOVAL OF THE EXISTINGCOATING / CORROSION & SURFACE PREP DOES NOT YIELD UNEXPECTED RESULTS & REPAIRSCANNOT BE INSTALLED AS NOTED.7.REMOVE & REINSTALL EXIST. WINDOW GLASS & FRAME TO REPAIR IF REQ'D.8.WELD L5's TO HSS TRUSS CHORD, COL. & HORZ. BM. REF. DETAIL 2-S1.03 FOR WELD REQ.'s & INFO.9.TRUSS WEB DIAGONAL SHOWN UNDERSIDE OF TOP CHORD FOR CLARITY.RUST / CORROSION @ T.O.TRUSS TOP CHORDRUST / CORROSION @SOUTH FACE OF HORZ.BM. / COL. INTERSECTRUST / CORROSION @BTM. & SIDES OF TRUSSDIAGONAL WEB UNDERBLISTERED COATINGREF. DETAIL 3-S1.06MK. B-7-T1-5RUST / CORROSION @WEST FACE OF COL.(SIM.)MK. B-7-T1-4RUST / CORROSION @SIDES & T&B OF TRUSSBTM. CHORD UNDERBLISTERED COATINGRUST / CORROSION @SOUTH FACE OF COL. & RADIUSRUST / CORROSION @SOUTH FACE OF HORZ. BM.& T&B RADIUSREF. DETAIL 4-S1.05(SIM.)MK. B-7-T1-3REF. DETAIL 5-S1.04(SIM.)RUST / CORROSION @SOUTH FACE OF HORZ. BM.& T&B RADIUSRUST / CORROSION @ SOUTHFACE OF COL. & COL. RADIUS(T&B) UNDER BLISTEREDCOATINGMK. B-7-T1-2RUST / CORROSION @SOUTH FACE OF HORZ. BM.& T&B RADIUS UNDERBLISTERED COATINGRUST / CORROSION @ SOUTHFACE OF COL. & COL. RADIUS(T&B) UNDER BLISTEREDCOATINGREF. DETAIL 5-S1.04(SIM.)MK. B-7-T1-1RUST / CORROSION @SOUTH FACE OF HORZ. BM.& T&B RADIUS UNDERBLISTERED COATINGRUST / CORROSION @ SOUTHFACE OF COL. & COL. RADIUS(T&B) UNDER BLISTEREDCOATINGREF. DETAIL 5-S1.04(SIM.)[REF. NOTE 7 @ COL. FACE]MK. B-7.3-T1-5RUST / CORROSION @ T.O.TRUSS TOP CHORDRUST / CORROSION @SOUTH FACE OF HORZ.BM. / COL. INTERSECTRUST / CORROSION @BTM. & SIDES OF TRUSSDIAGONAL WEB UNDERBLISTERED COATINGREF. DETAIL 3-S1.06(SIM.)MK. B-7.3-T1-4RUST / CORROSION @SIDES & T&B OF TRUSSBTM. CHORD UNDERBLISTERED COATINGRUST / CORROSION @SOUTH FACE OF COL. & RADIUSRUST / CORROSION @SOUTH FACE OF HORZ. BM.& TOP RADIUSREF. DETAIL 4-S1.05(SIM.)[REF. NOTE 7]REF. DETAIL 4-S1.06(SIM.)MK. B-8-T1-5RUST / CORROSION @ T.O.TRUSS TOP CHORDRUST / CORROSION @ SOUTHFACE OF HORZ. BM. / COL.INTERSECT & BM. BTM.RADIUSRUST / CORROSION @BTM. & SIDES OF TRUSSDIAGONAL WEB UNDERBLISTERED COATINGREF. DETAIL 9-S1.04(SIM.)[ORIENT. WING PLATE UP]MK. B-8-T1-1RUST / CORROSION @SOUTH FACE OF HORZ. BM.@ T&B RADIUS UNDERBLISTERED COATINGRUST / CORROSION @ SOUTHFACE OF COL. & COL. RADIUSUNDER BLISTERED COATINGREF. DETAIL 3-S1.06(SIM.)MK. B-8.3-T1-5RUST / CORROSION @ T.O.TRUSS TOP CHORDRUST / CORROSION @ SOUTH FACE OFHORZ. BM. & @ BM. / COL. INTERSECTRUST / CORROSION @ BTM. & SIDESOF TRUSS DIAGONAL WEB UNDERBLISTERED COATINGMK. B-8.3-T1-4RUST / CORROSION @ F.S. & T&B OFTRUSS BTM. CHORD UNDERBLISTERED COATINGRUST / CORROSION @ SOUTH FACE OFCOL. & RADIUS UNDER BLISTEREDCOATINGRUST / CORROSION @ SOUTH FACE OFHORZ. BM., BTM. RADIUS & COL.INTERSECTREF. DETAIL 4-S1.05(SIM.)[VERT. L5 @ B.O. CHORD][HORZ. L5's EA. SIDE]MK. B-8.3-T1-3RUST / CORROSION @ SOUTH FACE OFHORZ. BM. & TOP RADIUS UNDERBLISTERED COATINGRUST / CORROSION @ SOUTH FACEOF COL. & COL. RADIUS (T&B) UNDERBLISTERED COATINGREF. DETAIL 9-S1.04(SIM.)[ORIENT. WING PLATE UP][REF. NOTE 7 @ COL. FACE]MK. B-8.3-T1-2RUST / CORROSION @ SOUTH FACE OFHORZ. BM. & TOP RADIUS UNDERBLISTERED COATINGRUST / CORROSION @ SOUTH FACEOF COL. & COL. RADIUS UNDERBLISTERED COATINGREF. DETAIL 9-S1.04(SIM.)[ORIENT. WING PLATE UP][REF. NOTE 7 @ COL. FACE]MK. B-8.3-T1-1RUST / CORROSION @ SOUTH FACE OFHORZ. BM. & T&B RADIUS UNDERBLISTERED COATINGRUST / CORROSION @ SOUTH FACEOF COL. & COL. RADIUS (T&B) UNDERBLISTERED COATINGX4NOTES CTD. ...10. " " SYMBOL ON DRAWING INDICATES MARK NO. FOR BASE PLATE REPAIRS. REFERENCE DRAWING S-1.09 "KEY NOTES - COLUMN BASE PLATE REPAIRS" AND APPLICABLE SECTIONS & DETAILS AS REQUIRED.11. REFERENCE DWG. S0.00 FOR ADDITIONAL GENERAL NOTES, MATERIAL SPECIFICATIONS & REQUIREMENTS, DESIGN CRITERIA AND LEGEND.444ESTIMATED BILL OF MATERIALS ... S1.07ITEM #01COMPONENTANGLE SECTION020304NOTESQTY.DESCRIPTIONL5x5x14" x 412"PLATE0'-812"x212"x14"FILLET WELD316" EFF. THROAT050609WING PLATEBUTT WELDCOMPLETE PEN.FLARE BEVEL WELDPARTIAL PEN.110'-6"x212"x38" x 512"BENT PLATE0708FILLET WELD14" EFF. THROATFILLET WELD516" EFF. THROAT1290'-4"x134"x14"8520"20"50"210"20" 99.3C EXIST. TRUSS "T1"LC EXIST. TRUSS "T1"L1010.3C EXIST. TRUSS "T2"LC EXIST. TRUSS "T1"LEXIST. HSS BM.EXIST. HSS COL.EXIST. HSS BRACEEXIST. PIPE SUPPT.BRACKET (N.S. COL.).EXIST. HSS BRACEEXIST. HSS BM.L812"x212"x14" THK. P(REF. DETAIL 5-S1.04 (SIM.))LC HSS & P'sLLREF. NOTE 7(TYP.)(2) 4"x134"x14" THK. WING P's(1 N.S. & 1 F.S. - TYP.)[REF. DETAIL 5-S1.04 (SIM.)]REF. NOTE 4812"x412"x14" THK. P(REF. DETAIL 5-S1.04 (SIM.))LEXIST. HSS BM.C HSS's & L5'sLEXIST. HSS COL.EXIST. TRUSS BTM.CHORDC HSS's & L5'sLEXIST. HSS BRACEEXIST. HSS BRACEL5 (TYP. EA. SIDE BTM. CHORD)[REF. DETAIL 4-S1.05 (SIM.)][REF. NOTE 8]EXIST. HSS BM.REMOVE EXIST. SURFACERUST, PREP STL. & APPLYNEW COATING (REF. NOTE 6)REF. NOTE 4REMOVE EXIST. COATING,SURFACE RUST, PREP STL. &APPLY NEW COATING(REF. NOTE 5)[2'-0" (MIN.) LENGTH]REF. NOTE 7 (TYP.)EXIST. HSS BM.C HSS & PLEXIST. HSS COL.EXIST. HSS BRACEEXIST. HSS BRACEEXIST. HSS BM.REMOVE EXIST. SURFACE RUST,PREP STL. & APPLY NEWCOATING (REF. NOTE 6)REF. NOTE 4REF. NOTE 7 (TYP.)LL812"x212"x14" THK. P(REF. DETAIL 5-S1.04)[SIM.]L(2) 4"x134"x14" THK. WING P's(1 N.S. & 1 F.S.)[REF. DETAIL 5-S1.04 (SIM.)]EXIST. HSS BM.C HSS's & L5'sLEXIST. HSS COL.EXIST. TRUSS BTM.CHORDC HSSLEXIST. HSS BRACEEXIST. HSS BRACEREF. NOTE 4REF. NOTE 7 (TYP.)C HSS & PLLC HSS & PLL14" THK. WING P's (T&B)[REF. DETAIL 4-S1.03][SIM.]L1'-9"x5"x14" x 412" LONG BENT P(REF. DETAILS 3-S1.03) [SIM.]L5"S1.08STRUCTURALEXIST. BLDG. A TRUSS CONDITIONS &REPAIRS (SHT. 6 OF 11)1. IN GENERAL REPAIR OF THE EXISTING STRUCTURAL STEEL TRUSSES AND THE SECONDARYEXTERIOR WALL BEAMS INVOLVES REPAIRS TO INTERIOR VERTICAL, HORIZONTAL & DIAGONALSURFACES OF THE TRUSSES, COLUMNS, CONNECTION PLATES OR ANGLES, BASE PLATES ANDANCHOR BOLTS AND HARDWARE. IN GENERAL REPAIR WORK INCLUDES THE FOLLOWING:a.) REMOVING EXISTING COATINGS TO BARE METAL.b.) REMOVING SURFACE RUST OR THRU WALL RUST AND CLEANING SURFACES TO BARE METAL.c.) PREPARING BARE METAL SURFACES TO SSPC-SP6 "COMMERCIAL BLAST CLEANING" CRITERIA.d.) WELDING NEW STEEL PLATE OR ANGLE SECTIONS TO THE EXISTING STEEL SECTIONS.REGARDING FIELD WELDING AND PREPARATION TO SSPC-SP6 CRITERIA, THE MAXIMUM BASEMETAL TEMPERATURE AT DEMARCATION BETWEEN BRIGHT METAL AND THE EXISTING COATINGSTO BE CONFIRMED w/ THE USE OF 182° F TEMPILSTIK's BETWEEN WELD PASSES.e.) INSTALL NEW COATING SYSTEM ON THE REPAIRED AREAS TO MATCH2. CODE FOR UTILIZING TRUSS CONNECTION LOCATIONS MARK NUMBERS AS FOLLOWS:a.) COL. ID E/W DIRECTION - COL. ID N/S DIRECTION - TRUSS TYPE - ELEVATION ABOVE BASE PLATE.b.) COORDINATE w/ TRUSS ELEVATIONS DWG.'s S-1.01 & S-1.02 FOR HEIGHT CODES 0 TO 5.c.) COORDINATE w/ THE "TRUSS CONN. LOCATION MK. # LEGEND EXAMPLE" DWG. S1.03 FORADDITIONAL INFORMATION.NOTES:DESCRIPTIONDATEREVISIONSSCALEHORIZONTAL:VERTICAL:STATUS:DRAWNPROJ. MGR. DESIGNEDCHECKEDPROJ. START DATE:MCE PROJ. #REV.NO.2021.NOV00992-0261LONG CENTER NATATORIUMSTRUCTURAL FRAME REPAIRSREVISIONDRAWING NUMBERwww.mckimcreed.comCA Lic. No. 29588Phone: (727) 442-7196, Fax: (727) 461-3827Clearwater, Florida 33756-33311365 Hamlet AvenueWFBWFBWFB / AEAAAHNAAS NOTED02 MAR 202290% DESIGN - NOT FOR CONSTRUCTIONA18 MAR 2022100% DESIGN - NOT FOR CONSTRUCTIONB09 MAY 2022FINAL DESIGN - FINAL REVIEW NOT FOR CONSTRUCTIONC23 MAY 2022FINAL DESIGN - RELEASED FOR BIDDRELEASED FOR BIDSTRUCTURALFINAL DESIGN SUBMITTALD1 - DETAIL - TRUSS "T1" COL. LINE "B"SCALE: 1/4" = 1'-0"2 - DETAIL - TRUSS "T1" & "T2" @ COL. LINE "B"SCALE: 1/4" = 1'-0"NOTES CTD. ...3. REGARDING VERIFYING CONDITION OF EXISTING STEEL, NOTE THE FOLLOWING:a.) DURING SITE VISITS NOT ALL AREAS OF THE EXISTING FACILITY COULD BE EASILY ACCESSED SAFELY w/ THE LIFT.b.) CONTRACTOR TO VERIFY IF EXISTING TOP CHORDS EXHIBITING SIGNS OF RUST, CORROSION OR LOSS OF COATING.c.) NOTIFY ENGINEER OF AREAS THAT ARE NOT CURRENTLY INDICATED BUT DISPLAY RUST,CORROSION, AND / OR COATING PEELING OR LOSS FOR DIRECTIONS HOW TO PROCEED.4. COORDINATE w/ DETAILS REFERENCED FOR ANGLE / PLATE LAYOUT DIM.'s & WELD REQ.'s. U.N.O..5. IF COATING REMOVAL YIELDS SURFACE PITTING GRIND SMOOTH & TO SURFACE PREP. REQ.'s.6. PLATE OR ANGLE ASSEMBLIES NOT REQUIRED PROVIDED REMOVAL OF THE EXISTINGCOATING / CORROSION & SURFACE PREP DOES NOT YIELD UNEXPECTED RESULTS & REPAIRSCANNOT BE INSTALLED AS NOTED.7. REMOVE & REINSTALL EXIST. WINDOW GLASS & FRAME TO REPAIR IF REQ'D.8. WELD L5's TO HSS TRUSS CHORD, COL. & HORZ. BM. REF. DETAIL 2-S1.03 FOR WELD REQ.'s & INFO.RUST / CORROSION @ T.O.TRUSS TOP CHORDRUST / CORROSION @ SOUTHFACE OF HORZ. BM. & COL.INTERSECTRUST / CORROSION @BTM. & SIDES OF TRUSSDIAGONAL WEB UNDERBLISTERED COATINGREF. DETAIL 3-S1.06RUST / CORROSION @WEST FACE OF COL.RUST / CORROSION @SIDES & T&B OF TRUSSBTM. CHORD UNDERBLISTERED COATINGRUST / CORROSION @SOUTH FACE OF COL. & RADIUSRUST / CORROSION @SOUTH FACE OF HORZ. BM.& T&B RADIUSRUST / CORROSION @SOUTH FACE OF HORZ. BM.& T&B RADIUSRUST / CORROSION @ SOUTHFACE OF COL. & COL. RADIUS(T&B) UNDER BLISTEREDCOATINGRUST / CORROSION @ SOUTHFACE OF HORZ. BM. & T&BRADIUS UNDER BLISTEREDCOATINGRUST / CORROSION @ SOUTHFACE OF COL. & COL. RADIUS(T&B) UNDER BLISTEREDCOATINGRUST / CORROSION @SOUTH FACE OF HORZ. BM.& T&B RADIUS UNDERBLISTERED COATINGRUST / CORROSION @ SOUTHFACE OF COL. & COL. RADIUS(T&B) UNDER BLISTEREDCOATINGMK. B-9-T1-5MK. B-9-T1-4REF. DETAIL 4-S1.05(SIM.)[VERT. L5 @ B.O. CHORD][HORZ. L5's EA. SIDE]MK. B-9-T1-3REF. DETAIL 5-S1.04(SIM.)MK. B-9-T1-2RUST / CORROSION @ SOUTHFACE OF DIAGONAL BRACE &COL. INTERSECT UNDERBLISTERED COATINGREF. DETAIL 3-S1.083 - DETAIL - B-9-T1-2 REPAIRSCALE: 3/4" = 1'-0"MK. B-9-T1-1RUST / CORROSION @ SOUTHFACE OF DIAGONAL BRACE &COL. INTERSECT UNDERBLISTERED COATINGREF. DETAIL 5-S1.04(SIM.)[REF. NOTE 5 @ COL. / BRACE]MK. B-9.3-T1-5RUST / CORROSION @ T.O.TRUSS TOP CHORDRUST / CORROSION @ SOUTHFACE OF HORZ. BM. & COL.INTERSECTRUST / CORROSION @BTM. & SIDES OF TRUSSDIAGONAL WEB UNDERBLISTERED COATINGREF. DETAIL 4-S1.06(SIM.)MK. B-9.3-T1-4MINOR RUST / CORROSION@ SIDES & BTM. OF TRUSSBTM. CHORD UNDERBLISTERED COATINGRUST / CORROSION @SOUTH FACE OF COL. & RADIUSRUST / CORROSION @SOUTH FACE OF HORZ. BM.& TOP RADIUSREF. DETAIL 4-S1.05(SIM.)[REF. NOTE 5 @ TRUSS CHORD]MK. B-9.3-T1-3MINOR RUST / CORROSION@ HORZ. BM. TOP RADIUSREF. DETAIL 9-S1.04(SIM.)[REF. NOTE 6]RUST / CORROSION @ SOUTHFACE OF HORZ. BM. & TOPRADIUS UNDER BLISTEREDCOATINGRUST / CORROSION @ SOUTHFACE OF COL. & COL. TOPRADIUS UNDER BLISTEREDCOATINGREF. DETAIL 5-S1.04(SIM.)[REF. NOTE 5 @ COL.]MK. B-9.3-T1-2RUST / CORROSION @ SOUTHFACE OF HORZ. BM. & BTM.RADIUS UNDER BLISTEREDCOATINGREF. DETAIL 9-S1.04(SIM.)[REF. NOTE 5 @ COL.]RUST / CORROSION @ SIDES &T&B OF TRUSS BTM. CHORDUNDER BLISTERED COATINGRUST / CORROSION @ SOUTHFACE OF COL. / DIAGONAL BRACEINTERSECT (T&B)RUST / CORROSION @ HORZ.BM. BTM. FACE / RADIUSMK. B-10-T1-4RUST / CORROSION @ DIAGONALBRACE BTM. RADIUS4 - DETAIL - B-10-T1-4 REPAIRSCALE: 3/4" = 1'-0"REF. DETAIL 4-S1.08MK. B-10-T1-3RUST / CORROSION @ DIAGONALBRACE TOP RADIUS UNDERBLISTERED COATINGRUST / CORROSION @ SOUTHFACE OF COL. & HORZ. BM. &COL. / BM. RADIUS UNDERBLISTERED COATINGREF. DETAIL 5-S1.085 - DETAIL - B-10-T1-3 REPAIRSCALE: 3/4" = 1'-0"MK. B-10-T1-2RUST / CORROSION @ SOUTHFACE OF COL. & HORZ. BM. &COL. / BM. RADIUS UNDERBLISTERED COATINGREF. DETAIL 5-S1.08(SIM.)[REF. NOTE 5]MK. B-10-T1-1RUST / CORROSION @ SOUTHFACE OF COL. & HORZ. BM. &COL. / BM. RADIUS UNDERBLISTERED COATING(REF. NOTE 5)REF. DETAIL 5-S1.08(SIM.)[REF. NOTE 5]REF. DETAIL 3-S1.04(SIM.)[REF. NOTE 6]MK. B-10.3-T2-5RUST / CORROSION @ SOUTH FACEOF HORZ. BM. / DIAGONAL BRACEINTERSECTVERIFY CONDITION OF T.O. CHORD DOES NOTREQUIRE REPAIR (REF. NOTE 3)VERIFY COATING DOES NOT REQUIRE REPAIR(REF. NOTE 9)VERIFY COATING DOES NOT REQUIRE REPAIR(REF. NOTE 9)MK. B-10.3-T2-4REF. DETAIL 6-S1.08RUST / CORROSION @ WEST FACE OFTRUSS BTM. CHORDRUST / CORROSION @ SOUTH FACE OFHORZ. BM. / DIAGONAL BRACE INTERSECT(T&B)6 - DETAIL - B-10.3-T2-4 REPAIRSCALE: 3/4" = 1'-0"MK. B-10.3-T2-3RUST / CORROSION @ WEST FACE OFHORZ. BM. / COL. INTERSECTREF. DETAIL 5-S1.03(SIM.)RUST / CORROSION @ SOUTH FACE OFHORZ. BM.RUST / CORROSION @ WEST FACE OFHORZ. BM. / COL. INTERSECT UNDERBLISTERED COATINGMK. B-10.3-T2-2REF. DETAIL 6-S1.04(SIM.)MK. B-10.3-T2-1RUST / CORROSION @ WEST FACE OFHORZ. BM. / COL. INTERSECT UNDERBLISTERED COATINGRUST / CORROSION @ SOUTH FACE OFHORZ. BM. & DIAGONAL BRACE INTERSECTUNDER BLISTERED COATINGREF. DETAIL 6-S1.04(SIM.)X4NOTES CTD. ...9. " " SYMBOL ON DRAWING INDICATES MARK NO. FOR BASE PLATE REPAIRS. REFERENCEDRAWING S-1.09 "KEY NOTES - COLUMN BASE PLATE REPAIRS" AND APPLICABLE SECTIONS& DETAILS AS REQUIRED.10. REFERENCE DWG. S0.00 FOR ADDITIONAL GENERAL NOTES, MATERIAL SPECIFICATIONS & REQUIREMENTS, DESIGN CRITERIA AND LEGEND.443ESTIMATED BILL OF MATERIALS ... S1.08ITEM #01COMPONENTANGLE SECTION020304NOTESQTY.DESCRIPTIONL5x5x14" x 412"PLATE0'-812"x212"x14"FILLET WELD316" EFF. THROAT050609WING PLATEBUTT WELDCOMPLETE PEN.FLARE BEVEL WELDPARTIAL PEN.150'-6"x212"x38" x 512"BENT PLATE0708FILLET WELD14" EFF. THROATFILLET WELD516" EFF. THROAT8170'-4"x134"x14"6870"50"70"180"25"0'-6"x212"x38" x 212"BENT PLATE1PLATE0'-812"x412"x14"11'-9"x5"x14" x 412"BENT PLATE110111213WING PLATE60'-4"x334"x14" 10.310C EXIST. TRUSS "T1"LC EXIST. TRUSS "T2"LEXIST. HSS BM.C HSS's & L5LEXIST. HSS COL.EXIST. TRUSS BTM.CHORD (N.S. COL.)L5(REF. DETAIL 2-S1.03)[SIM.]EXIST. HSS BRACEEXIST. HSS BRACE14" THK. WING P's (T&B)[REF. DETAIL 3-S1.03][SIM.]LREMOVE EXIST. SURFACERUST, PREP STL. & APPLYNEW COATING (REF. NOTE 6)[ B.O. BTM. CHORD]EXIST. HSS BM.C HSS's & L5LEXIST. HSS COL.EXIST. HSS BM.(N.S. COL.)L5(REF. DETAIL 2-S1.03)[SIM.]EXIST. HSS BRACEEXIST. HSS BRACEREMOVE EXIST. SURFACERUST, PREP STL. & APPLYNEW COATING (REF. NOTE 6)[ B.O. BTM. CHORD]REF. NOTE 7C PLATE & COL.1'-0"(*)6"(*)L1'-0"(*)[TYP.]1 1/2"(*)EXIST. 1" THK. STL. PLATEEXIST. HSS STL.COL.1/4EXIST. 1"Ø(*) STL. ANCHOR BOLTS(TYP.)[TYP.]2 3/4"3 SIDESEA. P LEG(TYP.)L6"x212x38" THK. x 212" LONG BENT PC HSS's & PLL1 1/2"(*) [TYP.]LEXIST. HSS BRACEC PLATE & COL.LEXIST. STL. PLATE ASSEMBLY(REF. DETAIL 6-S1.09)EXIST. HSS STL.COL.1/45 1/2"3 SIDESEA. P(TYP.)LC HSS's & PLL1 1/2"(*) [TYP.]EXIST. HSS BRACE6"x212"x38" THK. x 512" LONG BENT P(N.S. & F.S. PIPE SUPPT.)L5/162 SIDESEA. P(TYP.)LEXIST. PIPE SUPPT.BRACKETC PLATE & COL.1'-2 1/2"(*)4 1/2"(*)L1'-6"(*)[TYP.]2"(*)EXIST. STL. PLATEEXIST. STL. COL.ASSEMBLY5/16EXIST. 3/4"Ø STL. ANCHOR BOLTS[TYP.]1 1/2"(TYP.)3 SIDESEA. P LEG(TYP.)L0'-658"x0'-658"x38" x 312" LONG BENT P(N.S. & F.S. WEB)C PLATE & BOLTSLL1"Ø STL. THR'D ROD EXTENSION(TYP.)[THREADS NOT SHOWN FORCLARITY]EXIST. STL. BASE PLATEEXIST. 1"Ø(*) STL. ANCHOR BOLTS(TYP.)C EXIST. A.B.LCUT EXIST. A.B. BELOWCORROSION & GRIND LEVELACROSS BOLT45°BEVEL E.O.BOLT(TYP.)TIGHTEN NEW NUT & WASHERASSEMBLY TO PLATES1.09STRUCTURALEXIST. BLDG. A TRUSS CONDITIONS &REPAIRS (SHT. 7 OF 11)1. IN GENERAL REPAIR OF THE EXISTING STRUCTURAL STEEL TRUSSES AND THE SECONDARYEXTERIOR WALL BEAMS INVOLVES REPAIRS TO INTERIOR VERTICAL, HORIZONTAL & DIAGONALSURFACES OF THE TRUSSES, COLUMNS, CONNECTION PLATES OR ANGLES, BASE PLATES ANDANCHOR BOLTS AND HARDWARE. IN GENERAL REPAIR WORK INCLUDES THE FOLLOWING:a.) REMOVING EXISTING COATINGS TO BARE METAL.b.) REMOVING SURFACE RUST OR THRU WALL RUST AND CLEANING SURFACES TO BARE METAL.c.) PREPARING BARE METAL SURFACES TO SSPC-SP6 "COMMERCIAL BLAST CLEANING" CRITERIA.d.) WELDING NEW STEEL PLATE OR ANGLE SECTIONS TO THE EXISTING STEEL SECTIONS.REGARDING FIELD WELDING AND PREPARATION TO SSPC-SP6 CRITERIA, THE MAXIMUM BASEMETAL TEMPERATURE AT DEMARCATION BETWEEN BRIGHT METAL AND THE EXISTING COATINGSTO BE CONFIRMED w/ THE USE OF 182° F TEMPILSTIK's BETWEEN WELD PASSES.e.) INSTALL NEW COATING SYSTEM ON THE REPAIRED AREAS TO MATCH2. CODE FOR UTILIZING TRUSS CONNECTION LOCATIONS MARK NUMBERS AS FOLLOWS:a.) COL. ID E/W DIRECTION - COL. ID N/S DIRECTION - TRUSS TYPE - ELEVATION ABOVE BASE PLATE.b.) COORDINATE w/ TRUSS ELEVATIONS DWG.'s S-1.01 & S-1.02 FOR HEIGHT CODES 0 TO 5.c.) COORDINATE w/ THE "TRUSS CONN. LOCATION MK. # LEGEND EXAMPLE" DWG. S1.03 FORADDITIONAL INFORMATION.NOTES:DESCRIPTIONDATEREVISIONSSCALEHORIZONTAL:VERTICAL:STATUS:DRAWNPROJ. MGR. DESIGNEDCHECKEDPROJ. START DATE:MCE PROJ. #REV.NO.2021.NOV00992-0261LONG CENTER NATATORIUMSTRUCTURAL FRAME REPAIRSREVISIONDRAWING NUMBERwww.mckimcreed.comCA Lic. No. 29588Phone: (727) 442-7196, Fax: (727) 461-3827Clearwater, Florida 33756-33311365 Hamlet AvenueWFBWFBWFB / AEAAAHNAAS NOTED02 MAR 202290% DESIGN - NOT FOR CONSTRUCTIONA18 MAR 2022100% DESIGN - NOT FOR CONSTRUCTIONB09 MAY 2022FINAL DESIGN - FINAL REVIEW NOT FOR CONSTRUCTIONC23 MAY 2022FINAL DESIGN - RELEASED FOR BIDDRELEASED FOR BIDSTRUCTURALFINAL DESIGN SUBMITTALD1 - DETAIL - TRUSS "T1" & "T2" @ COL. LINE "D"SCALE: 1/4" = 1'-0"3 - DETAIL - D-10.3-T2-4 REPAIRSCALE: 3/4" = 1'-0"NOTES CTD. ...3. REGARDING VERIFYING CONDITION OF EXISTING STEEL, NOTE THE FOLLOWING:a.) DURING SITE VISITS NOT ALL AREAS OF THE EXISTING FACILITY COULD BE EASILY ACCESSED SAFELY w/ THE LIFT.b.) CONTRACTOR TO VERIFY IF EXISTING TOP CHORDS EXHIBITING SIGNS OF RUST, CORROSION OR LOSS OF COATING.c.) NOTIFY ENGINEER OF AREAS THAT ARE NOT CURRENTLY INDICATED BUT DISPLAY RUST,CORROSION, AND / OR COATING PEELING OR LOSS FOR DIRECTIONS HOW TO PROCEED.4. COORDINATE w/ DETAILS REFERENCED FOR ANGLE / PLATE LAYOUT DIM.'s & WELD REQ.'s. U.N.O..5. IF COATING REMOVAL YIELDS SURFACE PITTING GRIND SMOOTH & TO SURFACE PREP. REQ.'s.6. PLATE OR ANGLE ASSEMBLIES NOT REQUIRED PROVIDED REMOVAL OF THE EXISTINGCOATING / CORROSION & SURFACE PREP DOES NOT YIELD UNEXPECTED RESULTS & REPAIRSCANNOT BE INSTALLED AS NOTED.7. REMOVE & REINSTALL EXIST. WINDOW GLASS & FRAME TO REPAIR IF REQ'D.REF. DETAIL 3-S1.09MK. D-10.3-T2-4RUST / CORROSION @ WESTFACE OF TRUSS BTM. CHORD& TOP RADIUSRUST / CORROSION @ NORTHFACE OF HORZ. BM. &DIAGONAL BRACE UNDERBLISTERED COATINGRUST / CORROSION @ WESTFACE OF TRUSS BTM.CHORDMK. D-10.3-T2-3RUST / CORROSION @ NORTHFACE OF HORZ. BM. & T.O. BM.UNDER BLISTERED COATINGREF. DETAIL 4-S1.09(SIM.)[WING PLATES NOT REQ'D]MK. D-10.3-T2-24 - DETAIL - D-10.3-T2-3 REPAIRSCALE: 3/4" = 1'-0"RUST / CORROSION @ NORTHFACE & T.O. DIAGONAL BRACEUNDER BLISTERED COATINGRUST / CORROSION @ NORTHFACE OF COL. & RADIUSUNDER BLISTERED COATINGREF. DETAIL 6-S1.03(SIM.)[REF. NOTE 7]MK. D-10.3-T2-1RUST / CORROSION @ NORTHFACE OF HORZ. BM. & T.O. BM.REF. DETAIL 6-S1.03(SIM.)[REF. NOTE 7]MK. D-10-T1-4REPAIR COATING @ FACE OFDIAGONAL BRACE, COL. &T.O. BTM. CHORDMINOR RUST / CORROSIONSPOT @ T.O. HORZ. BM.MK. D-10-T1-3MINOR RUST / CORROSIONSPOTS @ COL. / HSS BM. &DIAGONAL BRACEINTERSECTSREF. DETAIL 6-S1.03(SIM.)REF. DETAIL 6-S1.03(SIM.)MINOR RUST / CORROSIONSPOTS @ COL. / HSS BM. &DIAGONAL BRACEINTERSECTSREF. DETAIL 6-S1.03(SIM.)[REF. NOTES 5 & 6]MK. D-10-T1-2REPAIR COATING @ FACE OFHORZ. BM. & COL.RUST / CORROSION @ B.O.DIAGONAL BRACEREF. DETAIL 6-S1.03(SIM.)[REF. NOTES 5, 6 & 7]VERIFY CONDITION OFT.O. CHORD DOES NOTREQUIRE REPAIR(REF. NOTE 3) [TYP.]2 - KEYNOTES - COL. BASE PLATE REPAIRSSCALE: N/AREMOVE EXISTING COATING FROM EXPOSED PLATE TOP & SIDE SURFACES.REMOVE ALL RUST FROM PLATE & ANCHOR BOLTS & HARDWARE SURFACES TO BARE METAL.REMOVE & REPLACE SEVERELY CORRODED NUTS & WASHERS.PREP ALL PLATE, COLUMN, BOLTS & HARDWARE STEEL SURFACES AS REQUIRED.REPAIR ANCHOR BOLTS PER DETAIL 8-S1.09 IF BOLT OR THREADS DAMAGED BEYOND REPAIR.INSTALL NEW COATING SYSTEM.REFERENCE KEYNOTE 1 FOR REMOVING EXISTING RUST, COATING & BOLT HARDWARE.REFERENCE KEYNOTE 1 FOR PREP OF EXISTING STEEL.REINFORCE PLATE AS INDICATED DETAIL 5-S1.09.REPAIR ANCHOR BOLTS PER DETAIL 8-S1.09 IF BOLT OR THREADS DAMAGED BEYOND REPAIR.INSTALL NEW COATING SYSTEM.REFERENCE KEYNOTE 1 FOR REMOVING EXISTING RUST, COATING & BOLT HARDWARE.REFERENCE KEYNOTE 1 FOR PREP OF EXISTING STEEL.REINFORCE PLATE AS INDICATED DETAIL 6-S1.09.REPAIR ANCHOR BOLTS PER DETAIL 8-S1.09 IF BOLT OR THREADS DAMAGED BEYOND REPAIR.INSTALL NEW COATING SYSTEM.REFERENCE KEYNOTE 1 FOR REMOVING EXISTING RUST, COATING & BOLT HARDWARE.REFERENCE KEYNOTE 1 FOR PREP OF EXISTING STEEL.REINFORCE PLATE AS INDICATED DETAIL 7-S1.09.REPAIR ANCHOR BOLTS PER DETAIL 8-S1.09 IF BOLT OR THREADS DAMAGED BEYOND REPAIR.INSTALL NEW COATING SYSTEM.1234X1NOTES CTD. ...8. " " SYMBOL ON DRAWING INDICATES MARK NO. FOR BASE PLATE REPAIRS. REFERENCEDRAWING S-1.09 "KEY NOTES - COLUMN BASE PLATE REPAIRS" AND APPLICABLE SECTIONS& DETAILS AS REQUIRED.9. REFERENCE DWG. S0.00 FOR ADDITIONAL GENERAL NOTES, MATERIAL SPECIFICATIONS &REQUIREMENTS, DESIGN CRITERIA AND LEGEND.1ESTIMATED BILL OF MATERIALS ... S1.09ITEM #01COMPONENTANGLE SECTION020304NOTESQTY.DESCRIPTIONL5x5x14" x 412"FILLET WELD316" EFF. THROAT05WING PLATE0'-4"x334"x14"BUTT WELDCOMPLETE PEN.FLARE BEVEL WELDPARTIAL PEN.6 - DETAIL - EXIST. BASE PLATE MOD KEY NOTE 3SCALE: 1 1/2" = 1'-0"7 - DETAIL - EXIST. BASE PLATE MOD KEY NOTE 4SCALE: 1 1/2" = 1'-0"2270"5"10"5 - DETAIL - EXIST. BASE PLATE MOD KEY NOTE 2SCALE: 1 1/2" = 1'-0"8 - DETAIL - EXIST. BASE PLATE A.B. MODSCALE: 3" = 1'-0" B.9EXIST. HSS BM.EXIST. W12 COL.(REF. NOTE 8)REF. NOTE 7(TYP.)REMOVE EXIST. SURFACERUST, PREP STL. & APPLYNEW COATING (REF. NOTE 6)EXIST. HSS BM.B.7B.5S1.10STRUCTURALEXIST. BLDG. A TRUSS CONDITIONS &REPAIRS (SHT. 8 OF 11)1. IN GENERAL REPAIR OF THE EXISTING STRUCTURAL STEEL TRUSSES AND THE SECONDARYEXTERIOR WALL BEAMS INVOLVES REPAIRS TO INTERIOR VERTICAL, HORIZONTAL & DIAGONALSURFACES OF THE TRUSSES, COLUMNS, CONNECTION PLATES OR ANGLES, BASE PLATES ANDANCHOR BOLTS AND HARDWARE. IN GENERAL REPAIR WORK INCLUDES THE FOLLOWING:a.) REMOVING EXISTING COATINGS TO BARE METAL.b.) REMOVING SURFACE RUST OR THRU WALL RUST AND CLEANING SURFACES TO BARE METAL.c.) PREPARING BARE METAL SURFACES TO SSPC-SP6 "COMMERCIAL BLAST CLEANING" CRITERIA.d.) WELDING NEW STEEL PLATE OR ANGLE SECTIONS TO THE EXISTING STEEL SECTIONS.REGARDING FIELD WELDING AND PREPARATION TO SSPC-SP6 CRITERIA, THE MAXIMUM BASEMETAL TEMPERATURE AT DEMARCATION BETWEEN BRIGHT METAL AND THE EXISTING COATINGSTO BE CONFIRMED w/ THE USE OF 182° F TEMPILSTIK's BETWEEN WELD PASSES.e.) INSTALL NEW COATING SYSTEM ON THE REPAIRED AREAS TO MATCH2. CODE FOR UTILIZING TRUSS CONNECTION LOCATIONS MARK NUMBERS AS FOLLOWS:a.) COL. ID E/W DIRECTION - COL. ID N/S DIRECTION - TRUSS TYPE - ELEVATION ABOVE BASE PLATE.b.) COORDINATE w/ TRUSS ELEVATIONS DWG.'s S-1.01 & S-1.02 FOR HEIGHT CODES 0 TO 5.c.) COORDINATE w/ THE "TRUSS CONN. LOCATION MK. # LEGEND EXAMPLE" THIS DWG. FORADDITIONAL INFORMATION.NOTES:DESCRIPTIONDATEREVISIONSSCALEHORIZONTAL:VERTICAL:STATUS:DRAWNPROJ. MGR. DESIGNEDCHECKEDPROJ. START DATE:MCE PROJ. #REV.NO.2021.NOV00992-0261LONG CENTER NATATORIUMSTRUCTURAL FRAME REPAIRSREVISIONDRAWING NUMBERwww.mckimcreed.comCA Lic. No. 29588Phone: (727) 442-7196, Fax: (727) 461-3827Clearwater, Florida 33756-33311365 Hamlet AvenueWFBWFBWFB / AEAAAHNAAS NOTEDRELEASED FOR BIDSTRUCTURALFINAL DESIGN SUBMITTALC1 - DETAIL - TRUSS "2" & COL. LINE "1" FRMG.SCALE: 1/4" = 1'-0"4 - DETAIL - B.9-1-T2-3 REPAIRSCALE: 3/4" = 1'-0"NOTES CTD. ...3. REGARDING VERIFYING CONDITION OF EXISTING STEEL, NOTE THE FOLLOWING:a.) CONDITIONS OF STEEL MAY HAVE CHANGED SINCE SITE REVIEWS. NOTIFY THE ENGINEEROF SITE CONDITIONS THAT MAY BE DIFFERENT THAN INDICATED. IN ADDITION NOTIFY THE ENGINEER OF AREAS THAT ARE NOT CURRENTLY INDICATED BUT DISPLAY RUST,CORROSION, AND / OR COATING PEELING OR LOSS FOR DIRECTIONS HOW TO PROCEED.4. COORDINATE w/ DETAILS REFERENCED FOR ANGLE / PLATE LAYOUT DIM.'s & WELD REQ.'s. U.N.O..5. IF COATING REMOVAL YIELDS SURFACE PITTING GRIND SMOOTH & TO SURFACE PREP. REQ.'s.6. PLATE OR ANGLE ASSEMBLIES NOT REQUIRED PROVIDED REMOVAL OF THE EXISTINGCOATING / CORROSION & SURFACE PREP DOES NOT YIELD UNEXPECTED RESULTS & REPAIRSCANNOT BE INSTALLED AS NOTED.7. REMOVE & REINSTALL EXIST. WINDOW GLASS & FRAME TO REPAIR IF REQ'D.8. THE W12 COL.'s INSTALLED w/ ADDITIONAL STEEL SECTION @ THE O/F OF THE W12 FLANGE. RECORDDWG.'s REVIEWED COULD NOT CONFIRM THE SECTION. SITE VISIT REVIEW APPEARED TO INDICATE(2) L6x3 SECTIONS INSTALLED w/ (1) L6x3 EACH SIDE OF THE WEB. FIELD VERIFY AS REQ.'D & NOTSHOWN ELEVATIONS FOR CLARITY. REFERENCE DETAIL 5-S1.11 FOR CLARITY.MK. B.9-1-T2-3SREF. DETAIL 4-S1.10REF. DETAIL 4-S1.10(SIM.)REF. DETAIL 4-S1.10(SIM.)REF. DETAIL 4-S1.10(SIM.)REF. DETAIL 4-S1.10(SIM.)ESTIMATED BILL OF MATERIALS ... S1.10ITEM #01COMPONENT02NOTESQTY.0'-658"x658"x 38" x 312"BENT PLATEFILLET WELD516" EFF. THROATRUST / CORROSION @EAST FACE OF HORZ.BM. & COL. INTERSECTUNDER BLISTEREDCOATINGMK. B.9-1-T2-2SRUST / CORROSION @HORZ. BM. & COL.INTERSECT UNDERBLISTERED COATINGMK. B.9-1-T2-1SRUST / CORROSION @EAST FACE OF HORZ.BM. & COL. INTERSECTUNDER BLISTEREDCOATINGREF. DETAIL 4-S1.10(SIM.)MK. B.9-1-T2-3NMINOR RUST /CORROSION @ EASTFACE OF HORZ. BM. &COL. INTERSECTMK. B.9-1-T2-2NMINOR RUST /CORROSION SPOT @T.O. HORZ. BM. & COL.MK. B.9-1-T2-1N2 - DETAIL - TRUSS "2" & COL. LINE "1" FRMG.SCALE: 1/4" = 1'-0"3 - DETAIL - TRUSS "2" & COL. LINE "1" FRMG.SCALE: 1/4" = 1'-0"MK. B.7-1-T2-3SREF. DETAIL 4-S1.10(SIM.)REF. DETAIL 4-S1.10(SIM.)MK. B.7-1-T2-2NMINOR RUST /CORROSION SPOT @T.O. HORZ. BM. & COL.INTERSECTREF. DETAIL 4-S1.10(SIM.)MK. B.7-1-T2-1NMINOR RUST /CORROSION SPOT @HORZ. BM. (T&B) &COL. INTERSECTREF. DETAIL 4-S1.10MK. B.5-1-T2-1SRUST / CORROSION@ T.O. HORZ. BM. &COL. INTERSECTREF. DETAIL 4-S1.10(SIM.)MK. B.5-1-T2-1N18 MAR 2022100% DESIGN - NOT FOR CONSTRUCTIONA09 MAY 2022FINAL DESIGN - FINAL REVIEW NOT FOR CONSTRUCTIONB23 MAY 2022FINAL DESIGN - RELEASED FOR BIDC1XNOTES CTD. ...9. " " SYMBOL ON DRAWING INDICATES MARK NO. FOR BASE PLATE REPAIRS. REFERENCEDRAWING S-1.09 "KEY NOTES - COLUMN BASE PLATE REPAIRS" AND APPLICABLE SECTIONS& DETAILS AS REQUIRED.10. REFERENCE DWG. S0.00 FOR ADDITIONAL GENERAL NOTES, MATERIAL SPECIFICATIONS &REQUIREMENTS, DESIGN CRITERIA AND LEGEND.12TRUSS CONN. LOCATION MK. # LEGEND EXAMPLE:TRUSS CONNECTION LOCATION MK. # = B.9-1-T2-3SB.9 = EAST / WEST ORIENTED COLUMN LINE DIRECTION ON PLAN 1-S1.00.1 = NORTH / SOUTH ORIENTED COLUMN LINE DIRECTION ON PLAN 1-S1.00.T1= EXISTING TRUSS TYPE T1 OR T2 AS NOTED ON PLAN 1-S1.00 & TRUSS DETAIL ELEVATIONS.3= ELEVATION ABOVE THE EXISTING SLAB-ON-GRADE AS INDICATED w/ " X " SYMBOL ON DWG.'s S1.01 & S1.02.S= SOUTH / NORTH SIDE OF THE EXISTING COLUMN.DESCRIPTION270" B.4EXIST. HSS BM.EXIST. W12 COL.(REF. NOTE 8)EXIST. HSS BM.C HSS & PLREF. NOTE 7(TYP.)9"x4"x14" THK. x 412" LONGBENT PLL3/16BENT. PTO FLG.(TYP.)3/163/16LF.S. P TO HSS(TYP.)3 SIDES(TYP.)L9"B.2B.2EXIST. HSS BRACEEXIST. W12 COL.(REF. NOTE 8)EXIST. COL.(O/F FLG.)EXIST. COL.(I/F FLG.)5 1/2"(*)EXIST. TRUSS BTM.CHORDEXIST. HSS BTM. CHORDBRACEEXIST. TRUSS HSSWEBEXIST. L6x312REMOVE EXIST. SURFACERUST, PREP STL. & APPLYNEW COATINGS1.11STRUCTURALEXIST. BLDG. A TRUSS CONDITIONS &REPAIRS (SHT. 9 OF 11)1. IN GENERAL REPAIR OF THE EXISTING STRUCTURAL STEEL TRUSSES AND THE SECONDARYEXTERIOR WALL BEAMS INVOLVES REPAIRS TO INTERIOR VERTICAL, HORIZONTAL & DIAGONALSURFACES OF THE TRUSSES, COLUMNS, CONNECTION PLATES OR ANGLES, BASE PLATES ANDANCHOR BOLTS AND HARDWARE. IN GENERAL REPAIR WORK INCLUDES THE FOLLOWING:a.) REMOVING EXISTING COATINGS TO BARE METAL.b.) REMOVING SURFACE RUST OR THRU WALL RUST AND CLEANING SURFACES TO BARE METAL.c.) PREPARING BARE METAL SURFACES TO SSPC-SP6 "COMMERCIAL BLAST CLEANING" CRITERIA.d.) WELDING NEW STEEL PLATE OR ANGLE SECTIONS TO THE EXISTING STEEL SECTIONS.REGARDING FIELD WELDING AND PREPARATION TO SSPC-SP6 CRITERIA, THE MAXIMUM BASEMETAL TEMPERATURE AT DEMARCATION BETWEEN BRIGHT METAL AND THE EXISTING COATINGSTO BE CONFIRMED w/ THE USE OF 182° F TEMPILSTIK's BETWEEN WELD PASSES.e.) INSTALL NEW COATING SYSTEM ON THE REPAIRED AREAS TO MATCH2. CODE FOR UTILIZING TRUSS CONNECTION LOCATIONS MARK NUMBERS AS FOLLOWS:a.) COL. ID E/W DIRECTION - COL. ID N/S DIRECTION - TRUSS TYPE - ELEVATION ABOVE BASE PLATE.b.) COORDINATE w/ TRUSS ELEVATIONS DWG.'s S-1.01 & S-1.02 FOR HEIGHT CODES 0 TO 5.c.) COORDINATE w/ THE "TRUSS CONN. LOCATION MK. # LEGEND EXAMPLE" DWG. S1.10 FORADDITIONAL INFORMATION.NOTES:DESCRIPTIONDATEREVISIONSSCALEHORIZONTAL:VERTICAL:STATUS:DRAWNPROJ. MGR. DESIGNEDCHECKEDPROJ. START DATE:MCE PROJ. #REV.NO.2021.NOV00992-0261LONG CENTER NATATORIUMSTRUCTURAL FRAME REPAIRSREVISIONDRAWING NUMBERwww.mckimcreed.comCA Lic. No. 29588Phone: (727) 442-7196, Fax: (727) 461-3827Clearwater, Florida 33756-33311365 Hamlet AvenueWFBWFBWFB / AEAAAHNAAS NOTEDRELEASED FOR BIDSTRUCTURALFINAL DESIGN SUBMITTALC1 - DETAIL - TRUSS "2" & COL. LINE "1" FRMG.SCALE: 1/4" = 1'-0"4 - DETAIL - B.4-1-T2-1 REPAIRSCALE: 3/4" = 1'-0"NOTES CTD. ...3. REGARDING VERIFYING CONDITION OF EXISTING STEEL, NOTE THE FOLLOWING:a.) CONDITIONS OF STEEL MAY HAVE CHANGED SINCE SITE REVIEWS. NOTIFY THE ENGINEEROF SITE CONDITIONS THAT MAY BE DIFFERENT THAN INDICATED. IN ADDITION NOTIFY THEENGINEER OF AREAS THAT ARE NOT CURRENTLY INDICATED BUT MAY DISPLAY RUST,CORROSION, AND / OR COATING PEELING OR LOSS FOR DIRECTIONS HOW TO PROCEED.4. COORDINATE w/ DETAILS REFERENCED FOR ANGLE / PLATE LAYOUT DIM.'s & WELD REQ.'s. U.N.O..5. IF COATING REMOVAL YIELDS SURFACE PITTING GRIND SMOOTH & TO SURFACE PREP. REQ.'s.6. PLATE OR ANGLE ASSEMBLIES NOT REQUIRED PROVIDED REMOVAL OF THE EXISTINGCOATING / CORROSION & SURFACE PREP DOES NOT YIELD UNEXPECTED RESULTS & REPAIRSCANNOT BE INSTALLED AS NOTED.7. REMOVE & REINSTALL EXIST. WINDOW GLASS & FRAME TO REPAIR IF REQ'D.8. THE W12 COL.'s INSTALLED w/ ADDITIONAL STEEL SECTION @ THE I/F OF THE W12 EXTR. FLANGE.RECORD DWG.'s REVIEWED COULD NOT CONFIRM THE SECTION. SITE VISIT REVIEW APPEARED TOINDICATE (2) L6x3 SECTIONS INSTALLED w/ (1) L6x3 EACH SIDE OF THE WEB. FIELD VERIFY AS REQ.'D& NOT SHOWN ELEVATIONS FOR CLARITY. REFERENCE DETAIL 5-S1.11 FOR CLARITY.REF. DETAIL 4-S1.10REF. DETAIL 4-S1.11ESTIMATED BILL OF MATERIALS ... S1.11ITEM #01COMPONENTNOTESQTY.DESCRIPTIONBENT PLATE0'-9"x4"x14" x 412"FILLET WELD316" EFF. THROATFLARE BEVEL WELDFILLET WELDPARTIAL PEN.RUST / CORROSION @EAST FACE OF HORZ.BM. & COL. INTERSECTUNDER BLISTEREDCOATING2 - DETAIL - TRUSS "2" & COL. LINE "1" FRMG.SCALE: 1/4" = 1'-0"3 - DETAIL - TRUSS "2" & COL. LINE "10.3" FRMG.SCALE: 1/4" = 1'-0"REF. DETAIL 4-S1.10(SIM.)[REF. NOTE 5 @ BM.]MINOR RUST /CORROSION SPOT @T.O. HORZ. BM. & COL.INTERSECTRUST / CORROSION @EAST FACE & T.O.HORZ. BM. & COL.INTERSECT(SIM.)MK. B.4-1-T2-1SMK. B.4-1-T2-1NRUST / CORROSION @EAST FACE & T.O.HORZ. BM. & COL.INTERESECTMK. B.2-1-T2-3NREF. DETAIL 4-S1.11MK. B.2-1-T2-1N18 MAR 2022100% DESIGN - NOT FOR CONSTRUCTIONA09 MAY 2022FINAL DESIGN - FINAL REVIEW NOT FOR CONSTRUCTIONB23 MAY 2022FINAL DESIGN - RELEASED FOR BIDCREF. DETAIL 5-S1.11MK. B.2-10.3-T2-4SMINOR RUST / CORROSIONSPOTS @ TRUSS CONN.BRACKET & BOLTHARDWARE @ T.O. COL.(SIM.)5 - DETAIL - B.2-10.3-T2-4 REPAIRSCALE: 3/4" = 1'-0"X2NOTES CTD. ...9. " " SYMBOL ON DRAWING INDICATES MARK NO. FOR BASE PLATE REPAIRS. REFERENCEDRAWING S-1.09 "KEY NOTES - COLUMN BASE PLATE REPAIRS" AND APPLICABLE SECTIONS& DETAILS AS REQUIRED.10. REFERENCE DWG. S0.00 FOR ADDITIONAL GENERAL NOTES, MATERIAL SPECIFICATIONS & REQUIREMENTS, DESIGN CRITERIA AND LEGEND.110'-658"x658"x 38" x 312"BENT PLATE2022516" EFF. THROAT70"50"20"030405 B.4B.5S1.12STRUCTURALEXIST. BLDG. A TRUSS CONDITIONS &REPAIRS (SHT. 10 OF 11)1. IN GENERAL REPAIR OF THE EXISTING STRUCTURAL STEEL TRUSSES AND THE SECONDARYEXTERIOR WALL BEAMS INVOLVES REPAIRS TO INTERIOR VERTICAL, HORIZONTAL & DIAGONALSURFACES OF THE TRUSSES, COLUMNS, CONNECTION PLATES OR ANGLES, BASE PLATES ANDANCHOR BOLTS AND HARDWARE. IN GENERAL REPAIR WORK INCLUDES THE FOLLOWING:a.) REMOVING EXISTING COATINGS TO BARE METAL.b.) REMOVING SURFACE RUST OR THRU WALL RUST AND CLEANING SURFACES TO BARE METAL.c.) PREPARING BARE METAL SURFACES TO SSPC-SP6 "COMMERCIAL BLAST CLEANING" CRITERIA.d.) WELDING NEW STEEL PLATE OR ANGLE SECTIONS TO THE EXISTING STEEL SECTIONS.REGARDING FIELD WELDING AND PREPARATION TO SSPC-SP6 CRITERIA, THE MAXIMUM BASEMETAL TEMPERATURE AT DEMARCATION BETWEEN BRIGHT METAL AND THE EXISTING COATINGSTO BE CONFIRMED w/ THE USE OF 182° F TEMPILSTIK's BETWEEN WELD PASSES.e.) INSTALL NEW COATING SYSTEM ON THE REPAIRED AREAS TO MATCH2. CODE FOR UTILIZING TRUSS CONNECTION LOCATIONS MARK NUMBERS AS FOLLOWS:a.) COL. ID E/W DIRECTION - COL. ID N/S DIRECTION - TRUSS TYPE - ELEVATION ABOVE BASE PLATE.b.) COORDINATE w/ TRUSS ELEVATIONS DWG.'s S-1.01 & S-1.02 FOR HEIGHT CODES 0 TO 5.c.) COORDINATE w/ THE "TRUSS CONN. LOCATION MK. # LEGEND EXAMPLE" DWG. S1.10 FORADDITIONAL INFORMATION.NOTES:DESCRIPTIONDATEREVISIONSSCALEHORIZONTAL:VERTICAL:STATUS:DRAWNPROJ. MGR. DESIGNEDCHECKEDPROJ. START DATE:MCE PROJ. #REV.NO.2021.NOV00992-0261LONG CENTER NATATORIUMSTRUCTURAL FRAME REPAIRSREVISIONDRAWING NUMBERwww.mckimcreed.comCA Lic. No. 29588Phone: (727) 442-7196, Fax: (727) 461-3827Clearwater, Florida 33756-33311365 Hamlet AvenueWFBWFBWFB / AEAAAHNAAS NOTEDRELEASED FOR BIDSTRUCTURALFINAL DESIGN SUBMITTALCNOTES CTD. ...3. REGARDING VERIFYING CONDITION OF EXISTING STEEL, NOTE THE FOLLOWING:a.) DURING SITE VISITS NOT ALL AREAS OF THE EXISTING FACILITY COULD BE EASILY ACCESSED SAFELY w/ THE LIFT.b.) CONTRACTOR TO VERIFY IF EXISTING STEEL SECTIONS NOTED EXHIBITING SIGNS OF RUST,CORROSION OR LOSS OF COATING.c.) NOTIFY ENGINEER OF AREAS THAT ARE CURRENTLY INDICATED BUT MAY DISPLAY RUST,CORROSION, AND / OR COATING PEELING OR LOSS FOR DIRECTIONS HOW TO PROCEED.4. COORDINATE w/ DETAILS REFERENCED FOR ANGLE / PLATE LAYOUT DIM.'s & WELD REQ.'s. U.N.O..5. IF COATING REMOVAL YIELDS SURFACE PITTING GRIND SMOOTH & TO SURFACE PREP. REQ.'s.6. PLATE OR ANGLE ASSEMBLIES NOT REQUIRED PROVIDED REMOVAL OF THE EXISTINGCOATING / CORROSION & SURFACE PREP DOES NOT YIELD UNEXPECTED RESULTS & REPAIRSCANNOT BE INSTALLED AS NOTED.7. REMOVE & REINSTALL EXIST. WINDOW GLASS & FRAME TO REPAIR IF REQ'D.8. THE W12 COL.'s INSTALLED w/ ADDITIONAL STEEL SECTION @ THE I/F OF THE W12 EXTR. FLANGE.RECORD DWG.'s REVIEWED COULD NOT CONFIRM THE SECTION. SITE VISIT REVIEW APPEARED TOINDICATE (2) L6x3 SECTIONS INSTALLED w/ (1) L6x3 EACH SIDE OF THE WEB. FIELD VERIFY AS REQ.'D& NOT SHOWN ELEVATIONS FOR CLARITY. REFERENCE DETAIL 5-S1.11 FOR CLARITY.RUST / CORROSION @T.O. HORZ. BM. & COL.INTERSECT1 - DETAIL - TRUSS "2" & COL. LINE "10.3" FRMG.SCALE: 1/4" = 1'-0"RUST / CORROSIONSPOT @ T.O. HORZ. BM.18 MAR 2022100% DESIGN - NOT FOR CONSTRUCTIONA09 MAY 2022FINAL DESIGN - FINAL REVIEW NOT FOR CONSTRUCTIONB23 MAY 2022FINAL DESIGN -RELEASED FOR BIDCMINOR RUST / CORROSIONSPOTS @ TRUSS CONN.BRACKET & BOLTHARDWARE @ T.O. COL.MK. B.4-10.3-T2-5N/SVERIFY CONDITION OFT.O. CHORD, HORZ.BRACE, COL. & WEBDIAGONAL DOES NOTREQUIRE REPAIR(REF. NOTE 3)REF. DETAIL 5-S1.11(SIM.)MK. B.4-10.3-T2-4SMK. B.4-10.3-T2-3NREF. DETAIL 4-S1.10(SIM.)REF. DETAIL 4-S1.10MK. B.4-10.3-T2-2S2 - DETAIL - TRUSS "2" & COL. LINE "10.3" FRMG.SCALE: 1/4" = 1'-0"MK. B.4-10.3-T2-1SRUST / CORROSIONSPOT @ T.O. HORZ. BM.& COL. INTERSECTREF. DETAIL 4-S1.10(SIM.)REF. DETAIL 5-S1.11(SIM.)MK. B.5-10.3-T2-4SMINOR RUST / CORROSIONSPOTS @ TRUSS CONN.BRACKET & BOLTHARDWARE @ T.O. COL.(N.S. & F.S. COL. WEB)MINOR RUST / CORROSIONSPOTS @ B.O. TRUSS HSSHORZ. BRACEREF. DETAIL 4-S1.11MK. B.5-10.3-T2-1SRUST / CORROSION @T.O. HORZ. BM.& COL. INTERSECTUNDER BLISTEREDCOATING(SIM.)X2NOTES CTD. ...9. " " SYMBOL ON DRAWING INDICATES MARK NO. FOR BASE PLATE REPAIRS. REFERENCEDRAWING S-1.09 "KEY NOTES - COLUMN BASE PLATE REPAIRS" AND APPLICABLE SECTIONS& DETAILS AS REQUIRED.10. REFERENCE DWG. S0.00 FOR ADDITIONAL GENERAL NOTES, MATERIAL SPECIFICATIONS & REQUIREMENTS, DESIGN CRITERIA AND LEGEND.2ESTIMATED BILL OF MATERIALS ... S1.12ITEM #01COMPONENTNOTESQTY.DESCRIPTIONBENT PLATE0'-9"x4"x14" x 412"FILLET WELD316" EFF. THROATFLARE BEVEL WELDFILLET WELDPARTIAL PEN.0'-658"x658"x38" x 312"BENT PLATE4021516" EFF. THROAT140"25"10"030405 B.7B.9S1.13STRUCTURALEXIST. BLDG. A TRUSS CONDITIONS &REPAIRS (SHT. 11 OF 11)1. IN GENERAL REPAIR OF THE EXISTING STRUCTURAL STEEL TRUSSES AND THE SECONDARYEXTERIOR WALL BEAMS INVOLVES REPAIRS TO INTERIOR VERTICAL, HORIZONTAL & DIAGONALSURFACES OF THE TRUSSES, COLUMNS, CONNECTION PLATES OR ANGLES, BASE PLATES ANDANCHOR BOLTS AND HARDWARE. IN GENERAL REPAIR WORK INCLUDES THE FOLLOWING:a.) REMOVING EXISTING COATINGS TO BARE METAL.b.) REMOVING SURFACE RUST OR THRU WALL RUST AND CLEANING SURFACES TO BARE METAL.c.) PREPARING BARE METAL SURFACES TO SSPC-SP6 "COMMERCIAL BLAST CLEANING" CRITERIA.d.) WELDING NEW STEEL PLATE OR ANGLE SECTIONS TO THE EXISTING STEEL SECTIONS.REGARDING FIELD WELDING AND PREPARATION TO SSPC-SP6 CRITERIA, THE MAXIMUM BASEMETAL TEMPERATURE AT DEMARCATION BETWEEN BRIGHT METAL AND THE EXISTING COATINGSTO BE CONFIRMED w/ THE USE OF 182° F TEMPILSTIK's BETWEEN WELD PASSES.e.) INSTALL NEW COATING SYSTEM ON THE REPAIRED AREAS TO MATCH2. CODE FOR UTILIZING TRUSS CONNECTION LOCATIONS MARK NUMBERS AS FOLLOWS:a.) COL. ID E/W DIRECTION - COL. ID N/S DIRECTION - TRUSS TYPE - ELEVATION ABOVE BASE PLATE.b.) COORDINATE w/ TRUSS ELEVATIONS DWG.'s S-1.01 & S-1.02 FOR HEIGHT CODES 0 TO 5.c.) COORDINATE w/ THE "TRUSS CONN. LOCATION MK. # LEGEND EXAMPLE" DWG. S1.10 FORADDITIONAL INFORMATION.NOTES:DESCRIPTIONDATEREVISIONSSCALEHORIZONTAL:VERTICAL:STATUS:DRAWNPROJ. MGR. DESIGNEDCHECKEDPROJ. START DATE:MCE PROJ. #REV.NO.2021.NOV00992-0261LONG CENTER NATATORIUMSTRUCTURAL FRAME REPAIRSREVISIONDRAWING NUMBERwww.mckimcreed.comCA Lic. No. 29588Phone: (727) 442-7196, Fax: (727) 461-3827Clearwater, Florida 33756-33311365 Hamlet AvenueWFBWFBWFB / AEAAAHNAAS NOTEDRELEASED FOR BIDSTRUCTURALFINAL DESIGN SUBMITTALCNOTES CTD. ...3. REGARDING VERIFYING CONDITION OF EXISTING STEEL, NOTE THE FOLLOWING:a.) DURING SITE VISITS NOT ALL AREAS OF THE EXISTING FACILITY COULD BE EASILY ACCESSED SAFELY w/ THE LIFT.b.) CONTRACTOR TO VERIFY IF EXISTING STEEL SECTIONS NOTED EXHIBITING SIGNS OF RUST,CORROSION OR LOSS OF COATING.c.) NOTIFY ENGINEER OF AREAS THAT ARE CURRENTLY INDICATED BUT DISPLAY RUST,CORROSION, AND / OR COATING PEELING OR LOSS FOR DIRECTIONS HOW TO PROCEED.4. COORDINATE w/ DETAILS REFERENCED FOR ANGLE / PLATE LAYOUT DIM.'s & WELD REQ.'s. U.N.O..5. IF COATING REMOVAL YIELDS SURFACE PITTING GRIND SMOOTH & TO SURFACE PREP. REQ.'s.6. PLATE OR ANGLE ASSEMBLIES NOT REQUIRED PROVIDED REMOVAL OF THE EXISTINGCOATING / CORROSION & SURFACE PREP DOES NOT YIELD UNEXPECTED RESULTS & REPAIRSCANNOT BE INSTALLED AS NOTED.7. REMOVE & REINSTALL EXIST. WINDOW GLASS & FRAME TO REPAIR IF REQ'D.8. THE W12 COL.'s INSTALLED w/ ADDITIONAL STEEL SECTION @ THE I/F OF THE W12 EXTR. FLANGE.RECORD DWG.'s REVIEWED COULD NOT CONFIRM THE SECTION. SITE VISIT REVIEW APPEARED TOINDICATE (2) L6x3 SECTIONS INSTALLED w/ (1) L6x3 EACH SIDE OF THE WEB. FIELD VERIFY AS REQ.'D& NOT SHOWN ELEVATIONS FOR CLARITY. REFERENCE DETAIL 5-S1.11 FOR CLARITY.RUST / CORROSION @T.O. HORZ. BM. UNDERBLISTERED COATING1 - DETAIL - TRUSS "2" & COL. LINE "10.3" FRMG.SCALE: 1/4" = 1'-0"18 MAR 2022100% DESIGN - NOT FOR CONSTRUCTIONA09 MAY 2022FINAL DESIGN - FINAL REVIEW NOT FOR CONSTRUCTIONB23 MAY 2022FINAL DESIGN - RELEASED FOR BIDCRUST / CORROSION @TRUSS BTM. CHORD / HSSHORZ. BRACE WELDREF. DETAIL 5-S1.11(SIM.)REF. DETAIL 4-S1.10(SIM.)REF. DETAIL 4-S1.112 - DETAIL - TRUSS "2" & COL. LINE "10.3" FRMG.SCALE: 1/4" = 1'-0"REF. DETAIL 5-S1.11(SIM.)MINOR RUST / CORROSIONSPOTS @ TRUSS CONN.BRACKET & BOLTHARDWARE @ T.O. COL.(N.S. & F.S. COL. WEB)RUST / CORROSION @ SIDES& B.O. TRUSS HSS HORZ.BRACEMINOR RUST / CORROSION@ SOUTH FACE OF COL.UNDER BLISTERED COATINGMINOR RUST / CORROSIONSPOTS @ TRUSS CONN.BRACKET & BOLTHARDWARE @ T.O. COL.MK. B.7-10.3-T2-4SMK. B.7-10.3-T2-3NMK. B.7-10.3-T2-1SRUST / CORROSION @T.O. HORZ. BM.& COL. INTERSECT(SIM.)[REF. NOTE 5]MK. B.9-10.3-T2-4SMK. B.9-10.3-T2-2NMINOR RUST / CORROSION@ T.O. HORZ. BM. UNDERBLISTERED COATINGREF. DETAIL 4-S1.10(SIM.)REF. DETAIL 4-S1.10(SIM.)MK. B.9-10.3-T2-2SMK. B.9-10.3-T2-1NRUST / CORROSION @T.O. HORZ. BM. & COL.INTERSECT UNDERBLISTERED COATINGREF. DETAIL 4-S1.11(SIM.)[REF. NOTE 5]X2NOTES CTD. ...9. " " SYMBOL ON DRAWING INDICATES MARK NO. FOR BASE PLATE REPAIRS. REFERENCEDRAWING S-1.09 "KEY NOTES - COLUMN BASE PLATE REPAIRS" AND APPLICABLE SECTIONS& DETAILS AS REQUIRED.10. REFERENCE DWG. S0.00 FOR ADDITIONAL GENERAL NOTES, MATERIAL SPECIFICATIONS & REQUIREMENTS, DESIGN CRITERIA AND LEGEND.2ESTIMATED BILL OF MATERIALS ... S1.13ITEM #01COMPONENTNOTESQTY.DESCRIPTIONBENT PLATE0'-9"x4"x14" x 412"FILLET WELD316" EFF. THROATFLARE BEVEL WELDFILLET WELDPARTIAL PEN.0'-658"x658"x38" x 312"BENT PLATE4022516" EFF. THROAT135"50"20"030405 9942 Currie Davis Dr., Ste. H Tampa, FL 33619 813.995.0300 emeraldmep.com FL EB # 0027845 LONG CENTER NATATORIUM 1501 N BELCHER RD, CLEARWATER, FL 33765 HVAC DESIGN REPORT DECEMBER 12, 2023 1.0 Purpose The existing Long Center Natatorium is in need of a renovation. The existing HVAC systems have surpassed their life span and are not operating properly. Recurring condensation on the interior of the glass walls is corroding the exterior wall steel frame structure. The Owner, the City of Clearwater, is considering two renovation options: Option 1: Remove the existing window glass, rehab the existing steel frame structure, build a new thermally-broke glass curtain wall structure on the exterior side of the existing steel frame, and provide all new HVAC systems. Option 2: Remove the existing window glass, rehab the existing steel frame structure, build new solid exterior walls with reduced glass area on the exterior side of the existing steel frame, and provide all new HVAC systems. Emerald Engineering, Inc. has been commissioned by Wannemacher Jensen Architects, Inc. to provide a preliminary HVAC design and run an energy model for both options. This information will then be used in a life cycle cost analysis to determine which option is the most economical over the anticipated life span of the building. This report documents our analysis and findings. 9942 Currie Davis Dr., Ste. H Tampa, FL 33619 813.995.0300 emeraldmep.com FL EB # 0027845 2.0 Option 1 HVAC Design Below is a brief rendering of the architectural design for Option 1. Please refer to Wannemacher Jensen Architect’s reports and drawings for more information. We understand the new glass curtain wall structure will be completely thermally-broke from the existing steel structure, so that the outside temperature will not transfer to the inside steel and cause condensation (and eventually corrosion of the steel). The new glass values are Winter U-Value 0.24, Summer U- value 0.20, and Solar Heat Gain Coefficient 0.22. The following are our HVAC design considerations: • Large pool is kept at 80 degrees F • Small pool is kept at 90 degrees F • Interior design temperature of 82 degrees F (two degrees above large pool temperature) • Interior design humidity of 55% RH • Provide a minimum of 6 air changes per hour (ACH) • 400 people in the pool area • Additional 100 people in the spectator area According to our HVAC load calculations, Option 1 will require two roof mounted de-humidifiers (approximately 70 tons each, 35,000 CFM of supply air each, and 19,000 CFM of outside air each) and two supply fan recirculating units (20,000 CFM each). The supply fan units do not contain cooling or heating elements; they are only used to provide the additional recirculation of air to achieve 6 ACH. Refer to Appendix A for cut sheets and schedules of these four HVAC systems. 9942 Currie Davis Dr., Ste. H Tampa, FL 33619 813.995.0300 emeraldmep.com FL EB # 0027845 All four HVAC systems shall be mounted on the roof of the natatorium on a steel structure that is isolated to restrict transfer of vibration and noise from the units to the building. Main ductwork shall be roof mounted and drop down into the natatorium. Interior ductwork wrapping around the perimeter of the pool shall be exposed ductsox, to avoid corrosion. Refer to Appendix B for a sketch of the HVAC system layout. The equipment budget for the HVAC system is $1.3 million. This only includes the equipment and not installation, ductwork, piping, controls, etc. 3.0 Option 2 HVAC Design Above is an architectural rendering of Option 2 provided by Wannemacher Jensen Architects. See their documentation for more information. The exterior glass area has been reduced. We have modeled this Option 2 building in our HVAC load calculation software and determined that it will not reduce the HVAC equipment sizes from Option 1. The tonnage of the equipment is based largely on the pool’s latent heat load (moisture removal load) and air exchanges. Both of those are the same in Option 1 and Option 2. A reduction of the exterior glass only reduces the sensible load (radiated heat load), and not by enough to reduce the overall tonnage of the equipment. The glass being specified has excellent insulation performance. Therefore the HVAC systems for Option 2 match that of Option 1. Please refer to Appendix A for cut sheets and schedules of the four HVAC systems and Appendix B for a sketch of the HVAC system layout. The equipment budget for the Option 2 HVAC systems is $1.3 million. This only includes the equipment and not installation, ductwork, piping, controls, etc. 9942 Currie Davis Dr., Ste. H Tampa, FL 33619 813.995.0300 emeraldmep.com FL EB # 0027845 4.0 Energy Model Results Separate energy models were completed for Option 1 and Option 2 using the same HVAC system, but different architectural building designs (the reduction in exterior glass). Refer to Appendix C for Option 1 and Appendix D for Option 2. The comparison shows that the HVAC system in Option 2 used about 15% less energy than the HVAC system in Option 1 over the course of a year. This equates to about $20,000 per year in energy cost savings. It should be noted that these energy models include many assumptions, such as a blended energy rate, operating hours, lighting load, occupancy, etc. They also do not include plug loads (such as receptacles, computers, etc.), pool equipment loads (pumps, pool lights, etc.), or any other portion of the building except for the natatorium. Therefore, these energy costs cannot be compared to current energy bills or be used to predict future energy bills. The energy models have been constructed solely to determine the difference in energy consumption due to the difference in glass areas between the two options. Please feel free to call me if you have any questions. Sincerely, Michael Costello, PE Director of Mechanical Division 9942 Currie Davis Dr., Ste. H Tampa, FL 33619 813.995.0300 emeraldmep.com FL EB # 0027845 APPENDIX A Submittal 33279 u64699 [20231024] [13.37].pdf60 65707590% RH80% RH70% RH60% R H 5 0 % R H 4 0% R H 3 0 % R H 20% RH 10% RH 140 130 120 110 100 90 80 70 60 50 40 30 20 10 02728293031333435363738394ENTHALPY AT SATURATIONGRAINS OF MOISTURE PER POUND OF DRY AIR10510095908580757065605550 14.0 CU. FT.13.5 CU. FT.13.0 CU. FT.21222324252632DRY BULB °F SELECTAIRE PLUS™ SERIES DEHUMIDIFIERS Water Parks School Aquatic Facilities Natatoriums Desert Aire’s patent pending SelectAire Plus™ (SP Series) dehumidification systems offer you complete humidity control solutions for large indoor pool applications and water parks. Building on our years of design, manufacture and applications expertise of natatorium-specific equipment, Desert Aire developed the SelectAire Plus™ Series to provide industry leading performance, efficiency and value. The SelectAire Plus™ Series incorporates the original SelectAire™ System energy recovery technology and adds features for applications that require the superior cabinetry, state-of-the-art fan design and next-generation control features for enhanced setup and serviceability. Best of all, an industry exclusive wrap-around heat pipe enhances the moisture removal capacity and efficiency of SelectAire Plus™ Series dehumidifiers, getting more work out of less energy throughout the year. MAJOR FEATURES AND BENEFITS • Unique dual circuit design with enhanced dehumidification section and a separate enhanced cooling and energy recovery section is an industry- leading exclusive • SelectAire Energy Recovery recovers more exhaust air energy than any other technology • Automated control of ventilation air and exhaust air protects the occupants and the building • Direct Expansion Technology with scroll compressors provides more dehumidification and higher energy efficiency than units with secondary glycol loops • New optional air-cooled packaged and integrated gas heating solutions simplify installations • Backward inclined airfoil plenum fans for both supply and exhaust are matched to the specific airflow and static pressure requested for the highest efficiency. All fans include electronically commutated (EC) motors or AC motors with variable speed drives in a fan-wall configuration OPTIMIZING SOLUTIONS THROUGH SUPERIOR DEHUMIDIFICATION TECHNOLOGY Next Generation Latent Enhancement Systems for Large Natatoriums & Water Parks Next Generation Latent Enhancement Systems for Large Natatoriums & Water Parks Submittal 33279 u64699 [20231024] [13.37].pdf DEHUMIDIFICATION OPTIONS • 2” double-wall injected foam cabinet with hinged access doors ensure sealing even against high static pressure and provides excellent serviceability • Single piece designs for large units and sectioned system options make installation simple – indoors or out ENHANCED LATENT DESIGN SelectAire Plus™ Series uses a unique dual-circuit design to maximize the dehu- midification capacity. A wrap-around heat pipe on one of the circuits enhances the moisture removal capabilities of the evaporator coil. The nature of the wrap- around heat pipe also tempers the air as it leaves the coil. This provides a more neutral leaving air condition and minimizes temperature fluctuations and drafts in the poolroom. When warm air passes over the heat pipe assembly, the refrigerant within the heat pipe vaporizes, carrying heat to the second section of heat pipe assembly placed downstream. Because some heat has been removed from the air before encountering the evaporator coil, the incoming air stream section is called the pre-cool heat pipe. Air entering the evaporator coil is assisted to a lower temperature, therefore coming closer to saturation and resulting in greater condensate removal by the coil. The “over-cooled” air is then reheated to a desirable temperature by the reheat heat pipe section, using the heat transferred from the pre-cool heat pipe. This entire process of pre-cool and reheat is accomplished with very little additional energy use. Figure 1 - SelectAire Plus™ Series unique enhanced latent design with heat pipe assembly When there is a call for cooling only or a call for more cooling than the dehumidi- fication-enhanced circuit is providing while operational, the cooling circuit is enabled. The operation of the circuit is further enhanced through the use of refrigeration suction pressure controls and airflow monitoring. As moisture load is reduced in the space, airflow is increased even further until the space is cooled to the setpoint. When cooling is enabled the heat absorbed when cooling the air is rejected to the pool water circuit or an auxiliary heat sink such as a condenser located outdoors. Even the relative capacity of the individual circuits has been thoughtfully designed. Extensive field research has shown that the vast majority of poolrooms require more total dehumidification capacity than sensible cooling capacity. SelectAire Plus™ Series circuit sizes have been specifically developed to ensure that the sensible cooling load on a design day is addressed, yet efficiency is extremely high. When heating is required the SelectAire Plus™ System shifts dampers to reroute the air through this sensible cooling coil before exhausting it. The refrigeration system also re-routes the hot gas from the compressor so that it is rejected into the supply air. In this way, a significant amount of energy is recovered from the exhaust air. Desert Aire’s use of this “heat-pump” technique has no equal in the industry. Where other passive-type recovery devices including run-around glycol loops and exhaust air heat pipes have significantly reduced capacity at part-load heating conditions, the SelectAire Plus™ System has a constant capacity. This system also recovers much more heat as the energy in the exhaust air, in the form of moisture, is converted to pure air heat energy. INTEGRATED AND AUTOMATED VENTILATION AND EXHAUST AIR Ventilation air is critical for occupant comfort and safety. Also, maintaining negative static pressure relative to outdoors and adjacent spaces is a critical issue for the longevity of the structure. The standard outdoor air and exhaust air in the SelectAire Plus™ System has self balancing and monitoring capability. The design of the SelectAire Plus™ System helps to automate setup by directly monitoring the outdoor airflow rate and poolroom static pressure. Up to five modes of outdoor airflow rates can be programmed and controlled: Unoccupied; Occupied; Event; Alarm; and, Purge. The static pressure in the space is automatically controlled when modes are switched. The improved efficiency of this section is extremely important since most pools are inactive for a majority of their operating hours. This means only half of the capacity of the dehumidifier needs to be used. In addition cold, dry winter air also reduces the moisture loads of occupied active pools during much of the year. Thus a dehumidifier that maximizes its moisture removal efficiency for the majority of operating hours will yield the lowest operating cost system. This circuit on the SelectAire Plus™ Series will be approximately 25% more efficient than a conventional natatorium dehumidifier without this technology. COOLING AND ENERGY RECOVERY In addition to the enhanced moisture removal circuit, the SelectAire Plus™ Series features a second circuit optimized for cooling the air and recovering energy from the exhaust air. This circuit has a higher velocity over the cooling coil than the dehumidification enhanced circuit.Figure 2 - Negative static pressure in the poolroom Submittal 33279 u64699 [20231024] [13.37].pdf Static pressure, outdoor airflow and exhaust flow are directly read by personnel at the user interface. This helps to ensure that setup is done properly and with minimal effort. FANS The SelectAire Plus™ fans are custom designed for the application. Automated selection software evaluates available fan and motor systems for each application to optimize cost and efficiency. All fans modulate and are automatically controlled to ensure that correct flow rates are maintained through each component, regardless of filter loading or mode changes. All fans include high-performance backwards-inclined airfoil blades. Electronically commutated (EC) external-rotor motors or direct drive NEMA Premium efficient motors with variable speed drives are used in a fan-wall configuration. CABINET The cabinet is constructed of a 2” double wall panel with superior insulating prop- erties and fabricated to withstand pool room corrosive environments. Exterior pan- els are galvannealed steel with powder coating and G90 galvanized with architectural paint treatment. Interior cabinet panels are G90 galvanized steel. The cabinet has double-bypass seals on all doors for superior weather resistance and tight sealing against high static pressures. Service doors are located at all regular maintenance and inspection points. Major mechanical components are located out of the airstream for accessibility. This also ensures that any high humidity or corrosive indoor air does not affect operation or longevity. Indoor units contain a mechanical section for major components that is outside of the airstream. Lights and service outlet for this area are standard and can be powered by a 120 VAC 15A circuit supplied by the field. OPERATION Desert Aire’s indoor pool dehumidifier systems are flexible in their design options. This modular concept allows each system to be customized for specific dehumid- ification applications. Each module type is described below. REHEAT ONLY... This is the basic option which removes moisture from the air at the evaporator coil and reheats it before returning to the space as dehumidified air. REHEAT & WATER ... In addition to the reheat coil, a water-condensing coil is added to the refrigeration circuit. Either condenser can become the primary heat sink allowing the circuit’s latent and sensible heat to be directed to a water source or returned to the air. REHEAT & AIR REMOTE CONDENSER READY... This option offers a reheat coil and an air cooled remote condenser connection. REHEAT & WATER & AIR COOLED REMOTE CONDENSER READY...This is the combination of all heat sink options. The combination is used when only a partial water heatsink is available but full capacity dehumidification is required continu- ously, regardless of season. This is typical for large natatoriums and water parks. CONTROLS & MODES OF OPERATION Each circuit is controlled by the integral microprocessor based controller. This control system includes an easy-to read user interface. A Remote Display Terminal (RDT) may be ordered separately for remote mounting. The use of basic control and staging sequences provides great flexibility in optimizing dehumidification and energy recovery capacity. The system features control of all dehumidification functions including auxiliary heating, occupancy schedules and ventilation air. The control system also provides diagnostic readouts and alarms. Optional communication cards are offered that allow the system controller to be connected to a building automation system. Communication is offered for BACnet™ MS/TP, BACnet™ Ethernet™, LonWorks® and Modbus®. The system automatically controls the selection of the compressor set that should be operational. This depends on the internal loads such as humidity and temperature. With completely separate exhaust and ventilation air streams, the SelectAire Plus™ Series and its integrated dampers will provide the correct solution to the ever changing demands of natatorium internal space conditions. In the dehumidification mode the system will capture the high energy content of the exhaust air and return this energy back to the air or pool water at an industry- leading coefficient of performance (COP) approaching 5. This helps to minimize the amount of new energy required to make up the ventilation load’s heating requirement. Figure 3 - Dehumidification in Energy Recovery Mode Submittal 33279 u64699 [20231024] [13.37].pdf 435 2019/11 Many conventional dehumidifiers exhaust the air after the evaporator coil for construction convenience. The SelectAire Plus ™ System strategically configures its airflow arrangement to “Select” where the exhaust air is coming from. In the cooling mode the higher enthalpy return air is exhausted before the evaporator coil thus maintaining all of the cooling performed by the evaporator and delivering this cool air to the space. In the heating mode the energy of the high enthalpy containing return air is recovered by the evaporator coil and the cool air is exhausted after the coil. Refer to Desert Aire’s Technical Bulletin 6 – SelectAire Heat Recovery System, for more details. FILTERS • Return Air: 4” MERV 8, pleated filters • Outdoor Air: 4” MERV 8, pleated filters ELECTRICAL SERVICE • Hinged electrical panel with separate sections for high and low voltage components •Single point power connection for all units CONTROLS • Duct or wall mount temperature and humidity sensors • Integrated Display with an optional remote display terminal • BAS communication options • Built in time clock for standalone operation • Alarm Retention COIL COATING • Coil ElectroFin E-Coat to resist chemicals and corrosion AUXILIARY HEAT OPTIONS • Hot water coil supplied downstream from hot gas reheat coil • Steam coil supplied downstream from hot gas reheat coil • Electric SCR heat supplied downstream from hot gas reheat coil • Gas heater supplied downstream of blowers • Control outputs for field supplied auxiliary heating devices INSTALLATION LOCATION • Indoor • Outdoor • Rooftop CONDENSER (Choose per circuit) (All circuits reject the full THR - Total Heat of Rejection) • Packaged air-cooled condenser (outdoor units only) • Split air-cooled remote condenser • Water condenser for water loops or fluid cooler POOL WATER HEAT • Coaxial heat exchanger for recovery of heat to pool water WARRANTY • 2-year parts warranty • ElectroFin Coated coils include 5-year parts warranty STANDARD SP SERIES REFRIGERATION DESIGN FEATURES •Dual, independent refrigeration circuits operate independently or simultaneously •Heavy-duty scroll compressors located in a separate vestibule •Maximum of 38” coil height maximizes moisture removal • Sloped, stainless steel drain pan for each circuit • Minimum of 8” separation between evaporator and condenser coils prevents re-evaporation • One circuit is designed for maximized latent removal using a wrap-around heat pipe • One circuit is designed for sensible cooling and energy recovery R-410A refrigerant CABINET AND CONSTRUCTION • Base rails and supports constructed of 12-gauge galvanized steel channels •Interior is constructed of G90 galvanized steel BLOWER • Backward-inclined airfoil plenum fans •Electronically commutated (EC) or direct drive motors • All fans arranged in a fan array Figure 4 - Dehumidification in Cooling Mode OPTIMIZING SOLUTIONS THROUGH SUPERIOR DEHUMIDIFICATION TECHNOLOGY N120 W18485 Friestadt Road, Germantown, WI 53022 sales@desert-aire.com Submittal 33279 u64699 [20231024] [13.37].pdf AUXILIARY ELECTRIC HEAT ELECTRIC HEATOPTIONAL AUXILIARY ELECTRIC HEATING OPTIONS Desert Aire provides auxiliary electric heating options for the SelectAire Plus™ Series that are sized to meet the winter heatingrequirements of the outside air. These heating elements are utilized when the air temperature in the zone drops below the customer set point. Desert Aire sizes the heating elements to precisely match the load requirement of the system. The heaters are automatically controlled by the units microprocessor to maintain zone temperature. An SCR controller is used for the electric heat option to vary the heat output. Design Specifications The following list highlights the noteworthy features of the SelectAire Plus™ Series electric heaters: • System Single Point Power to Dehumidifier • NiCr 60 Corrosion-Resistant Element • Welded Construction Using 20 MSG Galvanized Steel • Automatic Reset High Temperature Limit Safety Switch • Manual Reset High Maximum Temperature Limit Safety Switch • Air Flow Pressure Switch • Fusing as Required for Each 48 Amp Circuit • Fused Circuits per N.E.C., UL, and CSA • SCR modulation Figure 1 - Detail of Electric Heating Element for SelectAire Plus™ Series Unit 435-e 2019/01 OPTIMIZING SOLUTIONS THROUGH SUPERIOR DEHUMIDIFICATION TECHNOLOGY N120 W18485 Friestadt Road, Germantown, WI 53022 sales@desert-aire.com Submittal 33279 u64699 [20231024] [13.37].pdf AUXILIARY HOT WATER HEAT HOT WATER HEAT OPTIONAL HOT WATER HEATING OPTIONS Desert Aire provides auxiliary heating options for its SelectAire Plus™ Series product line that are sized to meet the winter heating requirements of the space. These heating elements are utilized when the air temperature in the zone drops below the customer set point. Desert Aire sizes the heating elements to precisely match the load requirement of the system. The heaters are automatically controlled by the unit’s microprocessor to maintain an exact leaving airtemperature. A customer supplied hot water control valve is modulated from the controller with a 0 to 10 VDC direct acting signal. Please refer to figure 1 for a typical installation. HWC Design Inputs The coil is selected for each customer’s particular application based on the following criteria: · Entering water temperature (EWT), typically between 140° F and 180° F · Leaving water temperature (LWT), typically 20 degrees less than the EWT · Customer specified capacity required (MBH) · Entering air temperature (EAT), (the mix temperature of outdoor air at winter design with return air) · Specify fluid pressure drop maximum · Type and concentration of glycol used, if applicable For freeze protection Desert Aire uses a capillary type temperature sensor which is attached across the downstream face of the coil. Freezestat is set at 38 deg F with an auto reset switch. If engaged the unit controls would respond by closing the outdoor air damper, wait 5 minutes and if not reset, de-energize the fan, open the hot water coil valve 100%, and log the alarm on the controller. To size the control valve, please provide a qualified vendor the watertemperature, flow rate (gpm) and the requirement for a 0 to 10VDC signal and they will select the appropriatevalve to purchase. Desert Aire offers HW valve/actuators as an option. Please consult with your Desert Aire sales representative if you wish for Desert Aire to supply this component. Optional ElectroFin coil coating for pool environments is available.Figure 1 - Hot Water Piping Detail 435-f 2019/01 OPTIMIZING SOLUTIONS THROUGH SUPERIOR DEHUMIDIFICATION TECHNOLOGY N120 W18485 Friestadt Road, Germantown, WI 53022 sales@desert-aire.com Submittal 33279 u64699 [20231024] [13.37].pdf ELECTROFIN®E-COAT COIL COATING CORROSION RESISTANT COILSElectroFin®E-coat Coil Coating Desert Aire has partnered with Luvata ElectorFin for its coil coating because of its superior performance in eliminating corrosion and fin deterioration in the pool and coastal climate applications. ElectroFin®E-coat is a water-based, flexible epoxy polymer coating process engineered specifically for HVAC/R heat transfer coils. ElectroFin®uses a PPG POWERCRON®e-coat formulation specifically designed to provide excellent edge coverage of fins with a unique polymer that controls the flow characteristics of the coating. Benefits of ElectroFin’s factory-applied electrocoating process: • The only process that can guarantee 100% coil coverage without bridging, including enhanced fin designs • Excellent corrosion and UV resistance make it suitable for pool room and coastal environments Electrocoating is the process by which a metallic work piece (coil) is submerged in a paint / water bath where electricity is used to deposit paint onto it. Corrosion Resistance In the electrocoating process, the coil assembly acts in the same way as a magnet. The coating molecules are electrically attracted to the metallic coil surfaces, meaning the entire coil is completely and uniformly coated. When we mention the entire coil we are talking about the coil fins, end plates, copper tubing and copper return bends. In other words, the coating covers the entire coil assembly. The result is a finish which provides excellent resistance to pool chemical, coastal marine (salt-air), industrial and urban environments. When properly maintained, you can expect ElectroFin®e-coated coils to provide protection for years. Desert Aire provides a 5-year coil parts warranty as evidence of its superior protection. Resistance to UV Degradation When coils are to be subjected to ultraviolet exposure such as the remote condenser, they receive a spray-applied, UV-resistant urethane mastic topcoat. As a result, UV degradation of the epoxy e-coat polymer molecules is eliminated and the film integrity is maintained. This is offered as an option for our RC Series condensers. Figure 1 - ElectroFin®E-coat Process Submittal 33279 u64699 [20231024] [13.37].pdf CORROSION RESISTANT COILSProven Effective The electro-deposition process is the most automatic, controllable, and efficient method for applying a corrosion inhibiting coating to a metallic work piece. The process dictates that all metal surfaces are coated in an even, uniform finish. All coil surfaces reach an average e-coat dry film thickness of 1 mil (0.001”). It meets the 5B rating cross-hatch adhesion per ASTM B3359-93. Corrosion durability is confirmed through testing to no less than 5,000 hours salt spray resistance per ASTM B117-90 using scribed aluminum test coupons. Comparison to Fin Stock Coatings Not all coil coatings are the same. Many dehumidifier companies use a fin stock coating that is applied to the aluminum stock before the coil is manufactured. This means the edges of the fin, the copper tubes and the steel header remain uncoated. Figure 2 - Photo of a coated coil 435-j 2019/01 Figure 3 - Photo of a uncoated coil OPTIMIZING SOLUTIONS THROUGH SUPERIOR DEHUMIDIFICATION TECHNOLOGY N120 W18485 Friestadt Road, Germantown, WI 53022 sales@desert-aire.com Submittal 33279 u64699 [20231024] [13.37].pdf AUXILIARY GAS HEATING OPTION AUXILIARY GAS HEATOPTIONAL GAS HEATING MODULE Desert Aire provides auxiliary heating options for its SelectAire Plus™ Series product line that are available in several capacities to meet the winter specified heating requirements of the space. These heating elements are utilized when the air temperature in the space drops below the customer set point. Desert Aire sizes the heating elements to precisely match the load requirement of the system. The heaters are automatically controlled by the unit’s microprocessor to maintain an exact leaving air temperature. Desert Aire controls the heater output with a 0-10VDC control signal from the dehumidifier’s operating controller. Desert Aire combines different burner sizes to precisely match the load of the system. This may be in a single heater module or in multiple modules. A modulating gas valve is automatically controlled by the unit’s microprocessor to maintain an exact leaving air temperature. If multiple burner sets are utilized, then a venier sequence is used where the base burner is modulated and the others are staged. The system’s overall turn down ratio is a function of the number of heating modules and is summarized in the table below: Output Capacity (MBH) 640 800 960 1,280 1,600 1,920 Input Capacity (MBH) 800 1,000 1,200 1,600 2,000 2,400 Gas Module Qty. 2 2 2 4 4 4 Gas Connection One 2” NPT One 2” NPT One 2” NPT Two 2” NPT Two 2” NPT Two 2” NPT Effective Turndown Ratio 10 to 1 10 to 1 10 to 1 20 to 1 20 to 1 20 to 1 Figure 1 - Detail of Gas Heat Compartment on SelectAire Plus™ Series Unit Submittal 33279 u64699 [20231024] [13.37].pdf 435-k 2019/01 The gas module shall provide a minimum combustion efficiency of 80%, and listed for operation downstream of refrigeration or cooling system, and provide means for removal of condensate that occurs in the heat exchanger during cooling operation. They are listed for outdoor installation without the need for additional power ventilation. Heat exchanger shall be tubular in design and constructed of Type 304L stainless steel and employ (integral formed dimple restric- tors, formed turbulators) and provide for an unobstructed drainage path for condensate and provide a positive pitch to promote drainage. Additionally the gas module shall employ: • Patented inshot gas burners, with integral carryovers, capable of operation at 5:1 turndown with modulating controls • A combustion blower to provide for positive venting of flue gases • Pressure switch to prove air supply for combustion • Direct spark ignition of gas burners with remote flame sensor to prove carryover across all burners • An automatic reset type high limit switch to limit maximum outlet air temperature to less than 250° F • Manual reset flame rollout switch • Listed Combination Gas Valve incorporating redundant safety shut-off valve, manual shut-off , and gas regulator which regulates gas pressure to burner supply manifold. • Direct Spark ignition control design certified by a Recognized National Testing Laboratory and incorporating a LED diagnostic light and alarm capable contact The completed heater assembly shall be factory fire tested prior to shipment. Figure 2 - Detail of Gas Heat Burner Assembly AUXILIARY GAS HEATOPTIMIZING SOLUTIONS THROUGH SUPERIOR DEHUMIDIFICATION TECHNOLOGY N120 W18485 Friestadt Road, Germantown, WI 53022 sales@desert-aire.com Submittal 33279 u64699 [20231024] [13.37].pdf SMART INTEGRATION OF EXHAUST AIR CHLORAMINE SENSORExhaust Air Integration - Duct Mount Desert Aire’s SelectAire Plus™ natatorium dehumidifier can vary the volume of outside air and exhaust air based on the level of contaminants within the pool room. The key to this integration is the use of a Volatile Organic Compounds (VOC) sensing element that can detect when interior levels of chemicals are present such as chloramines. This provides a similar methodology as the use of CO2 sensors in general ventilation applications for the pool environment. Now there is the ability to optimize the volume of exhaust air required with the energy cost of doing so and insure a suitable pool environment for the occupants. The VOC duct sensor samples duct air using an aspiration tube. Moving air from the duct enters the tube, is forced into the enclosure and exits through the other half of the tube. As long as there is air movement in the duct, air is continuously exchanged. Sensor Specifications Power: 15 to 35 VDC @ 50 mA Power Sensing Element: VOCs: Micro-machined Metal Oxide Quick Response Sensor through Aspiration Tube Analog Outputs: 0 to 10VDC, (>10KΩ impedance) VOC Contaminants: 0 to 2,000 PPM CO2 Equivalent VOC Detection Range: 0 to 100% Response Time: Less Than 60 Seconds Start-Up Time: 15 minutes Operating Environment: 32 to 122°F (0 to 50°C) 0 to 95%RH non-condensing Dimension: 4.91”H x 3.21”W x 1.20”D (124.6 x 81.5 x 30.5 mm) Enclosure Rating: NEMA 4 Enclosure Material: Polycarbonate, UL94 V-O VOC Duct Sensor Certifications: RoHS Warranty Period: Two years from manufacture date Figure 1 - Duct Mounted VOC Sensor Figure 2 - Duct Sensor Dimensions 4.11” Providing Peace of Mind to Your Pool Room Submittal 33279 u64699 [20231024] [13.37].pdf SMART INTEGRATION OF EXHAUST AIR CHLORAMINE SENSORExhaust Air Integration - Wall Mount Desert Aire’s SelectAire Plus™ natatorium dehumidifier can vary the volume of outside air and exhaust air based on the level of contaminants within the pool room. The key to this integration is the use of a Volatile Organic Compounds (VOC) sensing element that can detect when interior levels of chemicals are present such as chloramines. This provides a similar methodology as the use of CO2 sensors in general ventilation applications for the pool environment. Now there is the ability to optimize the volume of exhaust air required with the energy cost of doing so and insure a suitable pool environment for the occupants. Sensor Specifications Power: 15 to 35 VDC @ 50 mA Power Sensing Element: VOCs: Micro-machined Metal Oxide Analog Outputs: 0 to 10VDC, (>10KΩ impedance) VOC Contaminants: 0 to 2,000 PPM CO2 Equivalent VOC Detection Range: 0 to 100% Response Time: Less Than 2 Minutes Start-Up Time: 15 minutes Operating Environment: 32 to 122°F (0 to 50°C) 0 to 95%RH non-condensing Dimension: 4.50”H x 2.86”W x 1.06”D (114.3 x 72.7 x 26.9 mm) Enclosure Material: ABS Plastic, UL94 V-O Certifications: RoHS Warranty Period: Two years from manufacture date Figure 1 - Wall Mounted VOC Sensor Figure 2 - Wall Sensor Dimensions 435-s 2018/02 2.86”(72.7mm) 1.06”(26.9mm) 4.50”(114.3mm) ClosedCell Foam OPTIMIZING SOLUTIONS THROUGH SUPERIOR DEHUMIDIFICATION TECHNOLOGY N120 W18485 Friestadt Road, Germantown, WI 53022 sales@desert-aire.com Submittal 33279 u64699 [20231024] [13.37].pdf Advanced SelectAire Plus™ Microprocessor Controller D ESCRIPTION ADVANCED COMMUNICATIONS CAPABILITIES EASY INSTALLATION AND OPERATION CONTINUOUS MONITORING F EATURES O RDERING CODE CM3560 Series Controller for SP Dehumidifiers All trademarks hereby referenced are the property of their respective owners. CM3560 Controller Used on SP Series Dehumidifiers CM3560 Series Optional Remote Display Terminal (RDT) Wall Mount Temperature & Humidity Sensor Integral Return Temperature & Humidity Sensor Accessories CA3560-WALL - Optional Wall Mount Sensor CA3560-OD - Optional Remote Display Terminal •Standard integral return air sensor for control •Optional wall mounted sensor •LCD interface terminal in control panel •Optional remote display terminal (RDT) •Built-in cloud based remote monitoring The CM3560 controllers are uniquely programmed for each Desert Aire application providing energy efficient moisture removal and precise temper- ature & humidity control. The CM3560 controller offers an easy interface with building management systems (BMS) with on-board or pre-configured gateway modules. Modbus RTU and TCP/IP are standard. BACnet®MS/TP and BACnet®Ethernet are onboard and can be activated with optional licences. A LonTalk gateway is available that can connect a LonWorks system to the controls. A user interface to the CM3560 is supplied on each unit. This backlit LCD display provides easy to navigate screens for setpoint adjustment and unit monitoring. The optional remote display terminal can be connected to the controller and mounted at a more convenient location for user interface. S YSTEM DISPLAY OPTIONS The CM3560 controller is matched to SelectAire Plus™ Series systems based on the number of inputs and outputs; and by taking into account the accessibility of the controller and its user interface. Submittal 33279 u64699 [20231024] [13.37].pdf The SelectAire Plus™ Series uses the CM3560 controller with an integrated local display. The controller with local display is installed in the system electrical enclosure. All Inputs and Outputs along with alarm history can be viewed from the user interface to aid in unit or system diagnostics. When an integrated display and remote display terminal are connected to a controller, both display devices are fully functional. B MS COMMUNICATION LonWorks®- Echelon’s LonWorks®is a solution of control in industry, offices, homes and transport. The electric standard supported is FTT10. The SP dehumidifiers need to be configured with a gateway at the time of order for LonWorks®communication. Modbus®- One of the most widely used protocols. The system supports Modbus Slave, RTU mode; communications standard RS485 without licenses or activation. Additionally supports Modbus TCP/IP as standard. BACnet®MS/TP and BACnet®Ethernet- Based on EIA-485 and Ethernet standards. Ports are available for both BACnet MSTP and Ethernet as standard equipment, but licenses are required to be purchased at the time of order. Connection is possible through the following networks: •SNMP v1, v2, v3 networks •BACnet®, Ethernet, BACnet®/IP networks, BACnet®MS/TP •LAN or Internet B MS COMMUNICATION - DETAILS BACnet®MS/TP If the system was purchased with the BACnet MS/TP option, the BACnet Device Instance and Station Address will need to be set before connection to the control network. This is because the Station Address is set to 0 as a default, and will conflict with any device on the control network already set to 0. Defining the station address prior to system shipment will allow Desert Aire to correctly set the address. If the value is not known prior to shipment, then the contractor must alter these default settings during system commissioning. A software utility program will need to be used, allowing access to these settings. For more information, refer to the controller manual shipped with the dehu- midifier. Download the system BACnet Point List from the Desert Aire website (www.desert-aire.com). BACnet®Ethernet If the system was purchased with the BACnet®Ethernet option, the licenses have been activated in the controller and the Ethernet port 342 2019/05 CM3560 Controller for SP Dehumidifiers (cont.) can be used for connection to the BACnet network immediately.For the correct operation of the Ethernet network, a number of basic parameters need to be set, such as the IP address and Netmask. Each device connected to an Ethernet network must have a unique IP address. The Ethernet port on the controller is set for DHCP. Therefore, in a network served by a DHCP server, the controller will automatically acquire the necessary parameters without requiring configuration. In the case of a network without DHCP, these parameters need to be configured manually. For more information, refer to the controller manual shipped with the dehumidifier. Download the SYSTEM BACnet Ethernet Point List from the Desert Aire website (www.desert-aire.com). LonWorks® If the system was purchased with the LonWorks option, the unit will contain a gateway that allows for communication to the LonWorks network. Documentation, including points list and connection information will be included with the dehumidifier. Modbus® If the Modbus network is to be used, the network address needs to be set in the controller for proper communication operation. If Modbus®RTU is used, a baud rate must also be specified. Refer to the system controller manual for address and baud rate setting instructions. For more information, refer to the controller manual shipped with the dehumidifier. Download the Modbus® Point List from the Desert Aire website (www.desert-aire.com). AireGuard™ Remote Monitoring Tool The SP Series controller is equipped with an Ethernet connection to the internet. The owner must provide the Ethernet cable connection from their network router to the controller in order for data to transmit to a secure cloud storage location. A 2-year AireGuard™ subscription is included with systems shipped with this controller. For those users with more than one dehumidifier, this configuration can act as their local building management system where all of the units are available with the same login credentials. All that is required is an Ethernet cable to be connected between your network router with internet access and the AireGuard™interface located on the controller. The connection communicates without opening additional ports in the systems firewall or requiring a virtual private network. Please refer to the AireGuard™ brochure for additional details. OPTIMIZING SOLUTIONS THROUGH SUPERIOR DEHUMIDIFICATION TECHNOLOGY N120 W18485 Friestadt Road, Germantown, WI 53022 sales@desert-aire.com Submittal 33279 u64699 [20231024] [13.34].pdf SelectAire Plus™ Dehumidifiers Sequence of Operation (SP) 202111 SEQUENCE OF OPERATION Supply Blower Runs Continuously. CIRCUIT HEAT SINK CONFIGURATION: Compressor Starts On a Call for dehumidification and or cooling. The system has two configurable circuits as follows: Circuit “A” Priority: Packaged Condenser Circuit “B” Priority: Packaged Condenser Dehumidification First Stage: Circuit “A” starts and runs in respective order listed in the “Circuit Heat Sink Configuration Section”. Second Stage: Circuit “B” starts and runs in respective order listed in the “Circuit Heat Sink Configuration Section”. Cooling First Stage: The exhaust damper before the evaporator coils opens. Circuit “A” will start and operate with the air reheat off reject its heat to following condenser(s), in respective order, listed in the “Circuit Heat Sink Configuration Section”. Second Stage: Circuit “B” will start and operate with the air reheat off reject its heat to following condenser(s), in respective order, listed in the “Circuit Heat Sink Configuration Section”. Air Heating Occupied Times: First Stage: The cold air exhaust damper (damper after evaporator) will open to maximize heating capacity. Circuit “A” will start and operate in the air reheat mode. Second Stage: The auxiliary heater is activated by a 0-10 VDC control signal from the dehumidifier. Unoccupied Times: First Stage: The auxiliary heater is controlled by a 0-10VDC control signal from the dehumidifier. Submittal 33279 u64699 [20231024] [13.34].pdf SelectAire Plus™ Dehumidifiers Sequence of Operation (SP) 202111 Pool Water Heating Circuit A An auxiliary pool/spa heater dry contactor will be closed, to activate the pool heater by others. Circuit B An auxiliary pool/spa heater dry contactor will be closed, to activate the pool heater by others. Exhaust and Outside Air The operation of the SelectAire Plus™ system’s exhaust fan is to maintain the negative pressure of the poolroom by controlling the exhaust fan motor speed using inputs from the differential pressure transducer input signal. The dehumidifier controls the flow rate of the outdoor air in each mode by measuring the pressure differential across the calibration plate in the intake section to vary the outside air damper. This provides a direct measure of outdoor air volume. The system provides five individual settings for outdoor air flow rates that are field programmable:  Unoccupied – Controlled via time clock  Occupied – Controlled via time clock  Event – Controlled via time clock  Max OA – Controlled via VOC sensor set point  Purge – Controlled via contact closure EMERGENCY SYSTEM SHUTDOWN Terminal points are available for a binary contact closure by others to control unit shutdown by smoke detector or other similar device. An open contact in the 24 VAC circuit will deactivate motors, fans and compressors. Submittal 33279 u64699 [20231024] [13.34].pdf SelectAire Plus™ Dehumidifiers Dehumidifier Specifications (SP) 202310 DEHUMIDIFIER SPECIFICATIONS Standard Unit Features Enclosure:  2” double wall panel with injected polyurethane foam rated at R13.5  Cabinet material o Exterior panels shall be galvannealed steel with powder coating or G90 galvanized with architectural paint treatment o Base rails and supports shall be 12-gauge G90 galvanized steel channels  Hinged access doors shall allow easy access to internal components within each section o Doors shall be mounted with adjustable compression cam operated latches. o Double sealing bypass gaskets on frame and door  The electrical control box and switch panel is enclosed in a separate compartment, complete with a hinged door Exterior Paint and Finish:  Powder coat technique  High yield polyester paint  Meets 1,000 hour salt spray test  Beige color Refrigerant: R-410A Compressors:  Heavy-duty scroll-type  Equipped with high- and low- pressure safety devices  Externally vibration isolated Receiver:  Sized for full-system refrigerant capacity up to 50’ line set  Service ball valves included Evaporator Dehumidifier Coils:  Aluminum fins  Copper tubes, hydraulically expanded  One circuited with a wrap-around heat pipe for optimized moisture removal Internal Air-Cooled Condenser (Reheat Coil):  Aluminum fins  Copper tubes, hydraulically expanded  Coil is positioned with a minimum of 5” clearance from the DX coil to help prevent water re-evaporation Submittal 33279 u64699 [20231024] [13.34].pdf SelectAire Plus™ Dehumidifiers Dehumidifier Specifications (SP) 202310 Ventilation and Exhaust Air: SelectAire Plus™ with Auto Balancing Control: The unit will include the SelectAire Plus™ Energy Recovery Ventilation Air and Exhaust Assembly with up to 50% of the supply air volume for ventilation air. Exact amount of ventilation and exhaust air is as listed on the specification schedule. The integral control system will maintain the correct proportions of return air, supply air, exhaust air and ventilation air. The system will monitor the static pressure difference at three locations; the ventilation air intake, evaporator coil and the zone vs ambient. By monitoring the pressure differential across the ventilation air orifice plate, the unit controller will modulate the ventilation air damper to ensure the correct amount of ventilation air during occupied times. The amount of ventilation air can be set through the unit controller. The system will monitor the pressure differential across the evaporator coil and will modulate the evaporator by-pass damper to ensure the proper amount of evaporator cfm; therefore, optimizing the moisture removal capacity of the system at all times. The system will monitor the pressure difference between the zone pressure and the ambient pressure once the initial field air balance has been completed and setup values entered into the controller. This will vary the exhaust fan volume via the fan motor speed to help guarantee the negative pressure within the space. The exhaust fan includes a velocity pressure measurement transducer that allows direct readout of the current exhaust fan flow rate and an adjustable maximum flow rate for each occupancy mode. SelectAire Plus™ Recovery System: The unit will be supplied with an integral fresh air/exhaust air heat recovery system for introduction of outside air, to comply with ASHRAE Ventilation Standards 62.1 and local health codes. The exhaust air can be exhausted either before or after the evaporator coil, providing the ability to extract energy from the return air if heating is required. The control decision will be determined by the controls heating and cooling set points. On a call for heating, it is desirable to extract as much heat as possible from the exhaust air. Energy is recovered from the exhaust air by first passing it through the circuit “A” evaporator coil in a cooling / heat pump operation. The cooled air is exhausted and the “Heat Pipe” energy plus the heat of rejection is returned to the air stream. The minimum COP of this operation is 4.0. On a call for cooling, warm return air from the space is exhausted before the evaporator coil when it is desirable to remove as much heat as possible from the building. The refrigeration system serves to dehumidify and/or air condition the return air from the space. Submittal 33279 u64699 [20231024] [13.34].pdf SelectAire Plus™ Dehumidifiers Dehumidifier Specifications (SP) 202310 Exhaust will be provided with plenum fan(s) and motor(s) in direct drive arrangement on a frame independent of the unit base, properly sized for all exhaust modes listed in the unit schedule. The ventilation air is brought in through the integral plenum and mixed with the bypass airstream. The air shall be filtered by 4” extended surface type filters with a minimum MERV 8 rating. A motorized, proportional control damper assembly shall be used. The warm exhaust, cold exhaust, and ventilation air dampers each will be a motorized, proportional control type. In addition, a motorized, proportional damper assembly will be included to bypass the evaporator coils to ensure proper face velocity and system efficiency in all occupancy modes of operation. The controller will automatically adjust these dampers to maintain the specified flow rates (R/A, O/A and E/A) through the use of integral flow measurement devices. The SelectAire Plus™ heat recovery system will use the “heat pump” principle to recover energy on a call for heating by operating one of the dual refrigeration circuits in conjunction with exhaust air. The unit shall be supplied with an outdoor rain hood and bird screen. Electrical Control Panel:  Easily accessible on one side  Single point power connection to serve controls, fans, electric auxiliary heater (if provided)  Rated in compliance with NEC® 110.10 and UL 1995 Control System:  A digital control system using a 16 bit microprocessor  Three (3) levels of password protection  Easy-to-read display which indicates actual operating and set points  The display will be remote mountable up to 1,640 feet from the unit  Built-in occupancy timer Temperature Sensor:  The unit includes a temperature sensor to be field installed on the wall Relative Humidity Sensor: The unit includes a relative humidity sensor to be field installed on the wall Airflow Switch:  The dehumidifier is equipped with an airflow switch to prevent the compressors from starting or operating on loss of airflow. Refrigerant Pressure Transducers: Submittal 33279 u64699 [20231024] [13.34].pdf SelectAire Plus™ Dehumidifiers Dehumidifier Specifications (SP) 202310  The dehumidifier shall have internal transducers for monitoring refrigerant pressures Condensate Drain Pan:  20-gauge stainless steel, sloped, and positioned under the dehumidifier coil  Fitted with a minimum 1” MPT non-corrosive plastic drain connection Dampers and Damper Actuators: Dampers controlling outdoor air or separating the exhaust air from recirculating air to be low leakage thermally insulated galvanized airfoil blade dampers blades and frame. Control dampers for bypass air will be galvanized airfoil blades and frame. Linkage to consist of plated steel and axle with synthetic bearings. All damper actuators will be proportional control connected to unit microprocessor and positions adjusted automatically based on sequence of operation. All fasteners, brackets and shaft clamps will be plated steel. Supply Fan: Supply fan will either be a plenum fan array with direct drive EC motors or a single plenum airfoil fan with VFD controlled motor.  All bearings are selected for a minimum of a L50 Lifetime of 100,000 hours  All fans shall be dynamically and statically balanced  Blower Discharge: The unit’s air discharge will be as shown on the drawing VFD Option: The fan housing shall be made of galvanized steel. The high performance impeller is manufactured in corrosion resistant steel, with backward curved, true airfoil shaped blades, welded into position. All wheels are coated with an anticorrosive primer and a final layer of synthetic paint. The driver pulley and the blower pulley will be made of cast iron. The motor sheave will be a variable pitch type to allow for field adjustment of CFM and external static. VFD controller located out of air stream to control motor's speed. Exhaust Fan: Exhaust fan will either be a plenum fan array with direct drive EC motors or a single plenum airfoil fan with VFD controlled motor. VFD Option: The fan housing shall be made of galvanized steel. The high performance impeller is manufactured in corrosion resistant steel, with backward curved, true airfoil shaped blades, welded into position. All wheels are coated with an anticorrosive primer and a final layer of synthetic paint. The driver pulley and the blower pulley will be made of cast iron. The motor sheave will be a variable pitch type to allow for field adjustment of CFM and external static. VFD controller located out of air stream to control motor's speed. Return Air Filters:  Return air will have a 4”, pleated MERV 8 disposable filters  Optional Return air filters are washable aluminum  Outside air, when supplied with the Full OSA Assembly, will have a 2”, extended surface MERV 7 filters Submittal 33279 u64699 [20231024] [13.34].pdf SelectAire Plus™ Dehumidifiers Dehumidifier Specifications (SP) 202310 Approvals/Listings:  The unit is labeled and listed by ETL or UL Selected Unit Options Unit Location:  The unit shall be designed for outdoor (concrete slab or equipment rail) installation Disconnect: Not Selected Selected Refrigeration Options ElectroFin® E-Coating:  All airside coils protected with ElectroFin® E-Coat. The Electro-deposition process applies a dry film thickness 0.6 to 1.2 mils which meets 6,000 hour salt spray test Packaged Condenser: The dehumidifier shall be equipped with an integral, full-size, air-cooled condenser to reject excess heat to the outside. The system shall be able to reject all the recovered heat (T.H.R.) outdoors. • Aluminum fins • Copper tubes, hydraulically expanded • Axial condenser fans shall be of one-piece construction with an integral motor • Fan Cycling: Fans shall be cycled based on internal head pressure • Fan Guards: Guards shall be heavy-gauge, close-meshed steel wire with vinyl coating • E-Fin Coating installed Auxiliary Heater Options Electric Heater: The capacity shall be in accordance with the schedule. The heater shall be integral to the unit and wired to the unit as a single point power connection. The heater coils shall be constructed of High Grade Nickel-Chrome alloy and will be insulated by floating ceramic bushings from the galvanized steel frame. Control System Options BMS Compatibility: The unit’s controller will have the following BMS compatibility: BACnet MS/TP Other Options Submittal 33279 u64699 [20231024] [13.34].pdf SelectAire Plus™ Dehumidifiers System Warranty (SP) 202111 SYSTEM WARRANTY Dehumidification Equipment Standard Limited Warranty Desert Aire warrants the dehumidifying unit to be free from defects in materials and workmanship subject to the terms, conditions and limitations stated herein. TERMS Desert Aire warrants all components (except as noted) for a period of two (2) years from the date of shipment. This warranty shall be limited to the supply of new or rebuilt parts for the part which has failed because of defects in workmanship or material, and does not include the cost for labor, transportation or other costs not herein provided for. Replaced parts are warranted only for the remaining portion of the original warranty period. CONDITIONS The warranty is subject to the following conditions: 1. The unit must be properly installed and maintained in accordance with the Desert Aire “Installation and Operation Manual” provided with each unit and/or other documentation provided. 2. The Start-Up Report must be completed and returned to Desert Aire within 30 days of the start-up. 3. This warranty shall not apply to any part that has been tampered with, or has been subject to misuse, negligence or accident. A warranty can be obtained for altered equipment but only with written consent from Desert Aire. 4. The following parts and components are excluded from the warranty: belts, filters, driers, fuses and refrigerant. 5. Refrigerant coils or other components that corrode due to improperly balanced pool chemistry or corrosive air quality will not be warranted. 6. All replacements or repairs will be FOB Germantown, WI. 7. This warranty shall be null and void if defects or damages result from unauthorized opening of the refrigerant circuit, tampering with factory set controls, or operating outside the original design conditions. 8. Desert Aire shall not be liable for labor costs incurred in diagnosing the problem, or the removal or replacement of the part or parts being repaired. 9. Desert Aire must preauthorize all warranty coverage described herein. Submittal 33279 u64699 [20231024] [13.34].pdf SelectAire Plus™ Dehumidifiers System Warranty (SP) 202111 Extended Warranty: Your Desert Aire unit may have extended warrantees beyond this Standard Limited Warranty document. Extended warrantees are only available at the time of the purchase of the original equipment. These extended warrantees are covered under a separate document and their terms and conditions are separate from this document. It is mentioned in this document for informational purposes only. Any and all incidental or consequential damages are expressly excluded from this warranty. Some states do not allow the exclusion of incidental or consequential damages for personal injury, so the above limitations may not apply to you for certain damages. This warranty gives you specific legal rights, and you may also have other rights, which vary from state to state. No person or representative is authorized to make any warranty or assume any liability not strictly in accordance with the aforementioned. Inquiries regarding warranty matters should be addressed to: Desert Aire LLC c/o Service Manager N120 W18485 Freistadt Road Germantown, WI 53022 PH: (262) 946-7400 FAX: (262) 946-7401 E-MAIL: service@desert-aire.com Submittal 33279 u64699 [20231024] [13.34].pdf SelectAire Plus™ Dehumidifiers System Warranty (SP) 202111 Dehumidification Components Optional Extended Warranty Desert Aire warrants the following components to be free from defects in materials and workmanship subject to the terms, conditions and limitations stated on the standard warranty form. (Provided if Displayed) COMPRESSOR THREE (3)-YEAR EXTENDED WARRANTY TERMS For an additional fee (contact your local representative for cost), Desert Aire offers an extended three (3)-year warranty for compressors. This extended warranty begins after the system's standard two (2)-year warranty ends. This warranty will be limited to the supply of new or rebuilt parts for the part which has failed because of defects in workmanship or material, and does not include the cost for labor, transportation or other costs not herein provided for. Replaced parts are warranted only for the remaining portion of the original warranty period. COIL THREE (3)-YEAR EXTENDED WARRANTY TERMS For an additional fee (contact your local representative for cost), Desert Aire offers an extended three (3)-year warranty for coils. Upon special request, the coils will be coated with an Electro Fin® E-Coating. This extended warranty is only available for coated coils and begins after the system's standard two (2)-year warranty ends. This warranty will be limited to the supply of new or rebuilt parts for the part which has failed because of defects in workmanship or material, and does not include the cost of labor, transportation or other costs not herein provided for. Replaced parts are warranted only for the remaining portion of the original warranty period. Extended warranties do not apply to remote condenser coils. COIL EIGHT (8)-YEAR EXTENDED WARRANTY TERMS For an additional fee (contact your local representative for cost), Desert Aire offers an extended eight (8)-year warranty for coils. Upon special request, the coils will be coated with an Electro Fin® E-Coating. This extended warranty is only available for coated coils and begins after the system's standard two (2)-year warranty ends. This warranty will be limited to the supply of new or rebuilt parts for the part which has failed because of defects in workmanship or material, and does not include the cost for labor, transportation or other costs not herein provided for. Replaced parts are warranted only for the remaining portion of the original warranty period. Extended warranties do not apply to remote condenser coils. Submittal 33279 u64699 [20231024] [13.34].pdf 454 5/16"(OVERALL LENGTH) 421 5/16"(BASE LENGTH) INTAKE AIRFLOWm LEFT SIDE VIEW OUTDOOR AIR INTAKE HOOD 132 13/16"(OVERALL WIDTH) 94 3/16"(BASE WIDTH) 28 13/16" 118 3/8"(OVERALL HEIGHT) EXHAUST AIR HOOD BACK VIEW GENERAL NOTES FOR APPLICABLE SHEETS: LEFT HAND ACCESS SHOWN IN ALL VIEWS RIGHT HAND ACCESS OPTIONS LOCATED WITH SAME DIMENSIONS ON OPPOSITE SIDE UNLESS OTHERWISE SPECIFIED WEIGHTS SHOWN REFLECT FULLY OPTIONED ESTIMATED UNIT WEIGHT UNIT SIZE ESTIMATED WEIGHT (lbs.) 60 - 80 TONS 18500 N120 W18485 FREISTADT RDGERMANTOWN, WI 53022Tel: (262) 946-7400Fax: (262) 946-7401 Drawing Number G1000-011 Page Title DescriptionSP 60-80 TON PKG ELECT HEAT GENERAL ARRANGEMENT Tolerance Unless Otherwise Specifed X.X .125 X.XX .060 X.XXX .030 Angles 1 Date ReleasedDrawn Scale Sheet Rev. 1/19/2018ASV 5NTS All Dimensions in Inches All Angles 90 All outside corners 0.125" fillet Unless Otherwise Specified Third Angle Projection G1000-011 Part weight Desert Aire has a policy of continuous product and quality improvement. Specifications and dimensions are subject to change without notice. This drawing and information contained herein are the exclusive property of the Desert Aire Corporation. Any use detrimental to the interests of Desert Aire is prohibited. ALL DIMENSIONS ARE IN INCHES TOLERANCE 1/8" 1/8 Submittal 33279 u64699 [20231024] [13.34].pdf 110" 50" 26" INTAKE AIRFLOWm SIDE CONDENSATE LOCATION OPTION LEFT SIDE CONNECTION VIEW (LEFT HAND ACCESS SHOWN) FILTERACCESS CIRCUIT AEVAPCOILACCESS CIRCUIT BEVAPCOILACCESS REHEATCOILACCESS SUPPLY FANACCESS EXHAUST FANACCESS SIDE ELECTRICAL CONNECTION LOCATION OPTION (NO ORIENTATION CHANGE FOR RH OR LH ACCESS) ELECTRIC HEATCONTROLPANEL 17" 10" 70" BACK CONNECTIONS VIEW (NO ORIENTATION CHANGE FOR RH OR LH ACCESS) BACK POOL WATER CONNECTION LOCATION OPTION (NO ORIENTATION CHANGE FOR RH OR LH ACCESS) HIGH VOLTAGE LOWVOLTAGE REFRIG WALK-IN ACCESS 32 13/16" 7 3/8" 108" 21" 35" 25" 20" BOTTOM CUSTOMER CONNECTIONS (LEFT HAND ACCESS SHOWN) (VIEWED FROM ABOVE) BOTTOM ELECTRICAL LOCATION OPTION (NO ORIENTATION CHANGE FOR RH OR LH ACCESS) BOTTOM POOL WATER CONNECTION LOCATION OPTION (NO ORIENTATION CHANGE FOR RH OR LH ACCESS) BOTTOM CONDENSATE LOCATION OPTION NOTES: REFER TO SHEET 1 FOR GENERAL NOTES LEFT HAND ACCESS SHOWN IN ALL VIEWS RIGHT HAND ACCESS OPTIONS LOCATED WITH SAME DIMENSIONS ON OPPOSITE SIDE UNLESS OTHERWISE SPECIFIED FILTER INFORMATION UNIT SIZE OA QTY OA SIZE REPLACEMENT PART NUMBER RA QTY RA SIZE REPLACEMENT PART NUMBER 60-80 TONS 15 18 X 24 X 4 870-056 15 18 X 24 X 4 870-056 CUSTOMER CONNECTION LINE SIZE (in.) UNIT SIZE 60 TONS 70-80 TONS CONDENSATE (PVC)1 1/2 1 1/2 POOL WATER LINE CIRCUIT A (CPVC)2 3 POOL WATER LINE CIRCUIT B (CPVC)3 3 N120 W18485 FREISTADT RDGERMANTOWN, WI 53022Tel: (262) 946-7400Fax: (262) 946-7401 Drawing Number G1000-011 Page Title DescriptionSP 60-80 TON PKG ELECT HEAT CUSTOMER INTERFACE GA Tolerance Unless Otherwise Specifed X.X .125 X.XX .060 X.XXX .030 Angles 1 Date ReleasedDrawn Scale Sheet Rev. 1/19/2018ASV 5NTS All Dimensions in Inches All Angles 90 All outside corners 0.125" fillet Unless Otherwise Specified Third Angle Projection G1000-011 Part weight Desert Aire has a policy of continuous product and quality improvement. Specifications and dimensions are subject to change without notice. This drawing and information contained herein are the exclusive property of the Desert Aire Corporation. Any use detrimental to the interests of Desert Aire is prohibited. ALL DIMENSIONS ARE IN INCHES TOLERANCE 1/8" 2/8 Submittal 33279 u64699 [20231024] [13.34].pdf 39 5/16" 4 15/16" 15 5/16" 49 15/16" 244 11/16" 36" 15 1/4" 31" INTAKE SIDE RETURN AIR EXHAUST AIR 84" 5 3/16" 5 3/16" 35 13/16" INTAKE BOTTOM RETURN AIR 75 15/16" 9 3/16" 6 3/16" 23 1/4" 50" 16 3/16" 8 7/8" 76 1/2" OUTSIDE AIR INTAKE HORIZONTAL RETURN AIR HORIZONTAL RETURN AIR OPTION (INTAKE VIEW) SIDE RETURN AIR OPTION (SIDE VIEW) BOTTOM RETURN AIR OPTION (VIEW FROM ABOVE) NOTES: REFER TO SHEET 1 FOR GENERAL NOTES HOODS REMOVED FOR CLARITY ACCESS SIDE RETURN AIR OPTION WILL SHIFT FILTER SECTION DOORS TO NON-ACCESS SIDE OUTSIDE AIR INTAKE LOCATED IN THE SAME POSITION REGARDLESS OF OPTIONS N120 W18485 FREISTADT RDGERMANTOWN, WI 53022Tel: (262) 946-7400Fax: (262) 946-7401 Drawing Number G1000-011 Page Title DescriptionSP 60-80 TON PKG ELECT HEAT INTAKE OPTIONS GA Tolerance Unless Otherwise Specifed X.X .125 X.XX .060 X.XXX .030 Angles 1 Date ReleasedDrawn Scale Sheet Rev. 1/19/2018ASV 5NTS All Dimensions in Inches All Angles 90 All outside corners 0.125" fillet Unless Otherwise Specified Third Angle Projection G1000-011 Part weight Desert Aire has a policy of continuous product and quality improvement. Specifications and dimensions are subject to change without notice. This drawing and information contained herein are the exclusive property of the Desert Aire Corporation. Any use detrimental to the interests of Desert Aire is prohibited. ALL DIMENSIONS ARE IN INCHES TOLERANCE 1/8" 3/8 Submittal 33279 u64699 [20231024] [13.34].pdf 5 3/16" 283 5/16" 24" 84" INTAKE BOTTOM SUPPLY AIR NOTES: REFER TO SHEET 1 FOR GENERAL NOTES LEFT HAND ACCESS SHOWN IN ALL VIEWS UNLESS OTHERWISE SPECIFIED RIGHT HAND ACCESS OPTIONS LOCATED WITH SAME DIMENSIONS ON OPPOSITE SIDE UNLESS OTHERWISE SPECIFIED HOODS REMOVED FOR CLARITY BOTTOM SUPPLY OPTION (VIEW FROM ABOVE) (NO ORIENTATION CHANGE FOR RH OR LH ACCESS) N120 W18485 FREISTADT RDGERMANTOWN, WI 53022Tel: (262) 946-7400Fax: (262) 946-7401 Drawing Number G1000-011 Page Title DescriptionSP 60-80 TON PKG ELECT HEAT DISCHARGE OPTIONS GA Tolerance Unless Otherwise Specifed X.X .125 X.XX .060 X.XXX .030 Angles 1 Date ReleasedDrawn Scale Sheet Rev. 1/19/2018ASV 5NTS All Dimensions in Inches All Angles 90 All outside corners 0.125" fillet Unless Otherwise Specified Third Angle Projection G1000-011 Part weight Desert Aire has a policy of continuous product and quality improvement. Specifications and dimensions are subject to change without notice. This drawing and information contained herein are the exclusive property of the Desert Aire Corporation. Any use detrimental to the interests of Desert Aire is prohibited. ALL DIMENSIONS ARE IN INCHES TOLERANCE 1/8" 4/8 Submittal 33279 u64699 [20231024] [13.34].pdf 36" MIN 60" 48" 70" 48" MIN 230" 36" 60" 60" 1 2 2 1 96" RECOMMENDED FOR FILTER ACCESS. 120" CLEARANCE ON ACCESS SIDE RECOMMENDED FOR FAN AND COIL SERVICE NOTES: REFER TO SHEET 1 FOR GENERAL NOTES LEFT HAND ACCESS SHOWN IN ALL VIEWS RIGHT HAND ACCESS OPTIONS LOCATED WITH SAME DIMENSIONS ON OPPOSITE SIDE UNLESS OTHERWISE SPECIFIED N120 W18485 FREISTADT RDGERMANTOWN, WI 53022Tel: (262) 946-7400Fax: (262) 946-7401 Drawing Number G1000-011 Page Title DescriptionSP 60-80 TON PKG ELECT HEAT UNIT CLEARANCE GA Tolerance Unless Otherwise Specifed X.X .125 X.XX .060 X.XXX .030 Angles 1 Date ReleasedDrawn Scale Sheet Rev. 1/19/2018ASV 5NTS All Dimensions in Inches All Angles 90 All outside corners 0.125" fillet Unless Otherwise Specified Third Angle Projection G1000-011 Part weight Desert Aire has a policy of continuous product and quality improvement. Specifications and dimensions are subject to change without notice. This drawing and information contained herein are the exclusive property of the Desert Aire Corporation. Any use detrimental to the interests of Desert Aire is prohibited. ALL DIMENSIONS ARE IN INCHES TOLERANCE 1/8" 5/8 Submittal 33279 u64699 [20231024] [13.34].pdf 307 5/16" 18" or 24" 109" 18" or 24" B B 86 3/16" 36" 3" 83 3/16" 93 3/16" 311 5/16" 280 1/8" 3" 24 3/16" EQUIPMENT SUPPORT 2" 2" 89 3/16" C SECTION B-B 1 1/2" 1 1/2" DETAIL CSCALE 1 : 8 WOOD NAILER NOTES: REFER TO SHEET 1 FOR GENERAL NOTES 14 GA GALVANIZED STEEL CONSTRUCTION1. PRIME PAINTED AFTER FABRICATION2. PRESSURE TREATED WOOD NAILERS3. 1-1/2" THICK 3LB/FT^3 FIBERGLASS PERIMETER INSULATION4. INTERNAL ANGLE REINFORCEMENT5. CURB TO BE SHIPPED KNOCKED DOWN6. NUMBER AND LOCATION OF CROSS SUPPORTS IS DEPENDANT UPON THE GUAGE OF MATERIAL USED TO CONSTRUCT THE CURB, DUCT SUPPORT CONFIGURATION LENGTH OF CURB, AND WIDTH OF CURB. INSTALLATION INSTRUCTIONS INCLUDED WITH CURB SHIPMENT INDICATE THE REQUIRED POSITION FOR FIELD ASSEMBLED CURBS. UNIT TON 18" CURB 24" CURB 60-80 CB-80PEBN-18 CB-80PEBN-24 N120 W18485 FREISTADT RDGERMANTOWN, WI 53022Tel: (262) 946-7400Fax: (262) 946-7401 Drawing Number G1000-011 Page Title DescriptionSP 60-80 TON PKG ELECT HEAT CURB DETAIL GA Tolerance Unless Otherwise Specifed X.X .125 X.XX .060 X.XXX .030 Angles 1 Date ReleasedDrawn Scale Sheet Rev. 1/19/2018ASV 5NTS All Dimensions in Inches All Angles 90 All outside corners 0.125" fillet Unless Otherwise Specified Third Angle Projection G1000-011 Part weight Desert Aire has a policy of continuous product and quality improvement. Specifications and dimensions are subject to change without notice. This drawing and information contained herein are the exclusive property of the Desert Aire Corporation. Any use detrimental to the interests of Desert Aire is prohibited. ALL DIMENSIONS ARE IN INCHES TOLERANCE 1/8" 6/8 Submittal 33279 u64699 [20231024] [13.34].pdf 3/4" CLOSED CELL FOAM INSULATIONFACTORY INSTALLED 1" CLOSED CELL FOAM INSULATIONFACTORY INSTALLED 2" EXTRUDED FOAM INSULATION WITH FOIL BACKINGFACTORY INSTALLED 1 1/2" FIBERGLASS INSULATIONFACTORY INSTALLEDWHEN FACTORY CURB PROVIDED GASKET MATERIAL SUPPLIED BY FACTORY WHEN FACTORY CURB PROVIDED1 1 ALL EXPOSED METAL TO BE SPRAY FOAM INSULATION AFTER INSTALLATION PRESSURE TREATED WOOD NAILER FACTORY INSTALLED WHEN FACTORY CURB PROVIDED CURB MOUNT PAD MOUNT 1" CLOSED CELL FOAM INSULATIONFACTORY INSTALLEDOUTDOOR UNITS ONLY 3/4" CLOSED CELL FOAM INSULATIONFACTORY INSTALLEDOUTDOOR UNITS ONLY 2" EXTRUDED FOAM INSULATION WITH FOIL BACKINGFACTORY INSTALLED RUBBER ISOLATION PAD BY OTHERS CONCRETE FLOOR/PAD NOTES: REFER TO SHEET 1 FOR GENERAL NOTES SEE SHEET 6 NOTES FOR CURB SPECIFICATIONS N120 W18485 FREISTADT RDGERMANTOWN, WI 53022Tel: (262) 946-7400Fax: (262) 946-7401 Drawing Number G1000-011 Page Title DescriptionSP 60-80 TON PKG ELECT HEAT MOUNTING DETAIILS GA Tolerance Unless Otherwise Specifed X.X .125 X.XX .060 X.XXX .030 Angles 1 Date ReleasedDrawn Scale Sheet Rev. 1/19/2018ASV 5NTS All Dimensions in Inches All Angles 90 All outside corners 0.125" fillet Unless Otherwise Specified Third Angle Projection G1000-011 Part weight Desert Aire has a policy of continuous product and quality improvement. Specifications and dimensions are subject to change without notice. This drawing and information contained herein are the exclusive property of the Desert Aire Corporation. Any use detrimental to the interests of Desert Aire is prohibited. ALL DIMENSIONS ARE IN INCHES TOLERANCE 1/8" 7/8 Submittal 33279 u64699 [20231024] [13.34].pdf 105" 210 5/8" 105" OUTDOOR AIR INTAKE HOOD 1 3/4" 3/4" 3" 3/4" LUG DETAIL NOTES: REFER TO SHEET 1 FOR GENERAL NOTES AND HOOD DETAILS SHIP LOOSE ITEMS EXHAUST HOOD DA PART NO DESCRIPTION QTY HOOD EXHAUST ASSEMBLY 1 807-023 SCREW #8-18X1/2 SS 36 990-105 CAULK WHITE 1 N120 W18485 FREISTADT RDGERMANTOWN, WI 53022Tel: (262) 946-7400Fax: (262) 946-7401 Drawing Number G1000-011 Page Title DescriptionSP 60-80 TON PKG ELECT HEAT SHIPPING/LIFTING DETAILS GA Tolerance Unless Otherwise Specifed X.X .125 X.XX .060 X.XXX .030 Angles 1 Date ReleasedDrawn Scale Sheet Rev. 1/19/2018ASV 5NTS All Dimensions in Inches All Angles 90 All outside corners 0.125" fillet Unless Otherwise Specified Third Angle Projection G1000-011 Part weight Desert Aire has a policy of continuous product and quality improvement. Specifications and dimensions are subject to change without notice. This drawing and information contained herein are the exclusive property of the Desert Aire Corporation. Any use detrimental to the interests of Desert Aire is prohibited. ALL DIMENSIONS ARE IN INCHES TOLERANCE 1/8" 8/8 Submittal 33279 u64699 [20231024] [13.34].pdfSubmittal 33279 u64699 [20231024] [13.34].pdf 2023_09A UNIT TAG DH-1,2 UNIT MANUFACTURE DESERT AIRE MODEL NO SP70LOCATIONOutdoor UNIT WEIGHT 20,500 lbs. FAN DATA SUPPLY AIR FLOW - CFM 35,000TOTAL ESP (in. W.C.)3.50 S/A FAN TSP (in. W.C)6.51 S/A FAN HP Qty 4 | 60OUTSIDE AIR FLOW - CFM (MAX)19,000 EXHAUST AIR FLOW - CFM (MAX)20,000E/A ESP AT MAXIMUM FLOW (in. W.C.)0.00 E/A FAN TSP (in. W.C)3.96 E/A FAN HP Qty 2 | 30 PERFORMANCE EAT DB | WB (°F) | %RH 84.0 | 73.1 | 60 MOISTURE REMOVAL CAPACITY - LB/HR 387.3TOTAL COOLING CAPACITY BTUH 793.8 SENSIBLE COOLING CAPACITY BTUH 385THR BTUH 1,016 COMPRESSOR Circuit A 30 COMPRESSOR Circuit B 35 UNIT ELECTRICAL VOLTAGE 460/3/60 MOPD 400MCA341 SHORT CIRCUIT CURRENT RATING (SCCR)5kA or greater AUXILIARY HEATING TYPE Electric kW 070 HWC FLUID pD #DIV/0!HWC # ROWS #DIV/0! POOL WATER HEAT RECOVERY REMOTE COOLING DATA INTEGRAL PACKAGED CONDENSERAMBIENT TEMPERATURE (°F)105NO. OF FANS 4 HORSEPOWER (EA)4POWER (kW EA)2.8 COIL SECTION LEAVING AIR CONDITIONS* FULL COOLING MODE (°F)74.1 SP Pool Dehumidifier SF-1 & 2 YORK® Solution Endura™ Air Handling Unit Performance Report Project Name:Ocala Aquatics Last Saved: 7/30/2020 4:38:44 PM Unit Folder:SF-1-REV3 Report Version: 2019.4.24.1156 Unit Tag(s): AHU-1 Software Version: 20.1.6385.4217 Page 1 of 5 Job Summary Project Name: Ocala Aquatics Unit Tag(s): SF-1&2 Quantity: 1 Environment: Outdoor Unit Overview Model Cabinet Performance Airflow (CFM) Altitude (ft) Weight (lbs) XTO-69x123 Solution 20,000 10 5,869 Segment Sequence (DP)(FS)(XA FM) Unit Construction Casing Details Segment(s) Thickness (in) Exterior Paint Exterior Gauge and Material Interior Gauge and Material Insulation Thickness and Material Bulkhead Material FM , XA , FS , DP 2 STD Exterior Paint STD Ga. G-90 Galvanized STD Ga. G-90 Galvanized 2" Foam Galvanized Base Details Segment(s) Base Floor Gauge and Material Paint Gauge and Material Paint Insulation Attachment Tread Plate FM, XA, FS, DP Standard Formed Steel None STD Ga. G-90 Galvanized None N/A - Aluminum Diamond Plate Unit Electrical Circuit Details Circuit # Component(s) V/Ph/Hz Full Load Amps (FLA) Minimum Current Ampacity (MCA) Maximum Overcurrent Protection (MOP) 1 Supply Fan Motor Control, Supply Fan Motor Control 460/3/60 36.2 40.7 50.0 Electrical Details Minimum Unit SCCR - ETL Label (UL1995/NEC-2002) Yes Unit Light Type Unit Light Switch - - Supply Fan(s) Performance Details Fan Manufacturer Model Class Size % Wheel Width % Wheel Diameter Quantity Total Airflow (CFM) Altitude (ft) TSP (in w.g) ESP (in w.g) Fan Speed (RPM) Fan Power (BHP) Lau DDPG2 II 222-9 120 100 2 20,000 10 4.02 2.50 1,989 9.64 YORK® Solution Endura™ Air Handling Unit Performance Report Project Name:Ocala Aquatics Last Saved: 7/30/2020 4:38:44 PM Unit Folder:SF-1-REV3 Report Version: 2019.4.24.1156 Unit Tag(s): AHU-1 Software Version: 20.1.6385.4217 Page 2 of 5 Performance Details Fan Manufacturer Model Class Size % Wheel Width % Wheel Diameter Quantity Total Airflow (CFM) Altitude (ft) TSP (in w.g) ESP (in w.g) Fan Speed (RPM) Fan Power (BHP) Drive Type Wheel Type Blade Type Wheel Material Base Material Fan Flow Isolation AirFlow Monitoring Isolation Type Total Eficiency (%) Outlet Velocity (ft/s) Max Speed (RPM) Direct Drive SWSI Airfoil Aluminum Galvanized Steel Back-Draft Counter Balance Yes (K=2649.00) 2" Spring 65.64 671 2,454 Motor Details Type Manufacturer Motor Power (HP) V/Ph/Hz Quantity Insulation Class Motor Speed (RPM) Frame Size Full Load Amps (Amps) Efficiency Location TEFC Baldor 15.0 460/3/60 2 H 1,800 254 18.10 Premium Direct Drive At Motor Synchronous Details TSP (in w.g.) Total Air Flow (CMF) Fan Speed (RPM) Motor Correction Factor(%) Fan Power (BHP) Total Eficiency (%) 4.02 10,000 1,989 92.4 9.64 65.64 Filter(s) Details Segment Type Depth Filter Loading Media/MERV # of Spares Spare Filter Media Frame Material FM Primary Filter 4" Mini- Pleat Side 60-65% Eff, (MERV 11) 1 60-65% Eff, (MERV 11) Galvanized Sizes Filter Gauge Details Segment Filter 1st Filter Size W x H (in) 1st Qty 2nd Filter Size W x H (in) 2nd Qty Location Type Range (in w.g) FM Primary Filter 24x20 16 16x20 4 Door Magnehelic with Flag 0 - 1 Damper(s) Details Segment Air Path H x W (in) Total Face Velocity (ft/min) CFM Minimum Allowable OA CFM Damper Type Damper Config Model Material Blade Orientation Actuator Type Fail Position FM Return Air 26.75 x 105.00 1,025 20,000 - Control 100% CD50 Aluminum Parallel - - YORK® Solution Endura™ Air Handling Unit Performance Report Project Name:Ocala Aquatics Last Saved: 7/30/2020 4:38:44 PM Unit Folder:SF-1-REV3 Report Version: 2019.4.24.1156 Unit Tag(s): AHU-1 Software Version: 20.1.6385.4217 Page 3 of 5 Door(s) Details Segment(s) Location Swing Hinge Location H x W x T (in) View Port Test Port Spare Gasket Thermal Break Safety Latch Noncontact Safety Interlock FM Left Outward Upstream Side 63 x 39 x 2 None - - Yes - - XA Left Outward Downstream Side 63 x 36 x 2 None Yes - Yes - - FS Left Outward Downstream Side 63 x 18 x 2 None - - Yes Yes - FS Right Outward Downstream Side 63 x 18 x 2 None - - Yes Yes - DP Left Outward Upstream Side 63 x 24 x 2 None - - Yes Yes - Motor Control(s) Details Segment Type MMP V/Ph/Hz Input/Output Amps* Efficiency Heat Loss (at 100% load) Enclosure Bypass Disconnect Type RFI/EMI EMC Filter FS ABB VFD - Airmod AYK - 460/3/60 23.0/23.0 92 % 337 NEMA 3R - Fused Yes Notes *Drives are rated for use below 3,000 ft and 104°F. Use Derating Charts in Air-Mod Engineering Guide Form 100.42-EGI (212) for use above these limits. Storage Temperature: -40°F to 158°F Humidity: MAX 95% RH non-condensing Altitude: 3,300 ft. without derate (1% derate for each additional 330 ft.) Overload Current Rating: 100% for 1 minute every 10 minutes. The Class 10 trip rating of the MMP device will not withstand an across-the-line start of a fan and should not be used with VFDs with bypass circuits. The customer must provide a platform or catwalk for accessing the power-disconnect. Copper Conductors Only. FS: Contains the following option: Swinging DC Line Choke (Equivalent to 5% Input Line Reactor) Face Velocity and Static Pressure Summary Segment Description Face Area (sq. ft) Airflow (CFM) Face Velocity (ft/min) Supply Fan Static Pressure (in w.g.) Exhaust/Return Fan Static Pressure (in w.g.) FM Opening 19.5 20,000 1,025 0.18 0.00 FM Control Aluminum (CD50) 0.0 20,000 0 0.03 0.00 FM 4" Mini-Pleat 60-65% Eff, (MERV 11) 62.2 20,000 321 0.20 0.00 FM Dirty Filter Allowance 0.0 20,000 0 0.30 0.00 FS Backdraft Aluminum (CBD6) 0.0 20,000 0 0.18 0.00 FS External Static - User Entered 0.0 20,000 0 2.50 0.00 DP Opening 11.3 20,000 1,773 0.63 0.00 Total 4.02 0.00 YORK® Solution Endura™ Air Handling Unit Performance Report Project Name:Ocala Aquatics Last Saved: 7/30/2020 4:38:44 PM Unit Folder:SF-1-REV3 Report Version: 2019.4.24.1156 Unit Tag(s): AHU-1 Software Version: 20.1.6385.4217 Page 4 of 5 Dimensions and Weight Details Segment Description Length1 (in) Width2 (in) Height (in) Weight (lbs) FM Filter / Mixing Box 45 123 69 1,086 XA Variable Length Access 42 123 69 827 FS Supply Fan - SWSI 69 123 69 2,913 DP Discharge Plenum 38 123 69 1,043 Overall 194 5,869 Notes ¹The length includes bottom tier segments only ²The width does not include coil connection extensions or door latches that extend beyond the unit casing. The width does not include the depth of any pipe chases. Statement of Compliance Details YORK® Solution XT AHU's meet IBC seismic requirements for non-critical equipment (Ip = 1.0) for locations with design spectral response Sds <= 0.43. Units must be rigid mounted. The anchorage of the unit to the ground or building structure needs to be evaluated by and is the responsibility of the engineer of record. Specification of seismic requirements is the responsibility of the project design engineer. If formal certification is required, please contact your sales representative and/or application engineer for review. Certain application and site requirements may require additional cost and/or lead time. Component locations are listed as Segment Hand (Unit Hand): ex. Left (Right). See SubmittalDrawing for additional details Air handling unit parameters vary depending on conditions. Parameters such as airflows, air pressure drops, and coil capacities are shown for design conditions. YORK® Solution Endura™ Air Handling Unit Performance Report Project Name:Ocala Aquatics Last Saved: 7/30/2020 4:38:44 PM Unit Folder:SF-1-REV3 Report Version: 2019.4.24.1156 Unit Tag(s): AHU-1 Software Version: 20.1.6385.4217 Page 5 of 5 Shipping Summary Details Skid Skid Length (in) Skid Height (in) Skid Width (in) Skid Weight (lbs) (DP) 48 81 128 1,043 (FS) 69 81 141 2,913 (XA FM) 87 81 128 1,913 Notes Skid Width: Total width of the shipping skid, including any items that may extend beyond the cabinet (this includes any door handles, coil connections, drain connections, lifting lugs, mounted pipe-chases, electrical/control components, tie-down brackets, side dampers). Skid Height: Total height of the shipping skid, including any items that may extend beyond the cabinet (this includes any base-rails, shipping wood- blocks, roof peak, discharge flanges, mounted gas-furnace flue pipes). Skid Length: Total length of the shipping skid, including any items that may extend beyond the cabinet (this includes any mounted rain-hoods, discharge flanges,tie-down brackets, shipping wood-blocks, front dampers, split connectors, electrical/control components, outrigging extensions, isolation dampers, inlet baskets). 9942 Currie Davis Dr., Ste. H Tampa, FL 33619 813.995.0300 emeraldmep.com FL EB # 0027845 APPENDIX B 9942 Currie Davis Dr., Ste. H Tampa, FL 33619 813.995.0300 emeraldmep.com FL EB # 0027845 APPENDIX C Integrated Environmental Solutions 2023.2.1.0 Energy Model Output Report Project:Long Center Option#1 Design Team:Wannemacher Jensen Architects Address:1501 N Belcher Rd. Clearwater, FL 33765 Energy Analyst:REAL Building Consultants LLC Climate File:USA_FL_St.Petersburg-Clearwater.Intl.AP.722116_TMY3.epw Owner:City of Clearwater Simulation:Natatorium Option1_1206.aps Conditioned Area (ft²):34959.4935 Annual Energy Consumption (kBtu/ft²/year) & CO2 KgCO2/ft²/yr Project Viewer - 3D Model Energy End Use Site Energy Source Energy CO2 Emissions Heating Fossil Fuel 0.0 0.0 0.0 Heating Electricity 56.7 178.7 10.0 Space Cooling 27.3 86.0 4.8 Fans Interior 11.0 34.5 1.9 Heat Rejection 1.7 5.5 0.3 Pumps 0.0 0.0 0.0 DHW Fossil Fuel 0.0 0.0 0.0 DHW Electricity 0.0 0.0 0.0 Interior Lighting 4.8 15.0 0.8 Exterior Lighting 0.0 0.0 0.0 Receptacle 1.9 6.1 0.3 Data Center 0.0 0.0 0.0 Cooking Fossil Fuel 0.0 0.0 0.0 Cooking Electricity 0.0 0.0 0.0 Site Energy Use Intensity Elevators & Escalators 0.0 0.0 0.0 Refrigeration 0.0 0.0 0.0 Process 0.0 0.0 0.0 TOTAL (ex renewables)103 325 18 Site Energy Dashboard (MBtu) Site Energy Flows – Sankey Diagram Fuels End Uses Annual Fuel Costs and Peak Demands Fuels Cost ($)Peak Day Peak Time Peak Demand Electricity 111,256.00 05-Feb 7:00 465.9 kW Fossil Fuel 0.00 01-Jan 0:00 0.0 kBtu/h Total 111,256.00 01-Jan 0:00 Peak Energy Sources for Electricity (kW), Fossil Fuel (kBtu/h) and Onsite Power Generation (kW): Top 3 Contributors MonthSpace Heating (MBtu)Space Cooling (MBtu)Heat Rejection (MBtu)Interior Central Fans (MBtu)Total HVAC EnergyMonthNet electricity usage [kWh]Total net charges [$]Jan 01‐31 379.087 5.339 0.341 57.006 441.773 January 135,404.65 14,217.49$ Feb 01‐28 219.084 13.777 0.879 38.886 272.626 February 85,161.14 8,941.92$ Mar 01‐31 193.059 27.613 1.763 37.006 259.441 March 81,717.52 8,580.34$ Apr 01‐30 115.621 57.216 3.652 26.226 202.715 April 65,119.75 6,837.57$ May 01‐31 145.87 118.285 7.55 27.1 298.805 May 93,387.46 9,805.68$ Jun 01‐30 136.54 130.917 8.356 26.086 301.899 June 94,054.85 9,875.76$ Jul 01‐31 152.938 163.198 10.417 28.028 354.581 July 109,851.25 11,534.38$ Aug 01‐31 146.876 149.818 9.563 26.923 333.18 August 103,328.22 10,849.46$ Sep 01‐30 141.646 137.782 8.795 26.369 314.592 September 97,907.63 10,280.30$ Oct 01‐31 127.867 98.849 6.309 27.257 260.282 October 82,214.91 8,632.57$ Nov 01‐30 83.918 39.798 2.54 25.602 151.858 November 49,964.51 5,246.27$ Dec 01‐31 141.068 11.364 0.725 36.332 189.489 December 61,467.63 6,454.10$ Summed total 1983.572 953.954 60.891 382.822 3,381.24 Total year 1,059,579.53 111,255.84$ Option#1 Electricity ($0.105/kWh) blended rateOption#1 Energy Consumption HVAC Use global inputs for oversizing (yes/no): noCooling (Sensible) Load Oversizing Factor:10%Date:2023‐12‐06Cooling (Latent) Load Oversizing Factor:10%Heating Load Oversizing Factor:10%Loads reported below are non‐coincident room‐ and zone‐level loadsZone group Zone Room Template Floor area VolumeCooling occupied setpointCooling design load oversizing factorCooling design load with oversizing Cooling supply air temperatureMax RH setpointLatent cooling load without oversizingDesign latent cooling load with oversizingCooling design load oversizing factor from (ft²) (ft³) (⁰F) Month/time (kBtu/h) (Btu/h.ft²) (kBtu/h) (⁰F) (cfm) (ACH) (cfm/ft²) (%) (kBtu/h) (kBtu/h)(same for sens & lat)DH‐1 DH‐1 29 DH ‐1 Pool area North CirculaSPACE: Corridor ‐ All Other Corridors1,853.3 53,109.4 82.0Jun 14:3070.72 38.16 1.10 77.79 55.0 2,633.7 2.98 1.42 60.0 3.15 3.46 1.1DH‐1 Pool AreaSPACE: Gymnasium/ Fitness center ‐ Exercise area10,647.6 106,238.4 82.0Jun 10:3056.88 5.34 1.10 62.57 55.0 2,118.4 1.20 0.20 55.0 344.65 379.11 1.1DH‐1 Pool Area (upper 1)SPACE: Corridor ‐ All Other Corridors10,647.6 150,037.4 82.0Jun 10:3021.56 2.02 1.10 23.71 55.0 802.8 0.32 0.08 60.0 10.10 11.11 1.1DH‐1 Pool Area (upper 2)SPACE: Corridor ‐ All Other Corridors10,647.6 150,037.4 82.0Jun 11:3027.38 2.57 1.10 30.12 55.0 1,019.8 0.41 0.10 60.0 10.53 11.58 1.1DH‐2 Dh‐2 23 Spectator AreaSPACE: Audience Seating Area ‐ Exercise Center9,175.0 191,146.9 82.0Jun 7:3055.43 6.04 1.10 60.98 55.0 2,064.3 0.65 0.22 60.0 14.00 15.40 1.130 VestibuleSPACE: Corridor ‐ All Other Corridors251.6 9,596.6 82.0Aug 17:3020.41 81.11 1.10 22.45 55.0 759.9 4.75 3.02 60.0 0.70 0.77 1.131 VestibuleSPACE: Corridor ‐ All Other Corridors264.5 10,094.0 82.0Sep 10:3030.96 117.08 1.10 34.06 55.0 1,153.1 6.85 4.36 60.0 0.67 0.74 1.132 DH‐2 Pool Area CirculationSPACE: Corridor ‐ All Other Corridors1,187.8 44,412.8 82.0Jun 8:3017.65 14.86 1.10 19.41 55.0 657.2 0.89 0.55 60.0 3.25 3.58 1.1DH‐2 Pool AreaSPACE: Gymnasium/ Fitness center ‐ Exercise area11,579.7 115,538.8 82.0Jun 10:3086.32 7.45 1.10 94.95 55.0 3,214.7 1.67 0.28 55.0 377.47 415.22 1.1DH‐2 Pool Area (upper 1)SPACE: Corridor ‐ All Other Corridors11,579.7 163,172.2 82.0Aug 10:3023.00 1.99 1.10 25.30 55.0 856.6 0.31 0.07 60.0 11.95 13.15 1.1DH‐2 Pool Area (upper 2)SPACE: Corridor ‐ All Other Corridors11,579.7 163,172.2 82.0Jun 10:3027.21 2.35 1.10 29.93 55.0 1,013.4 0.37 0.09 60.0 11.52 12.68 1.1Zone group Zone Room Template Floor area VolumeHeating occupied setpointHeating design load oversizing factorHeating design load with oversizingHeating supply air temperatureMin RH setpointHumidification load (ft²) (ft³) (⁰F) (kBtu/h) (Btu/h.ft²) (kBtu/h) (⁰F) (cfm) (cfm/ft²) (%) (kBtu/h)DH‐1 DH‐1 29 DH ‐1 Pool area North CirculaSPACE: Corridor ‐ All Other Corridors1,853.3 53,109.4 70.00 78.39 42.30 0.00 0.00 90.0 0.0 0.00 0.0 0.00DH‐1 Pool AreaSPACE: Gymnasium/ Fitness center ‐ Exercise area10,647.6 106,238.4 70.00 32.84 3.08 0.00 0.00 90.0 0.0 0.00 0.0 0.00DH‐1 Pool Area (upper 1)SPACE: Corridor ‐ All Other Corridors10,647.6 150,037.4 70.00 20.94 1.97 0.00 0.00 90.0 0.0 0.00 0.0 0.00DH‐1 Pool Area (upper 2)SPACE: Corridor ‐ All Other Corridors10,647.6 150,037.4 70.00 27.45 2.58 0.00 0.00 90.0 0.0 0.00 0.0 0.00DH‐2 Dh‐2 23 Spectator AreaSPACE: Audience Seating Area ‐ Exercise Center9,175.0 191,146.9 70.00 44.69 4.87 0.00 0.00 90.0 0.0 0.00 0.0 0.0030 VestibuleSPACE: Corridor ‐ All Other Corridors251.6 9,596.6 70.00 7.25 28.80 0.00 0.00 90.0 0.0 0.00 0.0 0.0031 VestibuleSPACE: Corridor ‐ All Other Corridors264.5 10,094.0 70.00 10.48 39.63 0.00 0.00 90.0 0.0 0.00 0.0 0.0032 DH‐2 Pool Area CirculationSPACE: Corridor ‐ All Other Corridors1,187.8 44,412.8 70.00 17.28 14.55 0.00 0.00 90.0 0.0 0.00 0.0 0.00DH‐2 Pool AreaSPACE: Gymnasium/ Fitness center ‐ Exercise area11,579.7 115,538.8 70.00 33.20 2.87 0.00 0.00 90.0 0.0 0.00 0.0 0.00DH‐2 Pool Area (upper 1)SPACE: Corridor ‐ All Other Corridors11,579.7 163,172.2 70.00 19.40 1.68 0.00 0.00 90.0 0.0 0.00 0.0 0.00DH‐2 Pool Area (upper 2)SPACE: Corridor ‐ All Other Corridors11,579.7 163,172.2 70.00 25.35 2.19 0.00 0.00 90.0 0.0 0.00 0.0 0.00Zone group Zone Room Template Floor area VolumeDesign occupancy (ft²) (ft³) (People) (cfm) (cfm/person) (cfm/ft²) (ACH)DH‐1 DH‐1 29 DH ‐1 Pool area North CirculaSPACE: Corridor ‐ All Other Corridors1,853.3 53,109.4 0.0 111.2 0.0 0.06 0.13DH‐1 Pool AreaSPACE: Gymnasium/ Fitness center ‐ Exercise area10,647.6 106,238.4 25.0 1,138.9 45.6 0.11 0.64DH‐1 Pool Area (upper 1)SPACE: Corridor ‐ All Other Corridors10,647.6 150,037.4 0.0 0.0 0.0 0.00 0.00DH‐1 Pool Area (upper 2)SPACE: Corridor ‐ All Other Corridors10,647.6 150,037.4 0.0 0.0 0.0 0.00 0.00DH‐2 Dh‐2 23 Spectator AreaSPACE: Audience Seating Area ‐ Exercise Center9,175.0 191,146.9 10.0 625.5 62.6 0.07 0.2030 VestibuleSPACE: Corridor ‐ All Other Corridors251.6 9,596.6 0.0 15.1 0.0 0.06 0.0931 VestibuleSPACE: Corridor ‐ All Other Corridors264.5 10,094.0 0.0 15.9 0.0 0.06 0.0932 DH‐2 Pool Area CirculationSPACE: Corridor ‐ All Other Corridors1,187.8 44,412.8 0.0 71.3 0.0 0.06 0.10DH‐2 Pool AreaSPACE: Gymnasium/ Fitness center ‐ Exercise area11,579.7 115,538.8 25.0 1,194.8 47.8 0.10 0.62DH‐2 Pool Area (upper 1)SPACE: Corridor ‐ All Other Corridors11,579.7 163,172.2 0.0 0.0 0.0 0.00 0.00DH‐2 Pool Area (upper 2)SPACE: Corridor ‐ All Other Corridors11,579.7 163,172.2 0.0 0.0 0.0 0.00 0.00Heating load (without oversizing)Heating design airflow (maximum)Required minimum ventilation airflowSensible cooling load (without oversizing)Cooling design airflow (sensible cooling maximum) Table of Contents Room-Zone Loads & Sizing Reports Link to Report Guidance Long Center Option1 IES VIRTUAL ENVIRONMENT VE 2023 Project and Climate 2 Zone Conditioning Loads Reports DH-1 05 a VAV - Reheat [DX cool -...DH-1 3 DH-2 05 a VAV - Reheat [DX cool -...Dh-2 4 Room Conditioning Loads Reports DH-1 DH-1 29 DH -1 Pool area North...5 DH-1 Pool Area 6 DH-1 Pool Area (upper 1)7 DH-1 Pool Area (upper 2)8 DH-2 Dh-2 30 Vestibule 9 31 Vestibule 10 32 DH-2 Pool Area...11 DH-2 Pool Area 12 DH-2 Pool Area (upper 1)13 DH-2 Pool Area (upper 2)14 Long Center Option1 Rooms loads rev1 | 2023/12/06 16:02 | Table of Contents - Page 1 of 1 Document Page: 1 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Table of Contents reports are not influenced by system operation. 1 Project and Climate Long Center Option1 IES VIRTUAL ENVIRONMENT VE 2023 Model Data Project file Long Center Option1.mit Source HVAC file Natatorium_Option1_HVAC.asp HVAC file snapshot Vista\Long Center Option1 Rooms loads rev1.asp Model floor area 34,959.5 ft² Building conditioned floor area 34,959.5 ft² Building conditioned volume 1,156,556.0 ft³ Number of conditioned rooms 11 Load analysis methodology ASHRAE Heat Balance Method Calculated 2023/12/06 16:02 Version No.2023.2.1.0 Location Data Location St Pete-Clearwater, Florida Latitude 27.91 N Longitude 82.69 W Altitude 9.8 ft Time Zone 5.0 hours behind GMT Design Weather Data Source ASHRAE design weather database Monthly percentile: For heating loads design weather 99.60 % For cooling loads design weather 0.40 % Barometric pressure 29.9109 inHg Air density 0.0749 lb/ft³ Air specific heat 0.2434 Btu/lb·°F Density-specific heat product 0.0591 Btu/ft³·°F Summer ground reflectance 0.2 Winter ground reflectance 0.2 Carbon dioxide (ambient)400.00 ppm Cooling Calculation Data Results file Long Center Option1 Rooms loads rev1.clg Calculated 2023/12/06 16:02 Profile Month May - Sep Max outdoor temp. dry bulb 93.7 °F Max outdoor temp. wet bulb 78.4 °F Heating Calculation Data Results file Long Center Option1 Rooms loads rev1.htg Calculated 2023/12/06 16:02 Profile Month Jan Outdoor winter design temp 42.1 °F Project Loads Summary Cooling loads:kBtu/h Btu/h·ft² Coincident peak space load 391.21 11.19 Heating loads: Coincident peak space load 317.27 9.08 Long Center Option1 Rooms loads rev1 | 2023/12/06 16:02 | Project and climate - Page 1 of 1 Document Page: 2 Project Cooling and Heating loads are coincident peak value for all conditioned spaces without oversizing. 1 Zone Loads Report System: 05 a VAV - Reheat Long Center Option1 DH-1 IES VIRTUAL ENVIRONMENT VE 2023 COOLING ZONE PEAK Time of Peak (Mo/Hr:Mn)6 / 11:30 Outside Air (DBT/WBT/RH) °F and %RH 90.3 / 75.7 / 51.3 Zone Zone Net Per Floor Percent Sensible Latent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h Btu/h·ft²% External Walls -3,913 --3,913 -0.3 -0.8 Roofs 1,385 -1,385 0.1 0.3 Ground/Exposed Floors -4,562 --4,562 -0.4 -0.9 External Doors 0 -0 0.0 0.0 Windows Conduction 34,424 -34,424 2.8 6.8 Skylights Conduction 0 -0 0.0 0.0 Solar 103,955 -103,955 8.3 20.5 Infiltration 5,971 5,826 11,797 0.9 2.3 Nat/Aux Vent 0 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings 75 -75 0.0 0.0 Internal Floors 797 -797 0.1 0.2 Internal Air & Furniture 0 -0 0.0 0.0 Ceilings 0 -0 0.0 0.0 Sub Total 138,133 5,826 143,959 11.5 Internal Gains Lights 3,162 -3,162 0.3 0.6 People 17,750 27,250 45,000 3.6 8.9 Misc, Computers, Equip 1,265 313,755 315,020 25.2 62.1 Sub Total 22,177 341,005 363,182 29.1 TOTAL 160,310 346,831 507,141 40.6 100 COOLING SUMMARY Sensible cooling load (Btu/h):160,310 Latent cooling load (Btu/h):346,831 Sensible heat ratio:0.32 Design Supply Airflow calculated per:Sensible Loads Design zone air temp for Supply Airflow calculation (°F):82.0 HEATING ZONE PEAK Time of Peak (Mo/Hr:Mn)Heating Design Outside Air (DBT/WBT/RH) °F and %RH 42.1 / 35.4 / 49.6 Zone Net Per Floor Percent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h·ft²% External Walls -21,014 -21,014 -1.7 13.2 Roofs -8,635 -8,635 -0.7 5.4 Ground/Exposed Floors -16,241 -16,241 -1.3 10.2 External Doors 0 0 0.0 0.0 Windows Conduction -77,794 -77,794 -6.2 48.7 Skylights Conduction 0 0 0.0 0.0 Solar 0 0 0.0 0.0 Infiltration -23,387 -23,387 -1.9 14.7 Nat/Aux Vent 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings 1,777 1,777 0.1 -1.1 Internal Floors -14,327 -14,327 -1.1 9.0 Internal Air & Furniture 0 0 0.0 0.0 Ceilings 0 0 0.0 0.0 Sub Total -159,621 -159,621 -12.8 Internal Gains Lights 0 0 0.0 0.0 People 0 0 0.0 0.0 Misc, Computers, Equip 0 0 0.0 0.0 Sub Total 0 0 0.0 TOTAL -159,621 -159,621 -12.8 100 HEATING SUMMARY Sensible heating load (Btu/h):159,621 Design zone air temp for Supply Airflow calculation (°F):70.0 AREAS & THERMAL TRANSMITTANCE Total Area Glazing Glazing U-value1 ft²ft²%Btu/h·ft²·°F External Wall (above grade)15,437.1 6,260.1 40.6 0.25 Below Grade Walls ---- Windows2 6,260.1 6,260.1 100.0 0.48 Doors ---- Floors 6,979.8 --0.09 Roofs3 12,392.2 --0.02 COMBINED 34,809.1 6,260.1 18.0 0.14 Internal Ceilings ---- Floors 5,521.2 --0.19 Partitions4 3,695.6 --0.33 1 Area-weighted U-value; 2 Windows/glazing include glass and frames;3 Roofs incl. skylights; 4 Partitions incl. internal windows and doors. TEMPERATURES & SETPOINTS Cooling Heating °F °F Supply Air (design)55.0 80.0 Master Room Setpoint (design)82.0 70.0 Master Room (actual)82.0 70.0 Mean Radiant Temperature 179.7 163.5 Dry Resultant Temperature 178.9 164.7 RH (Design Max Setpoint) (%)-- AIRFLOW Cooling Heating cfm cfm Supply (design)20,626 24,967 Reheat Minimum (design)20,626 20,626 Leakage at Design Flow 0 0 Ventilation (requirement)20,626 20,626 Exhaust (requirement)15,469 15,469 Infiltration 766 766 CHECKS Number of People 25.00 ft²/Person 500.04 Average Ceiling Height (ft)18.38 Btu/h/ft² - Cooling (sensible)12.82 Btu/h/ft² - Heating 12.77 ft²/ton - Cooling (sensible)935.76 ft²/ton - Heating 939.79 cfm/ft² - Cooling 1.65 cfm/ft² - Heating 2.00 % Outside Air - Cooling 100.00 % Outside Air - Heating 82.61 Outdoor Air cfm/ft²1.65 Outdoor Air cfm/person 825.03 Long Center Option1 Rooms loads rev1 | 2023/12/06 16:02 | Zone Loads - Page 1 of 2 Document Page: 3 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Zone Loads reports are not influenced by system operation. 1 Zone Loads Report System: 05 a VAV - Reheat Long Center Option1 Dh-2 IES VIRTUAL ENVIRONMENT VE 2023 COOLING ZONE PEAK Time of Peak (Mo/Hr:Mn)8 / 10:30 Outside Air (DBT/WBT/RH) °F and %RH 88.2 / 76.5 / 58.6 Zone Zone Net Per Floor Percent Sensible Latent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h Btu/h·ft²% External Walls -1,069 --1,069 0.0 -0.2 Roofs 4,693 -4,693 0.2 0.8 Ground/Exposed Floors -6,480 --6,480 -0.3 -1.1 External Doors 0 -0 0.0 0.0 Windows Conduction 9,305 -9,305 0.4 1.6 Skylights Conduction 0 -0 0.0 0.0 Solar 123,653 -123,653 5.5 21.9 Infiltration 4,642 11,000 15,642 0.7 2.8 Nat/Aux Vent 0 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings -4,807 --4,807 -0.2 -0.9 Internal Floors -2,436 --2,436 -0.1 -0.4 Internal Air & Furniture 0 -0 0.0 0.0 Ceilings 14 -14 0.0 0.0 Sub Total 127,514 11,000 138,514 6.2 Internal Gains Lights 38,467 -38,467 1.7 6.8 People 17,750 27,250 45,000 2.0 8.0 Misc, Computers, Equip 1,163 341,222 342,385 15.2 60.7 Sub Total 57,380 368,472 425,852 19.0 TOTAL 184,894 379,473 564,367 25.1 100 COOLING SUMMARY Sensible cooling load (Btu/h):184,894 Latent cooling load (Btu/h):379,473 Sensible heat ratio:0.33 Design Supply Airflow calculated per:Sensible Loads Design zone air temp for Supply Airflow calculation (°F):82.0 HEATING ZONE PEAK Time of Peak (Mo/Hr:Mn)Heating Design Outside Air (DBT/WBT/RH) °F and %RH 42.1 / 35.4 / 49.6 Zone Net Per Floor Percent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h·ft²% External Walls -18,277 -18,277 -0.8 16.2 Roofs -9,424 -9,424 -0.4 8.3 Ground/Exposed Floors -15,445 -15,445 -0.7 13.7 External Doors 0 0 0.0 0.0 Windows Conduction -24,650 -24,650 -1.1 21.8 Skylights Conduction 0 0 0.0 0.0 Solar 0 0 0.0 0.0 Infiltration -25,758 -25,758 -1.1 22.8 Nat/Aux Vent 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings -502 -502 0.0 0.4 Internal Floors -18,913 -18,913 -0.8 16.7 Internal Air & Furniture 0 0 0.0 0.0 Ceilings 0 0 0.0 0.0 Sub Total -112,969 -112,969 -5.0 Internal Gains Lights 0 0 0.0 0.0 People 0 0 0.0 0.0 Misc, Computers, Equip 0 0 0.0 0.0 Sub Total 0 0 0.0 TOTAL -112,969 -112,969 -5.0 100 HEATING SUMMARY Sensible heating load (Btu/h):112,969 Design zone air temp for Supply Airflow calculation (°F):70.0 AREAS & THERMAL TRANSMITTANCE Total Area Glazing Glazing U-value1 ft²ft²%Btu/h·ft²·°F External Wall (above grade)16,317.1 2,667.5 16.3 0.13 Below Grade Walls ---- Windows2 2,667.5 2,667.5 100.0 0.33 Doors ---- Floors 15,266.9 --0.07 Roofs3 22,414.2 --0.02 COMBINED 53,998.2 2,667.5 4.9 0.07 Internal Ceilings 22.0 --0.05 Floors 7,169.6 --0.19 Partitions4 6,690.0 --0.33 1 Area-weighted U-value; 2 Windows/glazing include glass and frames;3 Roofs incl. skylights; 4 Partitions incl. internal windows and doors. TEMPERATURES & SETPOINTS Cooling Heating °F °F Supply Air (design)55.0 90.0 Master Room Setpoint (design)82.0 70.0 Master Room (actual)82.0 70.0 Mean Radiant Temperature 229.6 218.3 Dry Resultant Temperature 228.9 219.0 RH (Design Max Setpoint) (%)-- AIRFLOW Cooling Heating cfm cfm Supply (design)20,789 20,789 Reheat Minimum (design)20,789 20,789 Leakage at Design Flow 0 0 Ventilation (requirement)18,914 18,914 Exhaust (requirement)14,453 14,453 Infiltration 843 843 CHECKS Number of People 25.00 ft²/Person 531.34 Average Ceiling Height (ft)24.67 Btu/h/ft² - Cooling (sensible)13.92 Btu/h/ft² - Heating 8.50 ft²/ton - Cooling (sensible)862.13 ft²/ton - Heating 1,411.02 cfm/ft² - Cooling 1.57 cfm/ft² - Heating 1.57 % Outside Air - Cooling 90.98 % Outside Air - Heating 90.98 Outdoor Air cfm/ft²1.42 Outdoor Air cfm/person 756.58 Long Center Option1 Rooms loads rev1 | 2023/12/06 16:02 | Zone Loads - Page 2 of 2 Document Page: 4 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Zone Loads reports are not influenced by system operation. 1 Room Loads Report Zone: DH-1 System: 05 a VAV - Reheat Long Center Option1 29 DH -1 Pool area North Circulation HVAC Methodology: ApacheHVAC IES VIRTUAL ENVIRONMENT VE 2023 COOLING ROOM PEAK Time of Peak (Mo/Hr:Mn)6 / 14:30 Outside Air (DBT/WBT/RH) °F and %RH 93.7 / 77.0 / 47.0 Room Room Net Per Floor Percent Sensible Latent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h Btu/h·ft²% External Walls 1,672 -1,672 0.9 2.3 Roofs -1,764 --1,764 -1.0 -2.5 Ground/Exposed Floors -1,652 --1,652 -0.9 -2.3 External Doors 0 -0 0.0 0.0 Windows Conduction 40,772 -40,772 22.0 57.1 Skylights Conduction 0 -0 0.0 0.0 Solar 37,866 -37,866 20.4 53.0 Infiltration 1,100 720 1,820 1.0 2.5 Nat/Aux Vent 0 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings -11,699 --11,699 -6.3 -16.4 Internal Floors 0 -0 0.0 0.0 Internal Air & Furniture 0 -0 0.0 0.0 Ceilings 0 -0 0.0 0.0 Sub Total 66,296 720 67,015 36.2 Internal Gains Lights 3,162 -3,162 1.7 4.4 People 0 0 0 0.0 0.0 Misc, Computers, Equip 1,265 0 1,265 0.7 1.8 Sub Total 4,427 0 4,427 2.4 TOTAL 70,722 720 71,442 38.5 100 COOLING SUMMARY Sensible cooling load (Btu/h):70,722 Latent cooling load (Btu/h):720 Sensible heat ratio:0.99 Design Supply Airflow calculated per:Sensible Loads Design zone air temp for Supply Airflow calculation (°F):82.0 HEATING ROOM PEAK Time of Peak (Mo/Hr:Mn)Heating Design Outside Air (DBT/WBT/RH) °F and %RH 42.1 / 35.4 / 49.6 Room Net Per Floor Percent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h·ft²% External Walls -15,300 -15,300 -8.3 19.5 Roofs -1,114 -1,114 -0.6 1.4 Ground/Exposed Floors -9,221 -9,221 -5.0 11.8 External Doors 0 0 0.0 0.0 Windows Conduction -67,040 -67,040 -36.2 85.5 Skylights Conduction 0 0 0.0 0.0 Solar 0 0 0.0 0.0 Infiltration -2,704 -2,704 -1.5 3.4 Nat/Aux Vent 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings 16,989 16,989 9.2 -21.7 Internal Floors 0 0 0.0 0.0 Internal Air & Furniture 0 0 0.0 0.0 Ceilings 0 0 0.0 0.0 Sub Total -78,390 -78,390 -42.3 Internal Gains Lights 0 0 0.0 0.0 People 0 0 0.0 0.0 Misc, Computers, Equip 0 0 0.0 0.0 Sub Total 0 0 0.0 TOTAL -78,390 -78,390 -42.3 100 HEATING SUMMARY Sensible heating load (Btu/h):78,390 Design zone air temp for Supply Airflow calculation (°F):70.0 AREAS & THERMAL TRANSMITTANCE Total Area Glazing Glazing U-value1 ft²ft²%Btu/h·ft²·°F External Wall (above grade)11,823.4 4,985.9 42.2 0.27 Below Grade Walls ---- Windows2 4,985.9 4,985.9 100.0 0.53 Doors ---- Floors 1,853.3 --0.19 Roofs3 1,744.7 --0.02 COMBINED 15,421.4 4,985.9 32.3 0.23 Internal Ceilings ---- Floors ---- Partitions4 331.4 --0.33 1 Area-weighted U-value; 2 Windows/glazing include glass and frames;3 Roofs incl. skylights; 4 Partitions incl. internal windows and doors. TEMPERATURES & SETPOINTS Cooling Heating °F °F Supply Air (design)55.0 80.0 Room Setpoint (design)82.0 70.0 Room (actual)82.0 70.0 Mean Radiant Temperature 85.8 64.1 Dry Resultant Temperature 83.9 67.1 RH (Design Max Setpoint) (%)60.0 60.0 AIRFLOW Cooling Heating cfm cfm Supply (design)3,541 7,882 Reheat Minimum (design)3,541 3,541 Leakage at Design Flow 0 0 Ventilation (requirement)3,541 3,541 Exhaust (requirement)1,770 1,770 Infiltration 89 89 CHECKS Number of People 0.00 ft²/Person - Average Ceiling Height (ft)35.37 Btu/h/ft² - Cooling (sensible)38.16 Btu/h/ft² - Heating 42.30 ft²/ton - Cooling (sensible)314.47 ft²/ton - Heating 283.71 cfm/ft² - Cooling 1.91 cfm/ft² - Heating 4.25 % Outside Air - Cooling 100.00 % Outside Air - Heating 44.92 Outdoor Air cfm/ft²1.91 Outdoor Air cfm/person - Long Center Option1 Rooms loads rev1 | 2023/12/06 16:02 | Room Loads - Page 1 of 10 Document Page: 5 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Room Loads reports are not influenced by system operation. 1 Room Loads Report Zone: DH-1 System: 05 a VAV - Reheat Long Center Option1 DH-1 Pool Area HVAC Methodology: ApacheHVAC IES VIRTUAL ENVIRONMENT VE 2023 COOLING ROOM PEAK Time of Peak (Mo/Hr:Mn)6 / 10:30 Outside Air (DBT/WBT/RH) °F and %RH 88.0 / 74.9 / 54.4 Room Room Net Per Floor Percent Sensible Latent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h Btu/h·ft²% External Walls -131 --131 0.0 0.0 Roofs 0 -0 0.0 0.0 Ground/Exposed Floors -4,944 --4,944 -0.5 -1.2 External Doors 0 -0 0.0 0.0 Windows Conduction 2,028 -2,028 0.2 0.5 Skylights Conduction 0 -0 0.0 0.0 Solar 47,625 -47,625 4.5 11.9 Infiltration 912 1,949 2,861 0.3 0.7 Nat/Aux Vent 0 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings -4,516 --4,516 -0.4 -1.1 Internal Floors -1,831 --1,831 -0.2 -0.5 Internal Air & Furniture 0 -0 0.0 0.0 Ceilings 0 -0 0.0 0.0 Sub Total 39,144 1,949 41,093 3.9 Internal Gains Lights 0 -0 0.0 0.0 People 17,750 27,250 45,000 4.2 11.3 Misc, Computers, Equip 0 313,755 313,755 29.5 78.5 Sub Total 17,750 341,005 358,755 33.7 TOTAL 56,894 342,954 399,848 37.6 100 COOLING SUMMARY Sensible cooling load (Btu/h):56,894 Latent cooling load (Btu/h):342,954 Sensible heat ratio:0.14 Design Supply Airflow calculated per:Sensible Loads Design zone air temp for Supply Airflow calculation (°F):82.0 HEATING ROOM PEAK Time of Peak (Mo/Hr:Mn)Heating Design Outside Air (DBT/WBT/RH) °F and %RH 42.1 / 35.4 / 49.6 Room Net Per Floor Percent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h·ft²% External Walls -1,019 -1,019 -0.1 3.1 Roofs 0 0 0.0 0.0 Ground/Exposed Floors -7,020 -7,020 -0.7 21.4 External Doors 0 0 0.0 0.0 Windows Conduction -4,359 -4,359 -0.4 13.3 Skylights Conduction 0 0 0.0 0.0 Solar 0 0 0.0 0.0 Infiltration -5,408 -5,408 -0.5 16.5 Nat/Aux Vent 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings -702 -702 -0.1 2.1 Internal Floors -14,327 -14,327 -1.3 43.6 Internal Air & Furniture 0 0 0.0 0.0 Ceilings 0 0 0.0 0.0 Sub Total -32,835 -32,835 -3.1 Internal Gains Lights 0 0 0.0 0.0 People 0 0 0.0 0.0 Misc, Computers, Equip 0 0 0.0 0.0 Sub Total 0 0 0.0 TOTAL -32,835 -32,835 -3.1 100 HEATING SUMMARY Sensible heating load (Btu/h):32,835 Design zone air temp for Supply Airflow calculation (°F):70.0 AREAS & THERMAL TRANSMITTANCE Total Area Glazing Glazing U-value1 ft²ft²%Btu/h·ft²·°F External Wall (above grade)944.8 526.2 55.7 0.20 Below Grade Walls ---- Windows2 526.2 526.2 100.0 0.30 Doors ---- Floors 5,126.4 --0.05 Roofs3 ---- COMBINED 6,071.3 526.2 8.7 0.08 Internal Ceilings ---- Floors 5,521.2 --0.19 Partitions4 140.0 --0.33 1 Area-weighted U-value; 2 Windows/glazing include glass and frames;3 Roofs incl. skylights; 4 Partitions incl. internal windows and doors. TEMPERATURES & SETPOINTS Cooling Heating °F °F Supply Air (design)55.0 80.0 Room Setpoint (design)82.0 70.0 Room (actual)82.0 70.0 Mean Radiant Temperature 84.3 67.5 Dry Resultant Temperature 83.2 68.7 RH (Design Max Setpoint) (%)-- AIRFLOW Cooling Heating cfm cfm Supply (design)7,083 7,083 Reheat Minimum (design)7,083 7,083 Leakage at Design Flow 0 0 Ventilation (requirement)7,083 7,083 Exhaust (requirement)6,197 6,197 Infiltration 177 177 CHECKS Number of People 25.00 ft²/Person 425.90 Average Ceiling Height (ft)9.98 Btu/h/ft² - Cooling (sensible)5.34 Btu/h/ft² - Heating 3.08 ft²/ton - Cooling (sensible)2,245.78 ft²/ton - Heating 3,891.30 cfm/ft² - Cooling 0.67 cfm/ft² - Heating 0.67 % Outside Air - Cooling 100.00 % Outside Air - Heating 100.00 Outdoor Air cfm/ft²0.67 Outdoor Air cfm/person 283.30 Long Center Option1 Rooms loads rev1 | 2023/12/06 16:02 | Room Loads - Page 2 of 10 Document Page: 6 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Room Loads reports are not influenced by system operation. 1 Room Loads Report Zone: DH-1 System: 05 a VAV - Reheat Long Center Option1 DH-1 Pool Area (upper 1) HVAC Methodology: ApacheHVAC IES VIRTUAL ENVIRONMENT VE 2023 COOLING ROOM PEAK Time of Peak (Mo/Hr:Mn)6 / 10:30 Outside Air (DBT/WBT/RH) °F and %RH 88.0 / 74.9 / 54.4 Room Room Net Per Floor Percent Sensible Latent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h Btu/h·ft²% External Walls -166 --166 --0.7 Roofs 0 -0 -0.0 Ground/Exposed Floors 0 -0 -0.0 External Doors 0 -0 -0.0 Windows Conduction 1,851 -1,851 -8.1 Skylights Conduction 0 -0 -0.0 Solar 11,521 -11,521 -50.3 Infiltration 1,288 1,340 2,628 -11.5 Nat/Aux Vent 0 0 0 -0.0 Internal Building Gains/Losses Internal Walls/Openings 7,075 -7,075 -30.9 Internal Floors 0 -0 -0.0 Internal Air & Furniture 0 -0 -0.0 Ceilings 0 -0 -0.0 Sub Total 21,570 1,340 22,910 0.0 Internal Gains Lights 0 -0 -0.0 People 0 0 0 -0.0 Misc, Computers, Equip 0 0 0 -0.0 Sub Total 0 0 0 0.0 TOTAL 21,570 1,340 22,910 0.0 100 COOLING SUMMARY Sensible cooling load (Btu/h):21,570 Latent cooling load (Btu/h):1,340 Sensible heat ratio:0.94 Design Supply Airflow calculated per:Sensible Loads Design zone air temp for Supply Airflow calculation (°F):82.0 HEATING ROOM PEAK Time of Peak (Mo/Hr:Mn)Heating Design Outside Air (DBT/WBT/RH) °F and %RH 42.1 / 35.4 / 49.6 Room Net Per Floor Percent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h·ft²% External Walls -2,335 -2,335 -- Roofs 0 0 -- Ground/Exposed Floors 0 0 -- External Doors 0 0 -- Windows Conduction -3,214 -3,214 -- Skylights Conduction 0 0 -- Solar 0 0 -- Infiltration -7,638 -7,638 -- Nat/Aux Vent 0 0 -- Internal Building Gains/Losses Internal Walls/Openings -7,756 -7,756 -- Internal Floors 0 0 -- Internal Air & Furniture 0 0 -- Ceilings 0 0 -- Sub Total -20,942 -20,942 0.0 Internal Gains Lights 0 0 -- People 0 0 -- Misc, Computers, Equip 0 0 -- Sub Total 0 0 0.0 TOTAL -20,942 -20,942 0.0 0 HEATING SUMMARY Sensible heating load (Btu/h):20,942 Design zone air temp for Supply Airflow calculation (°F):70.0 AREAS & THERMAL TRANSMITTANCE Total Area Glazing Glazing U-value1 ft²ft²%Btu/h·ft²·°F External Wall (above grade)1,334.4 376.7 28.2 0.15 Below Grade Walls ---- Windows2 376.7 376.7 100.0 0.30 Doors ---- Floors ---- Roofs3 ---- COMBINED 1,334.4 376.7 28.2 0.15 Internal Ceilings ---- Floors ---- Partitions4 3,206.4 --0.33 1 Area-weighted U-value; 2 Windows/glazing include glass and frames;3 Roofs incl. skylights; 4 Partitions incl. internal windows and doors. TEMPERATURES & SETPOINTS Cooling Heating °F °F Supply Air (design)55.0 80.0 Room Setpoint (design)82.0 70.0 Room (actual)82.0 70.0 Mean Radiant Temperature 83.4 68.0 Dry Resultant Temperature 82.7 69.0 RH (Design Max Setpoint) (%)-- AIRFLOW Cooling Heating cfm cfm Supply (design)5,001 5,001 Reheat Minimum (design)5,001 5,001 Leakage at Design Flow 0 0 Ventilation (requirement)5,001 5,001 Exhaust (requirement)3,751 3,751 Infiltration 250 250 CHECKS Number of People 0.00 ft²/Person - Average Ceiling Height (ft)14.09 Btu/h/ft² - Cooling (sensible)- Btu/h/ft² - Heating - ft²/ton - Cooling (sensible)- ft²/ton - Heating - cfm/ft² - Cooling - cfm/ft² - Heating - % Outside Air - Cooling 100.00 % Outside Air - Heating 100.00 Outdoor Air cfm/ft²- Outdoor Air cfm/person - Long Center Option1 Rooms loads rev1 | 2023/12/06 16:02 | Room Loads - Page 3 of 10 Document Page: 7 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Room Loads reports are not influenced by system operation. 1 Room Loads Report Zone: DH-1 System: 05 a VAV - Reheat Long Center Option1 DH-1 Pool Area (upper 2) HVAC Methodology: ApacheHVAC IES VIRTUAL ENVIRONMENT VE 2023 COOLING ROOM PEAK Time of Peak (Mo/Hr:Mn)6 / 11:30 Outside Air (DBT/WBT/RH) °F and %RH 90.3 / 75.7 / 51.3 Room Room Net Per Floor Percent Sensible Latent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h Btu/h·ft²% External Walls 55 -55 -0.2 Roofs 3,401 -3,401 -11.7 Ground/Exposed Floors 0 -0 -0.0 External Doors 0 -0 -0.0 Windows Conduction 2,022 -2,022 -7.0 Skylights Conduction 0 -0 -0.0 Solar 16,719 -16,719 -57.7 Infiltration 1,950 1,576 3,526 -12.2 Nat/Aux Vent 0 0 0 -0.0 Internal Building Gains/Losses Internal Walls/Openings 3,237 -3,237 -11.2 Internal Floors 0 -0 -0.0 Internal Air & Furniture 0 -0 -0.0 Ceilings 0 -0 -0.0 Sub Total 27,383 1,576 28,959 0.0 Internal Gains Lights 0 -0 -0.0 People 0 0 0 -0.0 Misc, Computers, Equip 0 0 0 -0.0 Sub Total 0 0 0 0.0 TOTAL 27,383 1,576 28,959 0.0 100 COOLING SUMMARY Sensible cooling load (Btu/h):27,383 Latent cooling load (Btu/h):1,576 Sensible heat ratio:0.95 Design Supply Airflow calculated per:Sensible Loads Design zone air temp for Supply Airflow calculation (°F):82.0 HEATING ROOM PEAK Time of Peak (Mo/Hr:Mn)Heating Design Outside Air (DBT/WBT/RH) °F and %RH 42.1 / 35.4 / 49.6 Room Net Per Floor Percent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h·ft²% External Walls -2,360 -2,360 -- Roofs -7,521 -7,521 -- Ground/Exposed Floors 0 0 -- External Doors 0 0 -- Windows Conduction -3,181 -3,181 -- Skylights Conduction 0 0 -- Solar 0 0 -- Infiltration -7,638 -7,638 -- Nat/Aux Vent 0 0 -- Internal Building Gains/Losses Internal Walls/Openings -6,754 -6,754 -- Internal Floors 0 0 -- Internal Air & Furniture 0 0 -- Ceilings 0 0 -- Sub Total -27,454 -27,454 0.0 Internal Gains Lights 0 0 -- People 0 0 -- Misc, Computers, Equip 0 0 -- Sub Total 0 0 0.0 TOTAL -27,454 -27,454 0.0 0 HEATING SUMMARY Sensible heating load (Btu/h):27,454 Design zone air temp for Supply Airflow calculation (°F):70.0 AREAS & THERMAL TRANSMITTANCE Total Area Glazing Glazing U-value1 ft²ft²%Btu/h·ft²·°F External Wall (above grade)1,334.4 371.3 27.8 0.14 Below Grade Walls ---- Windows2 371.3 371.3 100.0 0.30 Doors ---- Floors ---- Roofs3 10,647.6 --0.02 COMBINED 11,982.0 371.3 3.1 0.04 Internal Ceilings ---- Floors ---- Partitions4 349.2 --0.33 1 Area-weighted U-value; 2 Windows/glazing include glass and frames;3 Roofs incl. skylights; 4 Partitions incl. internal windows and doors. TEMPERATURES & SETPOINTS Cooling Heating °F °F Supply Air (design)55.0 80.0 Room Setpoint (design)82.0 70.0 Room (actual)82.0 70.0 Mean Radiant Temperature 83.3 68.1 Dry Resultant Temperature 82.6 69.1 RH (Design Max Setpoint) (%)-- AIRFLOW Cooling Heating cfm cfm Supply (design)5,001 5,001 Reheat Minimum (design)5,001 5,001 Leakage at Design Flow 0 0 Ventilation (requirement)5,001 5,001 Exhaust (requirement)3,751 3,751 Infiltration 250 250 CHECKS Number of People 0.00 ft²/Person - Average Ceiling Height (ft)14.09 Btu/h/ft² - Cooling (sensible)- Btu/h/ft² - Heating - ft²/ton - Cooling (sensible)- ft²/ton - Heating - cfm/ft² - Cooling - cfm/ft² - Heating - % Outside Air - Cooling 100.00 % Outside Air - Heating 100.00 Outdoor Air cfm/ft²- Outdoor Air cfm/person - Long Center Option1 Rooms loads rev1 | 2023/12/06 16:02 | Room Loads - Page 4 of 10 Document Page: 8 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Room Loads reports are not influenced by system operation. 1 Room Loads Report Zone: Dh-2 System: 05 a VAV - Reheat Long Center Option1 30 Vestibule HVAC Methodology: ApacheHVAC IES VIRTUAL ENVIRONMENT VE 2023 COOLING ROOM PEAK Time of Peak (Mo/Hr:Mn)8 / 17:30 Outside Air (DBT/WBT/RH) °F and %RH 91.6 / 77.7 / 53.8 Room Room Net Per Floor Percent Sensible Latent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h Btu/h·ft²% External Walls -1,967 --1,967 -7.8 -9.5 Roofs -1,177 --1,177 -4.7 -5.7 Ground/Exposed Floors -1,659 --1,659 -6.6 -8.0 External Doors 0 -0 0.0 0.0 Windows Conduction 1,887 -1,887 7.5 9.1 Skylights Conduction 0 -0 0.0 0.0 Solar 25,899 -25,899 103.0 125.5 Infiltration 178 227 405 1.6 2.0 Nat/Aux Vent 0 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings -3,356 --3,356 -13.3 -16.3 Internal Floors 0 -0 0.0 0.0 Internal Air & Furniture 0 -0 0.0 0.0 Ceilings 0 -0 0.0 0.0 Sub Total 19,805 227 20,032 79.6 Internal Gains Lights 429 -429 1.7 2.1 People 0 0 0 0.0 0.0 Misc, Computers, Equip 172 0 172 0.7 0.8 Sub Total 601 0 601 2.4 TOTAL 20,406 227 20,633 82.0 100 COOLING SUMMARY Sensible cooling load (Btu/h):20,406 Latent cooling load (Btu/h):227 Sensible heat ratio:0.99 Design Supply Airflow calculated per:Sensible Loads Design zone air temp for Supply Airflow calculation (°F):82.0 HEATING ROOM PEAK Time of Peak (Mo/Hr:Mn)Heating Design Outside Air (DBT/WBT/RH) °F and %RH 42.1 / 35.4 / 49.6 Room Net Per Floor Percent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h·ft²% External Walls -2,572 -2,572 -10.2 35.5 Roofs -173 -173 -0.7 2.4 Ground/Exposed Floors -1,312 -1,312 -5.2 18.1 External Doors 0 0 0.0 0.0 Windows Conduction -3,033 -3,033 -12.1 41.9 Skylights Conduction 0 0 0.0 0.0 Solar 0 0 0.0 0.0 Infiltration -489 -489 -1.9 6.7 Nat/Aux Vent 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings 332 332 1.3 -4.6 Internal Floors 0 0 0.0 0.0 Internal Air & Furniture 0 0 0.0 0.0 Ceilings 0 0 0.0 0.0 Sub Total -7,246 -7,246 -28.8 Internal Gains Lights 0 0 0.0 0.0 People 0 0 0.0 0.0 Misc, Computers, Equip 0 0 0.0 0.0 Sub Total 0 0 0.0 TOTAL -7,246 -7,246 -28.8 100 HEATING SUMMARY Sensible heating load (Btu/h):7,246 Design zone air temp for Supply Airflow calculation (°F):70.0 AREAS & THERMAL TRANSMITTANCE Total Area Glazing Glazing U-value1 ft²ft²%Btu/h·ft²·°F External Wall (above grade)1,462.0 366.6 25.1 0.14 Below Grade Walls ---- Windows2 366.6 366.6 100.0 0.30 Doors ---- Floors 251.6 --0.19 Roofs3 251.4 --0.02 COMBINED 1,965.0 366.6 18.7 0.13 Internal Ceilings ---- Floors ---- Partitions4 1,192.2 --0.33 1 Area-weighted U-value; 2 Windows/glazing include glass and frames;3 Roofs incl. skylights; 4 Partitions incl. internal windows and doors. TEMPERATURES & SETPOINTS Cooling Heating °F °F Supply Air (design)55.0 90.0 Room Setpoint (design)82.0 70.0 Room (actual)82.0 70.0 Mean Radiant Temperature 89.1 66.8 Dry Resultant Temperature 85.5 68.4 RH (Design Max Setpoint) (%)-- AIRFLOW Cooling Heating cfm cfm Supply (design)760 760 Reheat Minimum (design)760 760 Leakage at Design Flow 0 0 Ventilation (requirement)19 19 Exhaust (requirement)-- Infiltration 16 16 CHECKS Number of People 0.00 ft²/Person - Average Ceiling Height (ft)38.15 Btu/h/ft² - Cooling (sensible)81.11 Btu/h/ft² - Heating 28.80 ft²/ton - Cooling (sensible)147.94 ft²/ton - Heating 416.62 cfm/ft² - Cooling 3.02 cfm/ft² - Heating 3.02 % Outside Air - Cooling 2.48 % Outside Air - Heating 2.48 Outdoor Air cfm/ft²0.08 Outdoor Air cfm/person - Long Center Option1 Rooms loads rev1 | 2023/12/06 16:02 | Room Loads - Page 5 of 10 Document Page: 9 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Room Loads reports are not influenced by system operation. 1 Room Loads Report Zone: Dh-2 System: 05 a VAV - Reheat Long Center Option1 31 Vestibule HVAC Methodology: ApacheHVAC IES VIRTUAL ENVIRONMENT VE 2023 COOLING ROOM PEAK Time of Peak (Mo/Hr:Mn)9 / 10:30 Outside Air (DBT/WBT/RH) °F and %RH 87.7 / 75.3 / 56.6 Room Room Net Per Floor Percent Sensible Latent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h Btu/h·ft²% External Walls -1,035 --1,035 -3.9 -3.3 Roofs -2,538 --2,538 -9.6 -8.2 Ground/Exposed Floors -4,055 --4,055 -15.3 -13.0 External Doors 0 -0 0.0 0.0 Windows Conduction 1,210 -1,210 4.6 3.9 Skylights Conduction 0 -0 0.0 0.0 Solar 43,870 -43,870 165.9 141.1 Infiltration 83 130 213 0.8 0.7 Nat/Aux Vent 0 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings -7,202 --7,202 -27.2 -23.2 Internal Floors 0 -0 0.0 0.0 Internal Air & Furniture 0 -0 0.0 0.0 Ceilings 0 -0 0.0 0.0 Sub Total 30,333 130 30,463 115.2 Internal Gains Lights 451 -451 1.7 1.5 People 0 0 0 0.0 0.0 Misc, Computers, Equip 181 0 181 0.7 0.6 Sub Total 632 0 632 2.4 TOTAL 30,964 130 31,094 117.6 100 COOLING SUMMARY Sensible cooling load (Btu/h):30,964 Latent cooling load (Btu/h):130 Sensible heat ratio:1.00 Design Supply Airflow calculated per:Sensible Loads Design zone air temp for Supply Airflow calculation (°F):82.0 HEATING ROOM PEAK Time of Peak (Mo/Hr:Mn)Heating Design Outside Air (DBT/WBT/RH) °F and %RH 42.1 / 35.4 / 49.6 Room Net Per Floor Percent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h·ft²% External Walls -731 -731 -2.8 7.0 Roofs -174 -174 -0.7 1.7 Ground/Exposed Floors -1,311 -1,311 -5.0 12.5 External Doors 0 0 0.0 0.0 Windows Conduction -8,772 -8,772 -33.2 83.7 Skylights Conduction 0 0 0.0 0.0 Solar 0 0 0.0 0.0 Infiltration -514 -514 -1.9 4.9 Nat/Aux Vent 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings 1,022 1,022 3.9 -9.8 Internal Floors 0 0 0.0 0.0 Internal Air & Furniture 0 0 0.0 0.0 Ceilings 0 0 0.0 0.0 Sub Total -10,480 -10,480 -39.6 Internal Gains Lights 0 0 0.0 0.0 People 0 0 0.0 0.0 Misc, Computers, Equip 0 0 0.0 0.0 Sub Total 0 0 0.0 TOTAL -10,480 -10,480 -39.6 100 HEATING SUMMARY Sensible heating load (Btu/h):10,480 Design zone air temp for Supply Airflow calculation (°F):70.0 AREAS & THERMAL TRANSMITTANCE Total Area Glazing Glazing U-value1 ft²ft²%Btu/h·ft²·°F External Wall (above grade)1,453.8 816.5 56.2 0.27 Below Grade Walls ---- Windows2 816.5 816.5 100.0 0.41 Doors ---- Floors 264.5 --0.19 Roofs3 264.5 --0.02 COMBINED 1,982.8 816.5 41.2 0.23 Internal Ceilings ---- Floors ---- Partitions4 1,061.3 --0.33 1 Area-weighted U-value; 2 Windows/glazing include glass and frames;3 Roofs incl. skylights; 4 Partitions incl. internal windows and doors. TEMPERATURES & SETPOINTS Cooling Heating °F °F Supply Air (design)55.0 90.0 Room Setpoint (design)82.0 70.0 Room (actual)82.0 70.0 Mean Radiant Temperature 93.7 64.9 Dry Resultant Temperature 87.9 67.4 RH (Design Max Setpoint) (%)-- AIRFLOW Cooling Heating cfm cfm Supply (design)1,153 1,153 Reheat Minimum (design)1,153 1,153 Leakage at Design Flow 0 0 Ventilation (requirement)20 20 Exhaust (requirement)-- Infiltration 17 17 CHECKS Number of People 0.00 ft²/Person - Average Ceiling Height (ft)38.17 Btu/h/ft² - Cooling (sensible)117.08 Btu/h/ft² - Heating 39.63 ft²/ton - Cooling (sensible)102.49 ft²/ton - Heating 302.83 cfm/ft² - Cooling 4.36 cfm/ft² - Heating 4.36 % Outside Air - Cooling 1.72 % Outside Air - Heating 1.72 Outdoor Air cfm/ft²0.07 Outdoor Air cfm/person - Long Center Option1 Rooms loads rev1 | 2023/12/06 16:02 | Room Loads - Page 6 of 10 Document Page: 10 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Room Loads reports are not influenced by system operation. 1 Room Loads Report Zone: Dh-2 System: 05 a VAV - Reheat Long Center Option1 32 DH-2 Pool Area Circulation HVAC Methodology: ApacheHVAC IES VIRTUAL ENVIRONMENT VE 2023 COOLING ROOM PEAK Time of Peak (Mo/Hr:Mn)6 / 8:30 Outside Air (DBT/WBT/RH) °F and %RH 82.6 / 72.9 / 63.1 Room Room Net Per Floor Percent Sensible Latent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h Btu/h·ft²% External Walls -473 --473 -0.4 -2.6 Roofs 924 -924 0.8 5.2 Ground/Exposed Floors 0 -0 0.0 0.0 External Doors 0 -0 0.0 0.0 Windows Conduction -9 --9 0.0 -0.1 Skylights Conduction 0 -0 0.0 0.0 Solar 13,576 -13,576 11.4 75.8 Infiltration -60 258 198 0.2 1.1 Nat/Aux Vent 0 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings 849 -849 0.7 4.7 Internal Floors 0 -0 0.0 0.0 Internal Air & Furniture 8 -8 0.0 0.0 Ceilings 10 -10 0.0 0.1 Sub Total 14,826 258 15,084 12.7 Internal Gains Lights 2,026 -2,026 1.7 11.3 People 0 0 0 0.0 0.0 Misc, Computers, Equip 811 0 811 0.7 4.5 Sub Total 2,837 0 2,837 2.4 TOTAL 17,663 258 17,921 15.1 100 COOLING SUMMARY Sensible cooling load (Btu/h):17,663 Latent cooling load (Btu/h):258 Sensible heat ratio:0.99 Design Supply Airflow calculated per:Sensible Loads Design zone air temp for Supply Airflow calculation (°F):82.0 HEATING ROOM PEAK Time of Peak (Mo/Hr:Mn)Heating Design Outside Air (DBT/WBT/RH) °F and %RH 42.1 / 35.4 / 49.6 Room Net Per Floor Percent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h·ft²% External Walls -8,861 -8,861 -7.5 51.3 Roofs -806 -806 -0.7 4.7 Ground/Exposed Floors -6,690 -6,690 -5.6 38.7 External Doors 0 0 0.0 0.0 Windows Conduction -417 -417 -0.4 2.4 Skylights Conduction 0 0 0.0 0.0 Solar 0 0 0.0 0.0 Infiltration -2,261 -2,261 -1.9 13.1 Nat/Aux Vent 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings 1,752 1,752 1.5 -10.1 Internal Floors 0 0 0.0 0.0 Internal Air & Furniture 0 0 0.0 0.0 Ceilings 0 0 0.0 0.0 Sub Total -17,283 -17,283 -14.6 Internal Gains Lights 0 0 0.0 0.0 People 0 0 0.0 0.0 Misc, Computers, Equip 0 0 0.0 0.0 Sub Total 0 0 0.0 TOTAL -17,283 -17,283 -14.6 100 HEATING SUMMARY Sensible heating load (Btu/h):17,283 Design zone air temp for Supply Airflow calculation (°F):70.0 AREAS & THERMAL TRANSMITTANCE Total Area Glazing Glazing U-value1 ft²ft²%Btu/h·ft²·°F External Wall (above grade)3,735.4 28.7 0.8 0.09 Below Grade Walls ---- Windows2 28.7 28.7 100.0 0.53 Doors ---- Floors 1,187.8 --0.19 Roofs3 1,143.6 --0.02 COMBINED 6,066.8 28.7 0.5 0.10 Internal Ceilings 44.1 --0.05 Floors ---- Partitions4 2,305.0 --0.33 1 Area-weighted U-value; 2 Windows/glazing include glass and frames;3 Roofs incl. skylights; 4 Partitions incl. internal windows and doors. TEMPERATURES & SETPOINTS Cooling Heating °F °F Supply Air (design)55.0 90.0 Room Setpoint (design)82.0 70.0 Room (actual)82.0 70.0 Mean Radiant Temperature 83.5 68.0 Dry Resultant Temperature 82.7 69.0 RH (Design Max Setpoint) (%)-- AIRFLOW Cooling Heating cfm cfm Supply (design)2,221 2,221 Reheat Minimum (design)2,221 2,221 Leakage at Design Flow 0 0 Ventilation (requirement)2,221 2,221 Exhaust (requirement)1,480 1,480 Infiltration 74 74 CHECKS Number of People 0.00 ft²/Person - Average Ceiling Height (ft)37.39 Btu/h/ft² - Cooling (sensible)14.87 Btu/h/ft² - Heating 14.55 ft²/ton - Cooling (sensible)806.93 ft²/ton - Heating 824.71 cfm/ft² - Cooling 1.87 cfm/ft² - Heating 1.87 % Outside Air - Cooling 100.00 % Outside Air - Heating 100.00 Outdoor Air cfm/ft²1.87 Outdoor Air cfm/person - Long Center Option1 Rooms loads rev1 | 2023/12/06 16:02 | Room Loads - Page 7 of 10 Document Page: 11 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Room Loads reports are not influenced by system operation. 1 Room Loads Report Zone: Dh-2 System: 05 a VAV - Reheat Long Center Option1 DH-2 Pool Area HVAC Methodology: ApacheHVAC IES VIRTUAL ENVIRONMENT VE 2023 COOLING ROOM PEAK Time of Peak (Mo/Hr:Mn)6 / 10:30 Outside Air (DBT/WBT/RH) °F and %RH 88.0 / 74.9 / 54.4 Room Room Net Per Floor Percent Sensible Latent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h Btu/h·ft²% External Walls -100 --100 0.0 0.0 Roofs 0 -0 0.0 0.0 Ground/Exposed Floors -3,852 --3,852 -0.3 -0.8 External Doors 0 -0 0.0 0.0 Windows Conduction 2,251 -2,251 0.2 0.5 Skylights Conduction 0 -0 0.0 0.0 Solar 48,183 -48,183 4.2 10.5 Infiltration 992 2,119 3,111 0.3 0.7 Nat/Aux Vent 0 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings -12,140 --12,140 -1.0 -2.7 Internal Floors -2,329 --2,329 -0.2 -0.5 Internal Air & Furniture 0 -0 0.0 0.0 Ceilings 0 -0 0.0 0.0 Sub Total 33,005 2,119 35,124 3.0 Internal Gains Lights 35,560 -35,560 3.1 7.8 People 17,750 27,250 45,000 3.9 9.8 Misc, Computers, Equip 0 341,222 341,222 29.5 74.7 Sub Total 53,310 368,472 421,783 36.4 TOTAL 86,315 370,592 456,907 39.5 100 COOLING SUMMARY Sensible cooling load (Btu/h):86,315 Latent cooling load (Btu/h):370,592 Sensible heat ratio:0.19 Design Supply Airflow calculated per:Sensible Loads Design zone air temp for Supply Airflow calculation (°F):82.0 HEATING ROOM PEAK Time of Peak (Mo/Hr:Mn)Heating Design Outside Air (DBT/WBT/RH) °F and %RH 42.1 / 35.4 / 49.6 Room Net Per Floor Percent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h·ft²% External Walls -1,063 -1,063 -0.1 3.2 Roofs 0 0 0.0 0.0 Ground/Exposed Floors -6,133 -6,133 -0.5 18.5 External Doors 0 0 0.0 0.0 Windows Conduction -4,977 -4,977 -0.4 15.0 Skylights Conduction 0 0 0.0 0.0 Solar 0 0 0.0 0.0 Infiltration -5,882 -5,882 -0.5 17.7 Nat/Aux Vent 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings 3,761 3,761 0.3 -11.3 Internal Floors -18,913 -18,913 -1.6 57.0 Internal Air & Furniture 0 0 0.0 0.0 Ceilings 0 0 0.0 0.0 Sub Total -33,207 -33,207 -2.9 Internal Gains Lights 0 0 0.0 0.0 People 0 0 0.0 0.0 Misc, Computers, Equip 0 0 0.0 0.0 Sub Total 0 0 0.0 TOTAL -33,207 -33,207 -2.9 100 HEATING SUMMARY Sensible heating load (Btu/h):33,207 Design zone air temp for Supply Airflow calculation (°F):70.0 AREAS & THERMAL TRANSMITTANCE Total Area Glazing Glazing U-value1 ft²ft²%Btu/h·ft²·°F External Wall (above grade)1,027.6 594.8 57.9 0.21 Below Grade Walls ---- Windows2 594.8 594.8 100.0 0.30 Doors ---- Floors 4,432.2 --0.05 Roofs3 ---- COMBINED 5,459.8 594.8 10.9 0.08 Internal Ceilings ---- Floors 7,147.5 --0.19 Partitions4 344.5 --0.33 1 Area-weighted U-value; 2 Windows/glazing include glass and frames;3 Roofs incl. skylights; 4 Partitions incl. internal windows and doors. TEMPERATURES & SETPOINTS Cooling Heating °F °F Supply Air (design)55.0 90.0 Room Setpoint (design)82.0 70.0 Room (actual)82.0 70.0 Mean Radiant Temperature 84.8 67.9 Dry Resultant Temperature 83.4 68.9 RH (Design Max Setpoint) (%)-- AIRFLOW Cooling Heating cfm cfm Supply (design)5,777 5,777 Reheat Minimum (design)5,777 5,777 Leakage at Design Flow 0 0 Ventilation (requirement)5,777 5,777 Exhaust (requirement)4,814 4,814 Infiltration 193 193 CHECKS Number of People 25.00 ft²/Person 463.19 Average Ceiling Height (ft)9.98 Btu/h/ft² - Cooling (sensible)7.45 Btu/h/ft² - Heating 2.87 ft²/ton - Cooling (sensible)1,609.87 ft²/ton - Heating 4,184.57 cfm/ft² - Cooling 0.50 cfm/ft² - Heating 0.50 % Outside Air - Cooling 100.00 % Outside Air - Heating 100.00 Outdoor Air cfm/ft²0.50 Outdoor Air cfm/person 231.08 Long Center Option1 Rooms loads rev1 | 2023/12/06 16:02 | Room Loads - Page 8 of 10 Document Page: 12 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Room Loads reports are not influenced by system operation. 1 Room Loads Report Zone: Dh-2 System: 05 a VAV - Reheat Long Center Option1 DH-2 Pool Area (upper 1) HVAC Methodology: ApacheHVAC IES VIRTUAL ENVIRONMENT VE 2023 COOLING ROOM PEAK Time of Peak (Mo/Hr:Mn)8 / 10:30 Outside Air (DBT/WBT/RH) °F and %RH 88.2 / 76.5 / 58.6 Room Room Net Per Floor Percent Sensible Latent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h Btu/h·ft²% External Walls -87 --87 --0.3 Roofs 0 -0 -0.0 Ground/Exposed Floors 0 -0 -0.0 External Doors 0 -0 -0.0 Windows Conduction 2,193 -2,193 -8.4 Skylights Conduction 0 -0 -0.0 Solar 11,373 -11,373 -43.4 Infiltration 1,497 3,197 4,693 -17.9 Nat/Aux Vent 0 0 0 -0.0 Internal Building Gains/Losses Internal Walls/Openings 8,018 -8,018 -30.6 Internal Floors 0 -0 -0.0 Internal Air & Furniture 0 -0 -0.0 Ceilings 0 -0 -0.0 Sub Total 22,994 3,197 26,191 0.0 Internal Gains Lights 0 -0 -0.0 People 0 0 0 -0.0 Misc, Computers, Equip 0 0 0 -0.0 Sub Total 0 0 0 0.0 TOTAL 22,994 3,197 26,191 0.0 100 COOLING SUMMARY Sensible cooling load (Btu/h):22,994 Latent cooling load (Btu/h):3,197 Sensible heat ratio:0.88 Design Supply Airflow calculated per:Sensible Loads Design zone air temp for Supply Airflow calculation (°F):82.0 HEATING ROOM PEAK Time of Peak (Mo/Hr:Mn)Heating Design Outside Air (DBT/WBT/RH) °F and %RH 42.1 / 35.4 / 49.6 Room Net Per Floor Percent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h·ft²% External Walls -2,511 -2,511 -- Roofs 0 0 -- Ground/Exposed Floors 0 0 -- External Doors 0 0 -- Windows Conduction -3,758 -3,758 -- Skylights Conduction 0 0 -- Solar 0 0 -- Infiltration -8,306 -8,306 -- Nat/Aux Vent 0 0 -- Internal Building Gains/Losses Internal Walls/Openings -4,826 -4,826 -- Internal Floors 0 0 -- Internal Air & Furniture 0 0 -- Ceilings 0 0 -- Sub Total -19,401 -19,401 0.0 Internal Gains Lights 0 0 -- People 0 0 -- Misc, Computers, Equip 0 0 -- Sub Total 0 0 0.0 TOTAL -19,401 -19,401 0.0 0 HEATING SUMMARY Sensible heating load (Btu/h):19,401 Design zone air temp for Supply Airflow calculation (°F):70.0 AREAS & THERMAL TRANSMITTANCE Total Area Glazing Glazing U-value1 ft²ft²%Btu/h·ft²·°F External Wall (above grade)1,451.2 434.7 30.0 0.15 Below Grade Walls ---- Windows2 434.7 434.7 100.0 0.30 Doors ---- Floors ---- Roofs3 ---- COMBINED 1,451.2 434.7 30.0 0.15 Internal Ceilings ---- Floors ---- Partitions4 3,412.3 --0.33 1 Area-weighted U-value; 2 Windows/glazing include glass and frames;3 Roofs incl. skylights; 4 Partitions incl. internal windows and doors. TEMPERATURES & SETPOINTS Cooling Heating °F °F Supply Air (design)55.0 90.0 Room Setpoint (design)82.0 70.0 Room (actual)82.0 70.0 Mean Radiant Temperature 83.4 68.6 Dry Resultant Temperature 82.7 69.3 RH (Design Max Setpoint) (%)-- AIRFLOW Cooling Heating cfm cfm Supply (design)5,439 5,439 Reheat Minimum (design)5,439 5,439 Leakage at Design Flow 0 0 Ventilation (requirement)5,439 5,439 Exhaust (requirement)4,079 4,079 Infiltration 272 272 CHECKS Number of People 0.00 ft²/Person - Average Ceiling Height (ft)14.09 Btu/h/ft² - Cooling (sensible)- Btu/h/ft² - Heating - ft²/ton - Cooling (sensible)- ft²/ton - Heating - cfm/ft² - Cooling - cfm/ft² - Heating - % Outside Air - Cooling 100.00 % Outside Air - Heating 100.00 Outdoor Air cfm/ft²- Outdoor Air cfm/person - Long Center Option1 Rooms loads rev1 | 2023/12/06 16:02 | Room Loads - Page 9 of 10 Document Page: 13 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Room Loads reports are not influenced by system operation. 1 Room Loads Report Zone: Dh-2 System: 05 a VAV - Reheat Long Center Option1 DH-2 Pool Area (upper 2) HVAC Methodology: ApacheHVAC IES VIRTUAL ENVIRONMENT VE 2023 COOLING ROOM PEAK Time of Peak (Mo/Hr:Mn)6 / 10:30 Outside Air (DBT/WBT/RH) °F and %RH 88.0 / 74.9 / 54.4 Room Room Net Per Floor Percent Sensible Latent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h Btu/h·ft²% External Walls 11 -11 -0.0 Roofs 6,567 -6,567 -22.9 Ground/Exposed Floors 0 -0 -0.0 External Doors 0 -0 -0.0 Windows Conduction 2,131 -2,131 -7.4 Skylights Conduction 0 -0 -0.0 Solar 15,280 -15,280 -53.3 Infiltration 1,401 1,457 2,858 -10.0 Nat/Aux Vent 0 0 0 -0.0 Internal Building Gains/Losses Internal Walls/Openings 1,817 -1,817 -6.3 Internal Floors 0 -0 -0.0 Internal Air & Furniture 0 -0 -0.0 Ceilings 0 -0 -0.0 Sub Total 27,207 1,457 28,664 0.0 Internal Gains Lights 0 -0 -0.0 People 0 0 0 -0.0 Misc, Computers, Equip 0 0 0 -0.0 Sub Total 0 0 0 0.0 TOTAL 27,207 1,457 28,664 0.0 100 COOLING SUMMARY Sensible cooling load (Btu/h):27,207 Latent cooling load (Btu/h):1,457 Sensible heat ratio:0.95 Design Supply Airflow calculated per:Sensible Loads Design zone air temp for Supply Airflow calculation (°F):82.0 HEATING ROOM PEAK Time of Peak (Mo/Hr:Mn)Heating Design Outside Air (DBT/WBT/RH) °F and %RH 42.1 / 35.4 / 49.6 Room Net Per Floor Percent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h·ft²% External Walls -2,540 -2,540 -- Roofs -8,271 -8,271 -- Ground/Exposed Floors 0 0 -- External Doors 0 0 -- Windows Conduction -3,693 -3,693 -- Skylights Conduction 0 0 -- Solar 0 0 -- Infiltration -8,306 -8,306 -- Nat/Aux Vent 0 0 -- Internal Building Gains/Losses Internal Walls/Openings -2,542 -2,542 -- Internal Floors 0 0 -- Internal Air & Furniture 0 0 -- Ceilings 0 0 -- Sub Total -25,352 -25,352 0.0 Internal Gains Lights 0 0 -- People 0 0 -- Misc, Computers, Equip 0 0 -- Sub Total 0 0 0.0 TOTAL -25,352 -25,352 0.0 0 HEATING SUMMARY Sensible heating load (Btu/h):25,352 Design zone air temp for Supply Airflow calculation (°F):70.0 AREAS & THERMAL TRANSMITTANCE Total Area Glazing Glazing U-value1 ft²ft²%Btu/h·ft²·°F External Wall (above grade)1,451.2 426.3 29.4 0.15 Below Grade Walls ---- Windows2 426.3 426.3 100.0 0.30 Doors ---- Floors ---- Roofs3 11,579.7 --0.02 COMBINED 13,030.9 426.3 3.3 0.04 Internal Ceilings ---- Floors ---- Partitions4 471.9 --0.33 1 Area-weighted U-value; 2 Windows/glazing include glass and frames;3 Roofs incl. skylights; 4 Partitions incl. internal windows and doors. TEMPERATURES & SETPOINTS Cooling Heating °F °F Supply Air (design)55.0 90.0 Room Setpoint (design)82.0 70.0 Room (actual)82.0 70.0 Mean Radiant Temperature 83.2 68.7 Dry Resultant Temperature 82.6 69.3 RH (Design Max Setpoint) (%)-- AIRFLOW Cooling Heating cfm cfm Supply (design)5,439 5,439 Reheat Minimum (design)5,439 5,439 Leakage at Design Flow 0 0 Ventilation (requirement)5,439 5,439 Exhaust (requirement)4,079 4,079 Infiltration 272 272 CHECKS Number of People 0.00 ft²/Person - Average Ceiling Height (ft)14.09 Btu/h/ft² - Cooling (sensible)- Btu/h/ft² - Heating - ft²/ton - Cooling (sensible)- ft²/ton - Heating - cfm/ft² - Cooling - cfm/ft² - Heating - % Outside Air - Cooling 100.00 % Outside Air - Heating 100.00 Outdoor Air cfm/ft²- Outdoor Air cfm/person - Long Center Option1 Rooms loads rev1 | 2023/12/06 16:02 | Room Loads - Page 10 of 10 Document Page: 14 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Room Loads reports are not influenced by system operation. 1 9942 Currie Davis Dr., Ste. H Tampa, FL 33619 813.995.0300 emeraldmep.com FL EB # 0027845 APPENDIX D Integrated Environmental Solutions 2023.2.1.0 Energy Model Output Report Project:Long Center Natatorium - Option2 Design Team:Wannemacher Jensen Architects, Address:1501 Belcher Rd. Clearwater FL 33765 Energy Analyst:REAL Building Conultants LLC Climate File:USA_FL_St.Petersburg-Clearwater.Intl.AP.722116_TMY3.epw Owner:City of Clearwater Simulation:Natatorium Option2_1206.aps Conditioned Area (ft²):34959.4935 Annual Energy Consumption (kBtu/ft²/year) & CO2 KgCO2/ft²/yr Project Viewer - 3D Model Energy End Use Site Energy Source Energy CO2 Emissions Heating Fossil Fuel 0.0 0.0 0.0 Heating Electricity 45.8 144.3 8.1 Space Cooling 23.2 73.1 4.1 Fans Interior 10.5 33.0 1.8 Heat Rejection 1.5 4.7 0.3 Pumps 0.0 0.0 0.0 DHW Fossil Fuel 0.0 0.0 0.0 DHW Electricity 0.0 0.0 0.0 Interior Lighting 4.8 15.0 0.8 Exterior Lighting 0.0 0.0 0.0 Receptacle 1.9 6.1 0.3 Data Center 0.0 0.0 0.0 Cooking Fossil Fuel 0.0 0.0 0.0 Cooking Electricity 0.0 0.0 0.0 Site Energy Use Intensity Elevators & Escalators 0.0 0.0 0.0 Refrigeration 0.0 0.0 0.0 Process 0.0 0.0 0.0 TOTAL (ex renewables)87 276 15 Site Energy Dashboard (MBtu) Site Energy Flows – Sankey Diagram Fuels End Uses Annual Fuel Costs and Peak Demands Fuels Cost (£)Peak Day Peak Time Peak Demand Electricity 53,900.00 24-Jan 8:00 446.6 kW Fossil Fuel 0.00 01-Jan 0:00 0.0 kBtu/h Total 53,900.00 01-Jan 0:00 Peak Energy Sources for Electricity (kW), Fossil Fuel (kBtu/h) and Onsite Power Generation (kW): Top 3 Contributors MonthSpace Heating (MBtu)Space Cooling (MBtu)Heat Rejection (MBtu)Interior Central Fans (MBtu)Total HVAC EnergyMonthNet electricity usage [kWh]Total net charges [$]Jan 01‐31 271.63 0.17 0.01 46.76 318.57January 99,295.70 10,426.05$ Feb 01‐28 160.31 7.70 0.49 34.56 203.06February 64,772.67 6,801.13$ Mar 01‐31 136.45 19.14 1.22 33.17 189.98March 61,360.73 6,442.88$ Apr 01‐30 86.62 43.11 2.75 26.64 159.11April 52,340.30 5,495.73$ May 01‐31 130.46 101.32 6.47 27.45 265.69May 83,683.48 8,786.77$ Jun 01‐30 132.97 118.73 7.58 26.65 285.93June 89,373.98 9,384.27$ Jul 01‐31 148.18 147.34 9.41 28.68 333.60July 103,702.98 10,888.81$ Aug 01‐31 140.20 133.98 8.55 27.55 310.27August 96,613.71 10,144.44$ Sep 01‐30 134.34 123.41 7.88 26.95 292.57September 91,453.55 9,602.62$ Oct 01‐31 108.49 84.81 5.41 27.80 226.51October 72,317.91 7,593.38$ Nov 01‐30 53.22 26.84 1.71 26.05 107.83November 37,059.60 3,891.26$ Dec 01‐31 98.67 5.02 0.32 33.96 137.96December 46,366.75 4,868.51$ Summed total 1,601.52 811.55 51.80 366.19 2,831.07Total year 898,341.38 94,325.85$ Option#2 Electricity ($0.105/kWh) blended rateOption#2 Energy Consumption HVACVirtual Environment 2023Copyright © 2023 Integrated Environmental Solutions Limited. Use global inputs for oversizing (yes/no):noCooling (Sensible) Load Oversizing Factor:10%Date:2023‐12‐06Cooling (Latent) Load Oversizing Factor:10%Heating Load Oversizing Factor:10%Loads reported below are non‐coincident room‐ and zone‐level loadsZone groupZoneRoomTemplateFloor area VolumeCooling occupied setpointCooling design load oversizing factorCooling design load with oversizing Cooling supply air temperatureMax RH setpointLatent cooling load without oversizingDesign latent cooling load with oversizingCooling design load oversizing factor from(ft²) (ft³) (⁰F) Month/time (kBtu/h) (Btu/h.ft²)(kBtu/h) (⁰F) (cfm)(ACH) (cfm/ft²) (%) (kBtu/h) (kBtu/h)(same for sens & lat)DH‐1DH‐129 DH ‐1 Pool area North CirculaSPACE: Corridor ‐ All Other Corridors1,853.3 53,109.4 82.0Jun 15:3074.80 40.36 1.10 82.28 55.0 2,785.7 3.15 1.50 60.0 3.13 3.44 1.1DH‐1 Pool AreaSPACE: Gymnasium/ Fitness center ‐ Exercise area10,647.6 106,238.4 82.0Jun 17:3062.96 5.91 1.10 69.26 55.0 2,344.8 1.32 0.22 55.0 344.65 379.11 1.1DH‐1 Pool Area (upper 1)SPACE: Corridor ‐ All Other Corridors10,647.6 150,037.4 82.0Jun 17:3026.05 2.45 1.10 28.65 55.0 970.1 0.39 0.09 60.0 9.86 10.84 1.1DH‐1 Pool Area (upper 2)SPACE: Corridor ‐ All Other Corridors10,647.6 150,037.4 82.0Jun 17:3034.95 3.28 1.10 38.44 55.0 1,301.5 0.52 0.12 60.0 10.62 11.68 1.1DH‐2 Dh‐2 23 Spectator AreaSPACE: Audience Seating Area ‐ Exercise Center9,175.0 191,146.9 82.0Sep 17:3053.81 5.86 1.10 59.19 55.0 2,003.7 0.63 0.22 60.0 14.00 15.40 1.130 VestibuleSPACE: Corridor ‐ All Other Corridors251.6 9,596.6 82.0Jul 7:303.30 13.13 1.00 3.30 55.0 111.8 0.70 0.44 60.0 0.70 0.70 1.131 VestibuleSPACE: Corridor ‐ All Other Corridors264.5 10,094.0 82.0Sep 11:3015.42 58.29 1.00 15.42 55.0 521.9 3.10 1.97 60.0 0.74 0.74 1.132 DH‐2 Pool Area CirculationSPACE: Corridor ‐ All Other Corridors1,187.8 44,412.8 82.0Jun 17:3021.39 18.01 1.00 21.39 55.0 724.1 0.98 0.61 60.0 3.25 3.25 1.1DH‐2 Pool AreaSPACE: Gymnasium/ Fitness center ‐ Exercise area11,579.7 115,538.8 82.0Aug 17:3080.45 6.95 1.00 80.45 55.0 2,723.8 1.41 0.24 55.0 377.47 377.47 1.1DH‐2 Pool Area (upper 1)SPACE: Corridor ‐ All Other Corridors11,579.7 163,172.2 82.0Aug 16:3022.24 1.92 1.00 22.24 55.0 753.0 0.28 0.07 60.0 11.95 11.95 1.1DH‐2 Pool Area (upper 2)SPACE: Corridor ‐ All Other Corridors11,579.7 163,172.2 82.0Jun 17:3027.90 2.41 1.00 27.90 55.0 944.4 0.35 0.08 60.0 11.50 11.50 1.1Zone group Zone Room Template Floor area VolumeHeating occupied setpointHeating design load oversizing factorHeating design load with oversizingHeating supply air temperatureMin RH setpointHumidification load(ft²) (ft³) (⁰F) (kBtu/h) (Btu/h.ft²)(kBtu/h)(⁰F)(cfm) (cfm/ft²) (%) (kBtu/h)DH‐1DH‐129 DH ‐1 Pool area North CirculaSPACE: Corridor ‐ All Other Corridors1,853.3 53,109.4 70.00 79.57 42.93 1.10 87.53 90.0 4,000.4 2.16 0.0 0.00DH‐1 Pool AreaSPACE: Gymnasium/ Fitness center ‐ Exercise area10,647.6 106,238.4 70.00 34.54 3.24 1.10 37.99 90.0 1,736.2 0.16 0.0 0.00DH‐1 Pool Area (upper 1)SPACE: Corridor ‐ All Other Corridors10,647.6 150,037.4 70.00 22.45 2.11 1.10 24.70 90.0 1,128.7 0.11 0.0 0.00DH‐1 Pool Area (upper 2)SPACE: Corridor ‐ All Other Corridors10,647.6 150,037.4 70.00 30.45 2.86 1.10 33.50 90.0 1,530.9 0.14 0.0 0.00DH‐2 Dh‐2 23 Spectator AreaSPACE: Audience Seating Area ‐ Exercise Center9,175.0 191,146.9 70.00 44.60 4.86 1.10 49.06 90.0 2,242.0 0.24 0.0 0.0030 VestibuleSPACE: Corridor ‐ All Other Corridors251.6 9,596.6 70.00 5.43 21.60 1.00 5.43 90.0 248.4 0.99 0.0 0.0031 VestibuleSPACE: Corridor ‐ All Other Corridors264.5 10,094.0 70.00 8.66 32.74 1.00 8.66 90.0 395.7 1.50 0.0 0.0032 DH‐2 Pool Area CirculationSPACE: Corridor ‐ All Other Corridors1,187.8 44,412.8 70.00 18.25 15.37 1.00 18.25 90.0 834.1 0.70 0.0 0.00DH‐2 Pool AreaSPACE: Gymnasium/ Fitness center ‐ Exercise area11,579.7 115,538.8 70.00 33.53 2.90 1.00 33.53 90.0 1,532.2 0.13 0.0 0.00DH‐2 Pool Area (upper 1)SPACE: Corridor ‐ All Other Corridors11,579.7 163,172.2 70.00 20.86 1.80 1.00 20.86 90.0 953.6 0.08 0.0 0.00DH‐2 Pool Area (upper 2)SPACE: Corridor ‐ All Other Corridors11,579.7 163,172.2 70.00 27.58 2.38 1.00 27.58 90.0 1,260.5 0.11 0.0 0.00Zone group Zone Room Template Floor area VolumeDesign occupancy(ft²) (ft³) (People) (cfm) (cfm/person) (cfm/ft²) (ACH)DH‐1DH‐129 DH ‐1 Pool area North CirculaSPACE: Corridor ‐ All Other Corridors1,853.3 53,109.4 0.0 111.2 0.0 0.06 0.13DH‐1 Pool AreaSPACE: Gymnasium/ Fitness center ‐ Exercise area10,647.6 106,238.4 25.0 1,138.9 45.6 0.11 0.64DH‐1 Pool Area (upper 1)SPACE: Corridor ‐ All Other Corridors10,647.6 150,037.4 0.0 0.0 0.0 0.00 0.00DH‐1 Pool Area (upper 2)SPACE: Corridor ‐ All Other Corridors10,647.6 150,037.4 0.0 0.0 0.0 0.00 0.00DH‐2 Dh‐2 23 Spectator AreaSPACE: Audience Seating Area ‐ Exercise Center9,175.0 191,146.9 10.0 625.5 62.6 0.07 0.2030 VestibuleSPACE: Corridor ‐ All Other Corridors251.6 9,596.6 0.0 15.1 0.0 0.06 0.0931 VestibuleSPACE: Corridor ‐ All Other Corridors264.5 10,094.0 0.0 15.9 0.0 0.06 0.0932 DH‐2 Pool Area CirculationSPACE: Corridor ‐ All Other Corridors1,187.8 44,412.8 0.0 71.3 0.0 0.06 0.10DH‐2 Pool AreaSPACE: Gymnasium/ Fitness center ‐ Exercise area11,579.7 115,538.8 25.0 1,194.8 47.8 0.10 0.62DH‐2 Pool Area (upper 1)SPACE: Corridor ‐ All Other Corridors11,579.7 163,172.2 0.0 0.0 0.0 0.00 0.00DH‐2 Pool Area (upper 2)SPACE: Corridor ‐ All Other Corridors11,579.7 163,172.2 0.0 0.0 0.0 0.00 0.00Heating load (without oversizing)Heating design airflow (maximum)Required minimum ventilation airflowSensible cooling load (without oversizing)Cooling design airflow (sensible cooling maximum) Table of Contents Room-Zone Loads & Sizing Reports Link to Report Guidance Long Center Option2 IES VIRTUAL ENVIRONMENT VE 2023 Project and Climate 2 Zone Conditioning Loads Reports DH-1 05 a VAV - Reheat [DX cool -...DH-1 3 DH-2 05 a VAV - Reheat [DX cool -...Dh-2 4 Room Conditioning Loads Reports DH-1 DH-1 29 DH -1 Pool area North...5 DH-1 Pool Area 6 DH-1 Pool Area (upper 1)7 DH-1 Pool Area (upper 2)8 DH-2 Dh-2 30 Vestibule 9 31 Vestibule 10 32 DH-2 Pool Area...11 DH-2 Pool Area 12 DH-2 Pool Area (upper 1)13 DH-2 Pool Area (upper 2)14 Long Center Option2rev1 rooms loads | 2023/12/06 10:06 | Table of Contents - Page 1 of 1 Document Page: 1 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Table of Contents reports are not influenced by system operation. 1 Project and Climate Long Center Option2 IES VIRTUAL ENVIRONMENT VE 2023 Model Data Project file Long Center Option2.mit Source HVAC file Natatorium_Option2_HVAC.asp HVAC file snapshot Vista\Long Center Option2rev1 rooms loads.asp Model floor area 34,959.5 ft² Building conditioned floor area 34,959.5 ft² Building conditioned volume 1,156,556.0 ft³ Number of conditioned rooms 11 Load analysis methodology ASHRAE Heat Balance Method Calculated 2023/12/06 10:06 Version No.2023.2.1.0 Location Data Location St Pete-Clearwater, Florida Latitude 27.91 N Longitude 82.69 W Altitude 9.8 ft Time Zone 5.0 hours behind GMT Design Weather Data Source ASHRAE design weather database Monthly percentile: For heating loads design weather 99.60 % For cooling loads design weather 0.40 % Barometric pressure 29.9109 inHg Air density 0.0749 lb/ft³ Air specific heat 0.2434 Btu/lb·°F Density-specific heat product 0.0591 Btu/ft³·°F Summer ground reflectance 0.2 Winter ground reflectance 0.2 Carbon dioxide (ambient)400.00 ppm Cooling Calculation Data Results file Long Center Option2rev1 rooms loads.clg Calculated 2023/12/06 10:06 Profile Month May - Sep Max outdoor temp. dry bulb 93.7 °F Max outdoor temp. wet bulb 78.4 °F Heating Calculation Data Results file Long Center Option2rev1 rooms loads.htg Calculated 2023/12/06 10:06 Profile Month Jan Outdoor winter design temp 42.1 °F Project Loads Summary Cooling loads:kBtu/h Btu/h·ft² Coincident peak space load 404.28 11.56 Heating loads: Coincident peak space load 325.92 9.32 Long Center Option2rev1 rooms loads | 2023/12/06 10:06 | Project and climate - Page 1 of 1 Document Page: 2 Project Cooling and Heating loads are coincident peak value for all conditioned spaces without oversizing. 1 Zone Loads Report System: 05 a VAV - Reheat Long Center Option2 DH-1 IES VIRTUAL ENVIRONMENT VE 2023 COOLING ZONE PEAK Time of Peak (Mo/Hr:Mn)6 / 16:30 Outside Air (DBT/WBT/RH) °F and %RH 92.8 / 76.7 / 48.0 Zone Zone Net Per Floor Percent Sensible Latent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h Btu/h·ft²% External Walls 8,161 -8,161 0.7 1.5 Roofs 1,004 -1,004 0.1 0.2 Ground/Exposed Floors -7,333 --7,333 -0.6 -1.4 External Doors 0 -0 0.0 0.0 Windows Conduction 42,829 -42,829 3.4 7.9 Skylights Conduction 0 -0 0.0 0.0 Solar 122,109 -122,109 9.8 22.6 Infiltration 9,454 7,198 16,652 1.3 3.1 Nat/Aux Vent 0 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings -2,435 --2,435 -0.2 -0.5 Internal Floors -3,242 --3,242 -0.3 -0.6 Internal Air & Furniture 0 -0 0.0 0.0 Ceilings 0 -0 0.0 0.0 Sub Total 170,549 7,198 177,747 14.2 Internal Gains Lights 3,162 -3,162 0.3 0.6 People 17,750 27,250 45,000 3.6 8.3 Misc, Computers, Equip 1,265 313,755 315,020 25.2 58.2 Sub Total 22,177 341,005 363,182 29.1 TOTAL 192,726 348,203 540,929 43.3 100 COOLING SUMMARY Sensible cooling load (Btu/h):192,726 Latent cooling load (Btu/h):348,203 Sensible heat ratio:0.36 Design Supply Airflow calculated per:Sensible Loads Design zone air temp for Supply Airflow calculation (°F):82.0 HEATING ZONE PEAK Time of Peak (Mo/Hr:Mn)Heating Design Outside Air (DBT/WBT/RH) °F and %RH 42.1 / 35.4 / 49.6 Zone Net Per Floor Percent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h·ft²% External Walls -20,668 -20,668 -1.7 12.4 Roofs -8,630 -8,630 -0.7 5.2 Ground/Exposed Floors -16,223 -16,223 -1.3 9.7 External Doors 0 0 0.0 0.0 Windows Conduction -84,847 -84,847 -6.8 50.8 Skylights Conduction 0 0 0.0 0.0 Solar 0 0 0.0 0.0 Infiltration -23,387 -23,387 -1.9 14.0 Nat/Aux Vent 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings 1,070 1,070 0.1 -0.6 Internal Floors -14,326 -14,326 -1.1 8.6 Internal Air & Furniture 0 0 0.0 0.0 Ceilings 0 0 0.0 0.0 Sub Total -167,010 -167,010 -13.4 Internal Gains Lights 0 0 0.0 0.0 People 0 0 0.0 0.0 Misc, Computers, Equip 0 0 0.0 0.0 Sub Total 0 0 0.0 TOTAL -167,010 -167,010 -13.4 100 HEATING SUMMARY Sensible heating load (Btu/h):167,010 Design zone air temp for Supply Airflow calculation (°F):70.0 AREAS & THERMAL TRANSMITTANCE Total Area Glazing Glazing U-value1 ft²ft²%Btu/h·ft²·°F External Wall (above grade)15,437.1 6,450.5 41.8 0.26 Below Grade Walls ---- Windows2 6,450.5 6,450.5 100.0 0.51 Doors ---- Floors 6,979.8 --0.09 Roofs3 12,392.2 --0.02 COMBINED 34,809.1 6,450.5 18.5 0.14 Internal Ceilings ---- Floors 5,521.2 --0.19 Partitions4 8,912.8 --0.33 1 Area-weighted U-value; 2 Windows/glazing include glass and frames;3 Roofs incl. skylights; 4 Partitions incl. internal windows and doors. TEMPERATURES & SETPOINTS Cooling Heating °F °F Supply Air (design)55.0 80.0 Master Room Setpoint (design)82.0 70.0 Master Room (actual)82.0 70.0 Mean Radiant Temperature 180.0 163.4 Dry Resultant Temperature 179.0 164.7 RH (Design Max Setpoint) (%)-- AIRFLOW Cooling Heating cfm cfm Supply (design)20,626 25,086 Reheat Minimum (design)20,626 20,626 Leakage at Design Flow 0 0 Ventilation (requirement)20,626 20,626 Exhaust (requirement)15,469 15,469 Infiltration 766 766 CHECKS Number of People 25.00 ft²/Person 500.04 Average Ceiling Height (ft)18.38 Btu/h/ft² - Cooling (sensible)15.42 Btu/h/ft² - Heating 13.36 ft²/ton - Cooling (sensible)778.36 ft²/ton - Heating 898.22 cfm/ft² - Cooling 1.65 cfm/ft² - Heating 2.01 % Outside Air - Cooling 100.00 % Outside Air - Heating 82.22 Outdoor Air cfm/ft²1.65 Outdoor Air cfm/person 825.03 Long Center Option2rev1 rooms loads | 2023/12/06 10:06 | Zone Loads - Page 1 of 2 Document Page: 3 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Zone Loads reports are not influenced by system operation. 1 Zone Loads Report System: 05 a VAV - Reheat Long Center Option2 Dh-2 IES VIRTUAL ENVIRONMENT VE 2023 COOLING ZONE PEAK Time of Peak (Mo/Hr:Mn)8 / 17:30 Outside Air (DBT/WBT/RH) °F and %RH 91.6 / 77.7 / 53.8 Zone Zone Net Per Floor Percent Sensible Latent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h Btu/h·ft²% External Walls 10,304 -10,304 0.5 1.9 Roofs 8,006 -8,006 0.4 1.5 Ground/Exposed Floors -1,809 --1,809 -0.1 -0.3 External Doors 0 -0 0.0 0.0 Windows Conduction 9,570 -9,570 0.4 1.8 Skylights Conduction 0 -0 0.0 0.0 Solar 67,010 -67,010 3.0 12.4 Infiltration 9,369 13,055 22,425 1.0 4.1 Nat/Aux Vent 0 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings 683 -683 0.0 0.1 Internal Floors -756 --756 0.0 -0.1 Internal Air & Furniture 0 -0 0.0 0.0 Ceilings 0 -0 0.0 0.0 Sub Total 102,378 13,055 115,433 5.1 Internal Gains Lights 38,467 -38,467 1.7 7.1 People 17,750 27,250 45,000 2.0 8.3 Misc, Computers, Equip 1,163 341,222 342,385 15.2 63.3 Sub Total 57,380 368,472 425,852 19.0 TOTAL 159,758 381,528 541,285 24.1 100 COOLING SUMMARY Sensible cooling load (Btu/h):159,758 Latent cooling load (Btu/h):381,528 Sensible heat ratio:0.30 Design Supply Airflow calculated per:Sensible Loads Design zone air temp for Supply Airflow calculation (°F):82.0 HEATING ZONE PEAK Time of Peak (Mo/Hr:Mn)Heating Design Outside Air (DBT/WBT/RH) °F and %RH 42.1 / 35.4 / 49.6 Zone Net Per Floor Percent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h·ft²% External Walls -20,288 -20,288 -0.9 17.7 Roofs -9,431 -9,431 -0.4 8.3 Ground/Exposed Floors -15,510 -15,510 -0.7 13.6 External Doors 0 0 0.0 0.0 Windows Conduction -24,461 -24,461 -1.1 21.4 Skylights Conduction 0 0 0.0 0.0 Solar 0 0 0.0 0.0 Infiltration -25,758 -25,758 -1.1 22.5 Nat/Aux Vent 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings 117 117 0.0 -0.1 Internal Floors -18,985 -18,985 -0.8 16.6 Internal Air & Furniture 0 0 0.0 0.0 Ceilings 0 0 0.0 0.0 Sub Total -114,315 -114,315 -5.1 Internal Gains Lights 0 0 0.0 0.0 People 0 0 0.0 0.0 Misc, Computers, Equip 0 0 0.0 0.0 Sub Total 0 0 0.0 TOTAL -114,315 -114,315 -5.1 100 HEATING SUMMARY Sensible heating load (Btu/h):114,315 Design zone air temp for Supply Airflow calculation (°F):70.0 AREAS & THERMAL TRANSMITTANCE Total Area Glazing Glazing U-value1 ft²ft²%Btu/h·ft²·°F External Wall (above grade)16,317.1 1,903.5 11.7 0.13 Below Grade Walls ---- Windows2 1,903.5 1,903.5 100.0 0.46 Doors ---- Floors 15,266.9 --0.07 Roofs3 22,414.2 --0.02 COMBINED 53,998.2 1,903.5 3.5 0.07 Internal Ceilings 22.0 --0.05 Floors 7,169.6 --0.19 Partitions4 11,907.3 --0.33 1 Area-weighted U-value; 2 Windows/glazing include glass and frames;3 Roofs incl. skylights; 4 Partitions incl. internal windows and doors. TEMPERATURES & SETPOINTS Cooling Heating °F °F Supply Air (design)55.0 90.0 Master Room Setpoint (design)82.0 70.0 Master Room (actual)82.0 70.0 Mean Radiant Temperature 229.4 218.4 Dry Resultant Temperature 228.8 219.0 RH (Design Max Setpoint) (%)60.0 60.0 AIRFLOW Cooling Heating cfm cfm Supply (design)22,175 22,186 Reheat Minimum (design)21,773 21,773 Leakage at Design Flow 0 0 Ventilation (requirement)21,580 21,580 Exhaust (requirement)13,490 13,490 Infiltration 843 843 CHECKS Number of People 25.00 ft²/Person 531.34 Average Ceiling Height (ft)24.67 Btu/h/ft² - Cooling (sensible)12.03 Btu/h/ft² - Heating 8.61 ft²/ton - Cooling (sensible)997.77 ft²/ton - Heating 1,394.42 cfm/ft² - Cooling 1.67 cfm/ft² - Heating 1.67 % Outside Air - Cooling 97.32 % Outside Air - Heating 97.27 Outdoor Air cfm/ft²1.62 Outdoor Air cfm/person 863.21 Long Center Option2rev1 rooms loads | 2023/12/06 10:06 | Zone Loads - Page 2 of 2 Document Page: 4 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Zone Loads reports are not influenced by system operation. 1 Room Loads Report Zone: DH-1 System: 05 a VAV - Reheat Long Center Option2 29 DH -1 Pool area North Circulation HVAC Methodology: ApacheHVAC IES VIRTUAL ENVIRONMENT VE 2023 COOLING ROOM PEAK Time of Peak (Mo/Hr:Mn)6 / 15:30 Outside Air (DBT/WBT/RH) °F and %RH 93.7 / 77.0 / 47.0 Room Room Net Per Floor Percent Sensible Latent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h Btu/h·ft²% External Walls 2,816 -2,816 1.5 3.7 Roofs -2,009 --2,009 -1.1 -2.7 Ground/Exposed Floors -2,820 --2,820 -1.5 -3.7 External Doors 0 -0 0.0 0.0 Windows Conduction 39,780 -39,780 21.5 52.7 Skylights Conduction 0 -0 0.0 0.0 Solar 42,910 -42,910 23.2 56.8 Infiltration 1,137 735 1,872 1.0 2.5 Nat/Aux Vent 0 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings -11,428 --11,428 -6.2 -15.1 Internal Floors 0 -0 0.0 0.0 Internal Air & Furniture 0 -0 0.0 0.0 Ceilings 0 -0 0.0 0.0 Sub Total 70,387 735 71,122 38.4 Internal Gains Lights 3,162 -3,162 1.7 4.2 People 0 0 0 0.0 0.0 Misc, Computers, Equip 1,265 0 1,265 0.7 1.7 Sub Total 4,427 0 4,427 2.4 TOTAL 74,814 735 75,549 40.8 100 COOLING SUMMARY Sensible cooling load (Btu/h):74,814 Latent cooling load (Btu/h):735 Sensible heat ratio:0.99 Design Supply Airflow calculated per:Sensible Loads Design zone air temp for Supply Airflow calculation (°F):82.0 HEATING ROOM PEAK Time of Peak (Mo/Hr:Mn)Heating Design Outside Air (DBT/WBT/RH) °F and %RH 42.1 / 35.4 / 49.6 Room Net Per Floor Percent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h·ft²% External Walls -14,960 -14,960 -8.1 18.8 Roofs -1,113 -1,113 -0.6 1.4 Ground/Exposed Floors -9,198 -9,198 -5.0 11.6 External Doors 0 0 0.0 0.0 Windows Conduction -68,796 -68,796 -37.1 86.5 Skylights Conduction 0 0 0.0 0.0 Solar 0 0 0.0 0.0 Infiltration -2,704 -2,704 -1.5 3.4 Nat/Aux Vent 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings 17,198 17,198 9.3 -21.6 Internal Floors 0 0 0.0 0.0 Internal Air & Furniture 0 0 0.0 0.0 Ceilings 0 0 0.0 0.0 Sub Total -79,571 -79,571 -42.9 Internal Gains Lights 0 0 0.0 0.0 People 0 0 0.0 0.0 Misc, Computers, Equip 0 0 0.0 0.0 Sub Total 0 0 0.0 TOTAL -79,571 -79,571 -42.9 100 HEATING SUMMARY Sensible heating load (Btu/h):79,571 Design zone air temp for Supply Airflow calculation (°F):70.0 AREAS & THERMAL TRANSMITTANCE Total Area Glazing Glazing U-value1 ft²ft²%Btu/h·ft²·°F External Wall (above grade)11,823.4 5,125.7 43.4 0.28 Below Grade Walls ---- Windows2 5,125.7 5,125.7 100.0 0.53 Doors ---- Floors 1,853.3 --0.19 Roofs3 1,744.7 --0.02 COMBINED 15,421.4 5,125.7 33.2 0.24 Internal Ceilings ---- Floors ---- Partitions4 331.4 --0.33 1 Area-weighted U-value; 2 Windows/glazing include glass and frames;3 Roofs incl. skylights; 4 Partitions incl. internal windows and doors. TEMPERATURES & SETPOINTS Cooling Heating °F °F Supply Air (design)55.0 80.0 Room Setpoint (design)82.0 70.0 Room (actual)82.0 70.0 Mean Radiant Temperature 86.1 64.0 Dry Resultant Temperature 84.0 67.0 RH (Design Max Setpoint) (%)60.0 60.0 AIRFLOW Cooling Heating cfm cfm Supply (design)3,541 8,001 Reheat Minimum (design)3,541 3,541 Leakage at Design Flow 0 0 Ventilation (requirement)3,541 3,541 Exhaust (requirement)1,770 1,770 Infiltration 89 89 CHECKS Number of People 0.00 ft²/Person - Average Ceiling Height (ft)35.37 Btu/h/ft² - Cooling (sensible)40.37 Btu/h/ft² - Heating 42.93 ft²/ton - Cooling (sensible)297.27 ft²/ton - Heating 279.50 cfm/ft² - Cooling 1.91 cfm/ft² - Heating 4.32 % Outside Air - Cooling 100.00 % Outside Air - Heating 44.25 Outdoor Air cfm/ft²1.91 Outdoor Air cfm/person - Long Center Option2rev1 rooms loads | 2023/12/06 10:06 | Room Loads - Page 1 of 10 Document Page: 5 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Room Loads reports are not influenced by system operation. 1 Room Loads Report Zone: DH-1 System: 05 a VAV - Reheat Long Center Option2 DH-1 Pool Area HVAC Methodology: ApacheHVAC IES VIRTUAL ENVIRONMENT VE 2023 COOLING ROOM PEAK Time of Peak (Mo/Hr:Mn)6 / 17:30 Outside Air (DBT/WBT/RH) °F and %RH 91.6 / 76.2 / 49.5 Room Room Net Per Floor Percent Sensible Latent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h Btu/h·ft²% External Walls 773 -773 0.1 0.2 Roofs 0 -0 0.0 0.0 Ground/Exposed Floors -5,262 --5,262 -0.5 -1.3 External Doors 0 -0 0.0 0.0 Windows Conduction 1,762 -1,762 0.2 0.4 Skylights Conduction 0 -0 0.0 0.0 Solar 53,747 -53,747 5.0 13.2 Infiltration 1,981 2,349 4,330 0.4 1.1 Nat/Aux Vent 0 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings -4,784 --4,784 -0.4 -1.2 Internal Floors -3,010 --3,010 -0.3 -0.7 Internal Air & Furniture 0 -0 0.0 0.0 Ceilings 0 -0 0.0 0.0 Sub Total 45,206 2,349 47,555 4.5 Internal Gains Lights 0 -0 0.0 0.0 People 17,750 27,250 45,000 4.2 11.1 Misc, Computers, Equip 0 313,755 313,755 29.5 77.2 Sub Total 17,750 341,005 358,755 33.7 TOTAL 62,956 343,354 406,310 38.2 100 COOLING SUMMARY Sensible cooling load (Btu/h):62,956 Latent cooling load (Btu/h):343,354 Sensible heat ratio:0.15 Design Supply Airflow calculated per:Sensible Loads Design zone air temp for Supply Airflow calculation (°F):82.0 HEATING ROOM PEAK Time of Peak (Mo/Hr:Mn)Heating Design Outside Air (DBT/WBT/RH) °F and %RH 42.1 / 35.4 / 49.6 Room Net Per Floor Percent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h·ft²% External Walls -1,520 -1,520 -0.1 4.4 Roofs 0 0 0.0 0.0 Ground/Exposed Floors -7,025 -7,025 -0.7 20.3 External Doors 0 0 0.0 0.0 Windows Conduction -4,411 -4,411 -0.4 12.8 Skylights Conduction 0 0 0.0 0.0 Solar 0 0 0.0 0.0 Infiltration -5,408 -5,408 -0.5 15.7 Nat/Aux Vent 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings -1,846 -1,846 -0.2 5.3 Internal Floors -14,326 -14,326 -1.3 41.5 Internal Air & Furniture 0 0 0.0 0.0 Ceilings 0 0 0.0 0.0 Sub Total -34,536 -34,536 -3.2 Internal Gains Lights 0 0 0.0 0.0 People 0 0 0.0 0.0 Misc, Computers, Equip 0 0 0.0 0.0 Sub Total 0 0 0.0 TOTAL -34,536 -34,536 -3.2 100 HEATING SUMMARY Sensible heating load (Btu/h):34,536 Design zone air temp for Supply Airflow calculation (°F):70.0 AREAS & THERMAL TRANSMITTANCE Total Area Glazing Glazing U-value1 ft²ft²%Btu/h·ft²·°F External Wall (above grade)944.8 330.4 35.0 0.22 Below Grade Walls ---- Windows2 330.4 330.4 100.0 0.47 Doors ---- Floors 5,126.4 --0.05 Roofs3 ---- COMBINED 6,071.3 330.4 5.4 0.08 Internal Ceilings ---- Floors 5,521.2 --0.19 Partitions4 2,270.4 --0.33 1 Area-weighted U-value; 2 Windows/glazing include glass and frames;3 Roofs incl. skylights; 4 Partitions incl. internal windows and doors. TEMPERATURES & SETPOINTS Cooling Heating °F °F Supply Air (design)55.0 80.0 Room Setpoint (design)82.0 70.0 Room (actual)82.0 70.0 Mean Radiant Temperature 84.5 67.5 Dry Resultant Temperature 83.2 68.7 RH (Design Max Setpoint) (%)-- AIRFLOW Cooling Heating cfm cfm Supply (design)7,083 7,083 Reheat Minimum (design)7,083 7,083 Leakage at Design Flow 0 0 Ventilation (requirement)7,083 7,083 Exhaust (requirement)6,197 6,197 Infiltration 177 177 CHECKS Number of People 25.00 ft²/Person 425.90 Average Ceiling Height (ft)9.98 Btu/h/ft² - Cooling (sensible)5.91 Btu/h/ft² - Heating 3.24 ft²/ton - Cooling (sensible)2,029.53 ft²/ton - Heating 3,699.60 cfm/ft² - Cooling 0.67 cfm/ft² - Heating 0.67 % Outside Air - Cooling 100.00 % Outside Air - Heating 100.00 Outdoor Air cfm/ft²0.67 Outdoor Air cfm/person 283.30 Long Center Option2rev1 rooms loads | 2023/12/06 10:06 | Room Loads - Page 2 of 10 Document Page: 6 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Room Loads reports are not influenced by system operation. 1 Room Loads Report Zone: DH-1 System: 05 a VAV - Reheat Long Center Option2 DH-1 Pool Area (upper 1) HVAC Methodology: ApacheHVAC IES VIRTUAL ENVIRONMENT VE 2023 COOLING ROOM PEAK Time of Peak (Mo/Hr:Mn)6 / 17:30 Outside Air (DBT/WBT/RH) °F and %RH 91.6 / 76.2 / 49.5 Room Room Net Per Floor Percent Sensible Latent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h Btu/h·ft²% External Walls 1,234 -1,234 -4.4 Roofs 0 -0 -0.0 Ground/Exposed Floors 0 -0 -0.0 External Doors 0 -0 -0.0 Windows Conduction 2,546 -2,546 -9.1 Skylights Conduction 0 -0 -0.0 Solar 11,957 -11,957 -42.8 Infiltration 2,798 1,905 4,703 -16.8 Nat/Aux Vent 0 0 0 -0.0 Internal Building Gains/Losses Internal Walls/Openings 7,503 -7,503 -26.9 Internal Floors 0 -0 -0.0 Internal Air & Furniture 0 -0 -0.0 Ceilings 0 -0 -0.0 Sub Total 26,038 1,905 27,942 0.0 Internal Gains Lights 0 -0 -0.0 People 0 0 0 -0.0 Misc, Computers, Equip 0 0 0 -0.0 Sub Total 0 0 0 0.0 TOTAL 26,038 1,905 27,942 0.0 100 COOLING SUMMARY Sensible cooling load (Btu/h):26,038 Latent cooling load (Btu/h):1,905 Sensible heat ratio:0.93 Design Supply Airflow calculated per:Sensible Loads Design zone air temp for Supply Airflow calculation (°F):82.0 HEATING ROOM PEAK Time of Peak (Mo/Hr:Mn)Heating Design Outside Air (DBT/WBT/RH) °F and %RH 42.1 / 35.4 / 49.6 Room Net Per Floor Percent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h·ft²% External Walls -2,107 -2,107 -- Roofs 0 0 -- Ground/Exposed Floors 0 0 -- External Doors 0 0 -- Windows Conduction -6,022 -6,022 -- Skylights Conduction 0 0 -- Solar 0 0 -- Infiltration -7,638 -7,638 -- Nat/Aux Vent 0 0 -- Internal Building Gains/Losses Internal Walls/Openings -6,684 -6,684 -- Internal Floors 0 0 -- Internal Air & Furniture 0 0 -- Ceilings 0 0 -- Sub Total -22,452 -22,452 0.0 Internal Gains Lights 0 0 -- People 0 0 -- Misc, Computers, Equip 0 0 -- Sub Total 0 0 0.0 TOTAL -22,452 -22,452 0.0 0 HEATING SUMMARY Sensible heating load (Btu/h):22,452 Design zone air temp for Supply Airflow calculation (°F):70.0 AREAS & THERMAL TRANSMITTANCE Total Area Glazing Glazing U-value1 ft²ft²%Btu/h·ft²·°F External Wall (above grade)1,334.4 489.6 36.7 0.21 Below Grade Walls ---- Windows2 489.6 489.6 100.0 0.43 Doors ---- Floors ---- Roofs3 ---- COMBINED 1,334.4 489.6 36.7 0.21 Internal Ceilings ---- Floors ---- Partitions4 3,206.4 --0.33 1 Area-weighted U-value; 2 Windows/glazing include glass and frames;3 Roofs incl. skylights; 4 Partitions incl. internal windows and doors. TEMPERATURES & SETPOINTS Cooling Heating °F °F Supply Air (design)55.0 80.0 Room Setpoint (design)82.0 70.0 Room (actual)82.0 70.0 Mean Radiant Temperature 83.6 67.9 Dry Resultant Temperature 82.8 68.9 RH (Design Max Setpoint) (%)-- AIRFLOW Cooling Heating cfm cfm Supply (design)5,001 5,001 Reheat Minimum (design)5,001 5,001 Leakage at Design Flow 0 0 Ventilation (requirement)5,001 5,001 Exhaust (requirement)3,751 3,751 Infiltration 250 250 CHECKS Number of People 0.00 ft²/Person - Average Ceiling Height (ft)14.09 Btu/h/ft² - Cooling (sensible)- Btu/h/ft² - Heating - ft²/ton - Cooling (sensible)- ft²/ton - Heating - cfm/ft² - Cooling - cfm/ft² - Heating - % Outside Air - Cooling 100.00 % Outside Air - Heating 100.00 Outdoor Air cfm/ft²- Outdoor Air cfm/person - Long Center Option2rev1 rooms loads | 2023/12/06 10:06 | Room Loads - Page 3 of 10 Document Page: 7 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Room Loads reports are not influenced by system operation. 1 Room Loads Report Zone: DH-1 System: 05 a VAV - Reheat Long Center Option2 DH-1 Pool Area (upper 2) HVAC Methodology: ApacheHVAC IES VIRTUAL ENVIRONMENT VE 2023 COOLING ROOM PEAK Time of Peak (Mo/Hr:Mn)6 / 17:30 Outside Air (DBT/WBT/RH) °F and %RH 91.6 / 76.2 / 49.5 Room Room Net Per Floor Percent Sensible Latent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h Btu/h·ft²% External Walls 1,255 -1,255 -3.4 Roofs 3,830 -3,830 -10.4 Ground/Exposed Floors 0 -0 -0.0 External Doors 0 -0 -0.0 Windows Conduction 2,453 -2,453 -6.7 Skylights Conduction 0 -0 -0.0 Solar 21,162 -21,162 -57.4 Infiltration 2,798 1,905 4,703 -12.8 Nat/Aux Vent 0 0 0 -0.0 Internal Building Gains/Losses Internal Walls/Openings 3,439 -3,439 -9.3 Internal Floors 0 -0 -0.0 Internal Air & Furniture 0 -0 -0.0 Ceilings 0 -0 -0.0 Sub Total 34,936 1,905 36,841 0.0 Internal Gains Lights 0 -0 -0.0 People 0 0 0 -0.0 Misc, Computers, Equip 0 0 0 -0.0 Sub Total 0 0 0 0.0 TOTAL 34,936 1,905 36,841 0.0 100 COOLING SUMMARY Sensible cooling load (Btu/h):34,936 Latent cooling load (Btu/h):1,905 Sensible heat ratio:0.95 Design Supply Airflow calculated per:Sensible Loads Design zone air temp for Supply Airflow calculation (°F):82.0 HEATING ROOM PEAK Time of Peak (Mo/Hr:Mn)Heating Design Outside Air (DBT/WBT/RH) °F and %RH 42.1 / 35.4 / 49.6 Room Net Per Floor Percent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h·ft²% External Walls -2,080 -2,080 -- Roofs -7,518 -7,518 -- Ground/Exposed Floors 0 0 -- External Doors 0 0 -- Windows Conduction -5,617 -5,617 -- Skylights Conduction 0 0 -- Solar 0 0 -- Infiltration -7,638 -7,638 -- Nat/Aux Vent 0 0 -- Internal Building Gains/Losses Internal Walls/Openings -7,598 -7,598 -- Internal Floors 0 0 -- Internal Air & Furniture 0 0 -- Ceilings 0 0 -- Sub Total -30,451 -30,451 0.0 Internal Gains Lights 0 0 -- People 0 0 -- Misc, Computers, Equip 0 0 -- Sub Total 0 0 0.0 TOTAL -30,451 -30,451 0.0 0 HEATING SUMMARY Sensible heating load (Btu/h):30,451 Design zone air temp for Supply Airflow calculation (°F):70.0 AREAS & THERMAL TRANSMITTANCE Total Area Glazing Glazing U-value1 ft²ft²%Btu/h·ft²·°F External Wall (above grade)1,334.4 504.9 37.8 0.20 Below Grade Walls ---- Windows2 504.9 504.9 100.0 0.39 Doors ---- Floors ---- Roofs3 10,647.6 --0.02 COMBINED 11,982.0 504.9 4.2 0.04 Internal Ceilings ---- Floors ---- Partitions4 3,436.0 --0.33 1 Area-weighted U-value; 2 Windows/glazing include glass and frames;3 Roofs incl. skylights; 4 Partitions incl. internal windows and doors. TEMPERATURES & SETPOINTS Cooling Heating °F °F Supply Air (design)55.0 80.0 Room Setpoint (design)82.0 70.0 Room (actual)82.0 70.0 Mean Radiant Temperature 83.5 68.1 Dry Resultant Temperature 82.8 69.0 RH (Design Max Setpoint) (%)-- AIRFLOW Cooling Heating cfm cfm Supply (design)5,001 5,001 Reheat Minimum (design)5,001 5,001 Leakage at Design Flow 0 0 Ventilation (requirement)5,001 5,001 Exhaust (requirement)3,751 3,751 Infiltration 250 250 CHECKS Number of People 0.00 ft²/Person - Average Ceiling Height (ft)14.09 Btu/h/ft² - Cooling (sensible)- Btu/h/ft² - Heating - ft²/ton - Cooling (sensible)- ft²/ton - Heating - cfm/ft² - Cooling - cfm/ft² - Heating - % Outside Air - Cooling 100.00 % Outside Air - Heating 100.00 Outdoor Air cfm/ft²- Outdoor Air cfm/person - Long Center Option2rev1 rooms loads | 2023/12/06 10:06 | Room Loads - Page 4 of 10 Document Page: 8 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Room Loads reports are not influenced by system operation. 1 Room Loads Report Zone: Dh-2 System: 05 a VAV - Reheat Long Center Option2 30 Vestibule HVAC Methodology: ApacheHVAC IES VIRTUAL ENVIRONMENT VE 2023 COOLING ROOM PEAK Time of Peak (Mo/Hr:Mn)7 / 7:30 Outside Air (DBT/WBT/RH) °F and %RH 80.6 / 72.6 / 68.4 Room Room Net Per Floor Percent Sensible Latent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h Btu/h·ft²% External Walls 1,354 -1,354 5.4 40.1 Roofs 457 -457 1.8 13.5 Ground/Exposed Floors 368 -368 1.5 10.9 External Doors 0 -0 0.0 0.0 Windows Conduction 0 -0 0.0 0.0 Skylights Conduction 0 -0 0.0 0.0 Solar 0 -0 0.0 0.0 Infiltration -34 77 43 0.2 1.3 Nat/Aux Vent 0 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings 461 -461 1.8 13.6 Internal Floors 0 -0 0.0 0.0 Internal Air & Furniture 96 -96 0.4 2.8 Ceilings 0 -0 0.0 0.0 Sub Total 2,702 77 2,779 11.0 Internal Gains Lights 429 -429 1.7 12.7 People 0 0 0 0.0 0.0 Misc, Computers, Equip 172 0 172 0.7 5.1 Sub Total 601 0 601 2.4 TOTAL 3,303 77 3,380 13.4 100 COOLING SUMMARY Sensible cooling load (Btu/h):3,303 Latent cooling load (Btu/h):77 Sensible heat ratio:0.98 Design Supply Airflow calculated per:Sensible Loads Design zone air temp for Supply Airflow calculation (°F):82.0 HEATING ROOM PEAK Time of Peak (Mo/Hr:Mn)Heating Design Outside Air (DBT/WBT/RH) °F and %RH 42.1 / 35.4 / 49.6 Room Net Per Floor Percent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h·ft²% External Walls -3,536 -3,536 -14.1 65.1 Roofs -176 -176 -0.7 3.2 Ground/Exposed Floors -1,339 -1,339 -5.3 24.6 External Doors 0 0 0.0 0.0 Windows Conduction 0 0 0.0 0.0 Skylights Conduction 0 0 0.0 0.0 Solar 0 0 0.0 0.0 Infiltration -489 -489 -1.9 9.0 Nat/Aux Vent 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings 106 106 0.4 -1.9 Internal Floors 0 0 0.0 0.0 Internal Air & Furniture 0 0 0.0 0.0 Ceilings 0 0 0.0 0.0 Sub Total -5,434 -5,434 -21.6 Internal Gains Lights 0 0 0.0 0.0 People 0 0 0.0 0.0 Misc, Computers, Equip 0 0 0.0 0.0 Sub Total 0 0 0.0 TOTAL -5,434 -5,434 -21.6 100 HEATING SUMMARY Sensible heating load (Btu/h):5,434 Design zone air temp for Supply Airflow calculation (°F):70.0 AREAS & THERMAL TRANSMITTANCE Total Area Glazing Glazing U-value1 ft²ft²%Btu/h·ft²·°F External Wall (above grade)1,462.0 --0.09 Below Grade Walls ---- Windows2 ---- Doors ---- Floors 251.6 --0.19 Roofs3 251.4 --0.02 COMBINED 1,965.0 --0.09 Internal Ceilings ---- Floors ---- Partitions4 1,192.2 --0.33 1 Area-weighted U-value; 2 Windows/glazing include glass and frames;3 Roofs incl. skylights; 4 Partitions incl. internal windows and doors. TEMPERATURES & SETPOINTS Cooling Heating °F °F Supply Air (design)55.0 90.0 Room Setpoint (design)82.0 70.0 Room (actual)82.1 70.0 Mean Radiant Temperature 83.1 67.7 Dry Resultant Temperature 82.6 68.8 RH (Design Max Setpoint) (%)60.0 60.0 AIRFLOW Cooling Heating cfm cfm Supply (design)112 248 Reheat Minimum (design)75 75 Leakage at Design Flow 0 0 Ventilation (requirement)19 19 Exhaust (requirement)-- Infiltration 16 16 CHECKS Number of People 0.00 ft²/Person - Average Ceiling Height (ft)38.15 Btu/h/ft² - Cooling (sensible)13.13 Btu/h/ft² - Heating 21.60 ft²/ton - Cooling (sensible)914.07 ft²/ton - Heating 555.54 cfm/ft² - Cooling 0.44 cfm/ft² - Heating 0.99 % Outside Air - Cooling 16.87 % Outside Air - Heating 7.60 Outdoor Air cfm/ft²0.08 Outdoor Air cfm/person - Long Center Option2rev1 rooms loads | 2023/12/06 10:06 | Room Loads - Page 5 of 10 Document Page: 9 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Room Loads reports are not influenced by system operation. 1 Room Loads Report Zone: Dh-2 System: 05 a VAV - Reheat Long Center Option2 31 Vestibule HVAC Methodology: ApacheHVAC IES VIRTUAL ENVIRONMENT VE 2023 COOLING ROOM PEAK Time of Peak (Mo/Hr:Mn)9 / 11:30 Outside Air (DBT/WBT/RH) °F and %RH 89.8 / 76.1 / 53.4 Room Room Net Per Floor Percent Sensible Latent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h Btu/h·ft²% External Walls -614 --614 -2.3 -3.9 Roofs -807 --807 -3.1 -5.2 Ground/Exposed Floors -2,037 --2,037 -7.7 -13.1 External Doors 0 -0 0.0 0.0 Windows Conduction 1,750 -1,750 6.6 11.3 Skylights Conduction 0 -0 0.0 0.0 Solar 18,742 -18,742 70.9 120.5 Infiltration 124 142 266 1.0 1.7 Nat/Aux Vent 0 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings -2,375 --2,375 -9.0 -15.3 Internal Floors 0 -0 0.0 0.0 Internal Air & Furniture 0 -0 0.0 0.0 Ceilings 0 -0 0.0 0.0 Sub Total 14,784 142 14,926 56.4 Internal Gains Lights 451 -451 1.7 2.9 People 0 0 0 0.0 0.0 Misc, Computers, Equip 181 0 181 0.7 1.2 Sub Total 632 0 632 2.4 TOTAL 15,415 142 15,558 58.8 100 COOLING SUMMARY Sensible cooling load (Btu/h):15,415 Latent cooling load (Btu/h):142 Sensible heat ratio:0.99 Design Supply Airflow calculated per:Sensible Loads Design zone air temp for Supply Airflow calculation (°F):82.0 HEATING ROOM PEAK Time of Peak (Mo/Hr:Mn)Heating Design Outside Air (DBT/WBT/RH) °F and %RH 42.1 / 35.4 / 49.6 Room Net Per Floor Percent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h·ft²% External Walls -1,732 -1,732 -6.5 20.0 Roofs -178 -178 -0.7 2.1 Ground/Exposed Floors -1,344 -1,344 -5.1 15.5 External Doors 0 0 0.0 0.0 Windows Conduction -5,607 -5,607 -21.2 64.8 Skylights Conduction 0 0 0.0 0.0 Solar 0 0 0.0 0.0 Infiltration -514 -514 -1.9 5.9 Nat/Aux Vent 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings 716 716 2.7 -8.3 Internal Floors 0 0 0.0 0.0 Internal Air & Furniture 0 0 0.0 0.0 Ceilings 0 0 0.0 0.0 Sub Total -8,658 -8,658 -32.7 Internal Gains Lights 0 0 0.0 0.0 People 0 0 0.0 0.0 Misc, Computers, Equip 0 0 0.0 0.0 Sub Total 0 0 0.0 TOTAL -8,658 -8,658 -32.7 100 HEATING SUMMARY Sensible heating load (Btu/h):8,658 Design zone air temp for Supply Airflow calculation (°F):70.0 AREAS & THERMAL TRANSMITTANCE Total Area Glazing Glazing U-value1 ft²ft²%Btu/h·ft²·°F External Wall (above grade)1,453.8 402.8 27.7 0.21 Below Grade Walls ---- Windows2 402.8 402.8 100.0 0.53 Doors ---- Floors 264.5 --0.19 Roofs3 264.5 --0.02 COMBINED 1,982.8 402.8 20.3 0.18 Internal Ceilings ---- Floors ---- Partitions4 1,061.3 --0.33 1 Area-weighted U-value; 2 Windows/glazing include glass and frames;3 Roofs incl. skylights; 4 Partitions incl. internal windows and doors. TEMPERATURES & SETPOINTS Cooling Heating °F °F Supply Air (design)55.0 90.0 Room Setpoint (design)82.0 70.0 Room (actual)82.0 70.0 Mean Radiant Temperature 87.7 65.8 Dry Resultant Temperature 84.9 67.9 RH (Design Max Setpoint) (%)60.0 60.0 AIRFLOW Cooling Heating cfm cfm Supply (design)522 396 Reheat Minimum (design)157 157 Leakage at Design Flow 0 0 Ventilation (requirement)20 20 Exhaust (requirement)-- Infiltration 17 17 CHECKS Number of People 0.00 ft²/Person - Average Ceiling Height (ft)38.17 Btu/h/ft² - Cooling (sensible)58.29 Btu/h/ft² - Heating 32.74 ft²/ton - Cooling (sensible)205.88 ft²/ton - Heating 366.55 cfm/ft² - Cooling 1.97 cfm/ft² - Heating 1.50 % Outside Air - Cooling 3.80 % Outside Air - Heating 5.01 Outdoor Air cfm/ft²0.07 Outdoor Air cfm/person - Long Center Option2rev1 rooms loads | 2023/12/06 10:06 | Room Loads - Page 6 of 10 Document Page: 10 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Room Loads reports are not influenced by system operation. 1 Room Loads Report Zone: Dh-2 System: 05 a VAV - Reheat Long Center Option2 32 DH-2 Pool Area Circulation HVAC Methodology: ApacheHVAC IES VIRTUAL ENVIRONMENT VE 2023 COOLING ROOM PEAK Time of Peak (Mo/Hr:Mn)6 / 17:30 Outside Air (DBT/WBT/RH) °F and %RH 91.6 / 76.2 / 49.5 Room Room Net Per Floor Percent Sensible Latent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h Btu/h·ft²% External Walls 2,686 -2,686 2.3 12.1 Roofs 283 -283 0.2 1.3 Ground/Exposed Floors -487 --487 -0.4 -2.2 External Doors 0 -0 0.0 0.0 Windows Conduction 948 -948 0.8 4.3 Skylights Conduction 0 -0 0.0 0.0 Solar 17,285 -17,285 14.6 78.0 Infiltration 828 564 1,392 1.2 6.3 Nat/Aux Vent 0 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings -2,771 --2,771 -2.3 -12.5 Internal Floors 0 -0 0.0 0.0 Internal Air & Furniture 0 -0 0.0 0.0 Ceilings -3 --3 0.0 0.0 Sub Total 18,769 564 19,333 16.3 Internal Gains Lights 2,026 -2,026 1.7 9.1 People 0 0 0 0.0 0.0 Misc, Computers, Equip 811 0 811 0.7 3.7 Sub Total 2,837 0 2,837 2.4 TOTAL 21,606 564 22,170 18.7 100 COOLING SUMMARY Sensible cooling load (Btu/h):21,606 Latent cooling load (Btu/h):564 Sensible heat ratio:0.97 Design Supply Airflow calculated per:Sensible Loads Design zone air temp for Supply Airflow calculation (°F):82.0 HEATING ROOM PEAK Time of Peak (Mo/Hr:Mn)Heating Design Outside Air (DBT/WBT/RH) °F and %RH 42.1 / 35.4 / 49.6 Room Net Per Floor Percent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h·ft²% External Walls -8,486 -8,486 -7.1 46.5 Roofs -804 -804 -0.7 4.4 Ground/Exposed Floors -6,677 -6,677 -5.6 36.6 External Doors 0 0 0.0 0.0 Windows Conduction -2,639 -2,639 -2.2 14.5 Skylights Conduction 0 0 0.0 0.0 Solar 0 0 0.0 0.0 Infiltration -2,261 -2,261 -1.9 12.4 Nat/Aux Vent 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings 2,618 2,618 2.2 -14.3 Internal Floors 0 0 0.0 0.0 Internal Air & Furniture 0 0 0.0 0.0 Ceilings 0 0 0.0 0.0 Sub Total -18,249 -18,249 -15.4 Internal Gains Lights 0 0 0.0 0.0 People 0 0 0.0 0.0 Misc, Computers, Equip 0 0 0.0 0.0 Sub Total 0 0 0.0 TOTAL -18,249 -18,249 -15.4 100 HEATING SUMMARY Sensible heating load (Btu/h):18,249 Design zone air temp for Supply Airflow calculation (°F):70.0 AREAS & THERMAL TRANSMITTANCE Total Area Glazing Glazing U-value1 ft²ft²%Btu/h·ft²·°F External Wall (above grade)3,735.4 176.7 4.7 0.11 Below Grade Walls ---- Windows2 176.7 176.7 100.0 0.53 Doors ---- Floors 1,187.8 --0.19 Roofs3 1,143.6 --0.02 COMBINED 6,066.8 176.7 2.9 0.11 Internal Ceilings 44.1 --0.05 Floors ---- Partitions4 2,305.0 --0.33 1 Area-weighted U-value; 2 Windows/glazing include glass and frames;3 Roofs incl. skylights; 4 Partitions incl. internal windows and doors. TEMPERATURES & SETPOINTS Cooling Heating °F °F Supply Air (design)55.0 90.0 Room Setpoint (design)82.0 70.0 Room (actual)82.0 70.0 Mean Radiant Temperature 83.7 67.9 Dry Resultant Temperature 82.8 69.0 RH (Design Max Setpoint) (%)60.0 60.0 AIRFLOW Cooling Heating cfm cfm Supply (design)2,961 2,961 Reheat Minimum (design)2,961 2,961 Leakage at Design Flow 0 0 Ventilation (requirement)2,961 2,961 Exhaust (requirement)1,480 1,480 Infiltration 74 74 CHECKS Number of People 0.00 ft²/Person - Average Ceiling Height (ft)37.39 Btu/h/ft² - Cooling (sensible)18.19 Btu/h/ft² - Heating 15.36 ft²/ton - Cooling (sensible)659.67 ft²/ton - Heating 781.03 cfm/ft² - Cooling 2.49 cfm/ft² - Heating 2.49 % Outside Air - Cooling 100.00 % Outside Air - Heating 100.00 Outdoor Air cfm/ft²2.49 Outdoor Air cfm/person - Long Center Option2rev1 rooms loads | 2023/12/06 10:06 | Room Loads - Page 7 of 10 Document Page: 11 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Room Loads reports are not influenced by system operation. 1 Room Loads Report Zone: Dh-2 System: 05 a VAV - Reheat Long Center Option2 DH-2 Pool Area HVAC Methodology: ApacheHVAC IES VIRTUAL ENVIRONMENT VE 2023 COOLING ROOM PEAK Time of Peak (Mo/Hr:Mn)8 / 17:30 Outside Air (DBT/WBT/RH) °F and %RH 91.6 / 77.7 / 53.8 Room Room Net Per Floor Percent Sensible Latent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h Btu/h·ft²% External Walls 870 -870 0.1 0.2 Roofs 0 -0 0.0 0.0 Ground/Exposed Floors -1,550 --1,550 -0.1 -0.3 External Doors 0 -0 0.0 0.0 Windows Conduction 1,528 -1,528 0.1 0.3 Skylights Conduction 0 -0 0.0 0.0 Solar 33,794 -33,794 2.9 7.5 Infiltration 2,139 3,820 5,960 0.5 1.3 Nat/Aux Vent 0 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings -8,883 --8,883 -0.8 -2.0 Internal Floors -756 --756 -0.1 -0.2 Internal Air & Furniture 0 -0 0.0 0.0 Ceilings 0 -0 0.0 0.0 Sub Total 27,143 3,820 30,963 2.7 Internal Gains Lights 35,560 -35,560 3.1 7.9 People 17,750 27,250 45,000 3.9 9.9 Misc, Computers, Equip 0 341,222 341,222 29.5 75.4 Sub Total 53,310 368,472 421,783 36.4 TOTAL 80,453 372,293 452,746 39.1 100 COOLING SUMMARY Sensible cooling load (Btu/h):80,453 Latent cooling load (Btu/h):372,293 Sensible heat ratio:0.18 Design Supply Airflow calculated per:Sensible Loads Design zone air temp for Supply Airflow calculation (°F):82.0 HEATING ROOM PEAK Time of Peak (Mo/Hr:Mn)Heating Design Outside Air (DBT/WBT/RH) °F and %RH 42.1 / 35.4 / 49.6 Room Net Per Floor Percent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h·ft²% External Walls -1,610 -1,610 -0.1 4.8 Roofs 0 0 0.0 0.0 Ground/Exposed Floors -6,150 -6,150 -0.5 18.3 External Doors 0 0 0.0 0.0 Windows Conduction -3,582 -3,582 -0.3 10.7 Skylights Conduction 0 0 0.0 0.0 Solar 0 0 0.0 0.0 Infiltration -5,882 -5,882 -0.5 17.5 Nat/Aux Vent 0 0 0.0 0.0 Internal Building Gains/Losses Internal Walls/Openings 2,683 2,683 0.2 -8.0 Internal Floors -18,985 -18,985 -1.6 56.6 Internal Air & Furniture 0 0 0.0 0.0 Ceilings 0 0 0.0 0.0 Sub Total -33,527 -33,527 -2.9 Internal Gains Lights 0 0 0.0 0.0 People 0 0 0.0 0.0 Misc, Computers, Equip 0 0 0.0 0.0 Sub Total 0 0 0.0 TOTAL -33,527 -33,527 -2.9 100 HEATING SUMMARY Sensible heating load (Btu/h):33,527 Design zone air temp for Supply Airflow calculation (°F):70.0 AREAS & THERMAL TRANSMITTANCE Total Area Glazing Glazing U-value1 ft²ft²%Btu/h·ft²·°F External Wall (above grade)1,027.6 363.7 35.4 0.18 Below Grade Walls ---- Windows2 363.7 363.7 100.0 0.34 Doors ---- Floors 4,432.2 --0.05 Roofs3 ---- COMBINED 5,459.8 363.7 6.7 0.08 Internal Ceilings ---- Floors 7,147.5 --0.19 Partitions4 2,474.9 --0.33 1 Area-weighted U-value; 2 Windows/glazing include glass and frames;3 Roofs incl. skylights; 4 Partitions incl. internal windows and doors. TEMPERATURES & SETPOINTS Cooling Heating °F °F Supply Air (design)55.0 90.0 Room Setpoint (design)82.0 70.0 Room (actual)82.0 70.0 Mean Radiant Temperature 84.4 68.0 Dry Resultant Temperature 83.2 69.0 RH (Design Max Setpoint) (%)60.0 60.0 AIRFLOW Cooling Heating cfm cfm Supply (design)7,703 7,703 Reheat Minimum (design)7,703 7,703 Leakage at Design Flow 0 0 Ventilation (requirement)7,703 7,703 Exhaust (requirement)3,851 3,851 Infiltration 193 193 CHECKS Number of People 25.00 ft²/Person 463.19 Average Ceiling Height (ft)9.98 Btu/h/ft² - Cooling (sensible)6.95 Btu/h/ft² - Heating 2.90 ft²/ton - Cooling (sensible)1,727.17 ft²/ton - Heating 4,144.61 cfm/ft² - Cooling 0.67 cfm/ft² - Heating 0.67 % Outside Air - Cooling 100.00 % Outside Air - Heating 100.00 Outdoor Air cfm/ft²0.67 Outdoor Air cfm/person 308.10 Long Center Option2rev1 rooms loads | 2023/12/06 10:06 | Room Loads - Page 8 of 10 Document Page: 12 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Room Loads reports are not influenced by system operation. 1 Room Loads Report Zone: Dh-2 System: 05 a VAV - Reheat Long Center Option2 DH-2 Pool Area (upper 1) HVAC Methodology: ApacheHVAC IES VIRTUAL ENVIRONMENT VE 2023 COOLING ROOM PEAK Time of Peak (Mo/Hr:Mn)8 / 16:30 Outside Air (DBT/WBT/RH) °F and %RH 92.7 / 78.1 / 52.3 Room Room Net Per Floor Percent Sensible Latent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h Btu/h·ft²% External Walls 1,140 -1,140 -4.3 Roofs 0 -0 -0.0 Ground/Exposed Floors 0 -0 -0.0 External Doors 0 -0 -0.0 Windows Conduction 3,001 -3,001 -11.4 Skylights Conduction 0 -0 -0.0 Solar 7,375 -7,375 -28.1 Infiltration 3,314 3,997 7,311 -27.8 Nat/Aux Vent 0 0 0 -0.0 Internal Building Gains/Losses Internal Walls/Openings 7,429 -7,429 -28.3 Internal Floors 0 -0 -0.0 Internal Air & Furniture 0 -0 -0.0 Ceilings 0 -0 -0.0 Sub Total 22,259 3,997 26,257 0.0 Internal Gains Lights 0 -0 -0.0 People 0 0 0 -0.0 Misc, Computers, Equip 0 0 0 -0.0 Sub Total 0 0 0 0.0 TOTAL 22,259 3,997 26,257 0.0 100 COOLING SUMMARY Sensible cooling load (Btu/h):22,259 Latent cooling load (Btu/h):3,997 Sensible heat ratio:0.85 Design Supply Airflow calculated per:Sensible Loads Design zone air temp for Supply Airflow calculation (°F):82.0 HEATING ROOM PEAK Time of Peak (Mo/Hr:Mn)Heating Design Outside Air (DBT/WBT/RH) °F and %RH 42.1 / 35.4 / 49.6 Room Net Per Floor Percent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h·ft²% External Walls -2,438 -2,438 -- Roofs 0 0 -- Ground/Exposed Floors 0 0 -- External Doors 0 0 -- Windows Conduction -6,748 -6,748 -- Skylights Conduction 0 0 -- Solar 0 0 -- Infiltration -8,306 -8,306 -- Nat/Aux Vent 0 0 -- Internal Building Gains/Losses Internal Walls/Openings -3,373 -3,373 -- Internal Floors 0 0 -- Internal Air & Furniture 0 0 -- Ceilings 0 0 -- Sub Total -20,866 -20,866 0.0 Internal Gains Lights 0 0 -- People 0 0 -- Misc, Computers, Equip 0 0 -- Sub Total 0 0 0.0 TOTAL -20,866 -20,866 0.0 0 HEATING SUMMARY Sensible heating load (Btu/h):20,866 Design zone air temp for Supply Airflow calculation (°F):70.0 AREAS & THERMAL TRANSMITTANCE Total Area Glazing Glazing U-value1 ft²ft²%Btu/h·ft²·°F External Wall (above grade)1,451.2 487.7 33.6 0.22 Below Grade Walls ---- Windows2 487.7 487.7 100.0 0.48 Doors ---- Floors ---- Roofs3 ---- COMBINED 1,451.2 487.7 33.6 0.22 Internal Ceilings ---- Floors ---- Partitions4 3,412.3 --0.33 1 Area-weighted U-value; 2 Windows/glazing include glass and frames;3 Roofs incl. skylights; 4 Partitions incl. internal windows and doors. TEMPERATURES & SETPOINTS Cooling Heating °F °F Supply Air (design)55.0 90.0 Room Setpoint (design)82.0 70.0 Room (actual)82.0 70.0 Mean Radiant Temperature 83.2 68.5 Dry Resultant Temperature 82.6 69.2 RH (Design Max Setpoint) (%)60.0 60.0 AIRFLOW Cooling Heating cfm cfm Supply (design)5,439 5,439 Reheat Minimum (design)5,439 5,439 Leakage at Design Flow 0 0 Ventilation (requirement)5,439 5,439 Exhaust (requirement)4,079 4,079 Infiltration 272 272 CHECKS Number of People 0.00 ft²/Person - Average Ceiling Height (ft)14.09 Btu/h/ft² - Cooling (sensible)- Btu/h/ft² - Heating - ft²/ton - Cooling (sensible)- ft²/ton - Heating - cfm/ft² - Cooling - cfm/ft² - Heating - % Outside Air - Cooling 100.00 % Outside Air - Heating 100.00 Outdoor Air cfm/ft²- Outdoor Air cfm/person - Long Center Option2rev1 rooms loads | 2023/12/06 10:06 | Room Loads - Page 9 of 10 Document Page: 13 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Room Loads reports are not influenced by system operation. 1 Room Loads Report Zone: Dh-2 System: 05 a VAV - Reheat Long Center Option2 DH-2 Pool Area (upper 2) HVAC Methodology: ApacheHVAC IES VIRTUAL ENVIRONMENT VE 2023 COOLING ROOM PEAK Time of Peak (Mo/Hr:Mn)6 / 17:30 Outside Air (DBT/WBT/RH) °F and %RH 91.6 / 76.2 / 49.5 Room Room Net Per Floor Percent Sensible Latent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h Btu/h·ft²% External Walls 1,456 -1,456 -4.9 Roofs 7,488 -7,488 -25.0 Ground/Exposed Floors 0 -0 -0.0 External Doors 0 -0 -0.0 Windows Conduction 2,535 -2,535 -8.5 Skylights Conduction 0 -0 -0.0 Solar 10,649 -10,649 -35.5 Infiltration 3,043 2,072 5,114 -17.1 Nat/Aux Vent 0 0 0 -0.0 Internal Building Gains/Losses Internal Walls/Openings 2,729 -2,729 -9.1 Internal Floors 0 -0 -0.0 Internal Air & Furniture 0 -0 -0.0 Ceilings 0 -0 -0.0 Sub Total 27,899 2,072 29,971 0.0 Internal Gains Lights 0 -0 -0.0 People 0 0 0 -0.0 Misc, Computers, Equip 0 0 0 -0.0 Sub Total 0 0 0 0.0 TOTAL 27,899 2,072 29,971 0.0 100 COOLING SUMMARY Sensible cooling load (Btu/h):27,899 Latent cooling load (Btu/h):2,072 Sensible heat ratio:0.93 Design Supply Airflow calculated per:Sensible Loads Design zone air temp for Supply Airflow calculation (°F):82.0 HEATING ROOM PEAK Time of Peak (Mo/Hr:Mn)Heating Design Outside Air (DBT/WBT/RH) °F and %RH 42.1 / 35.4 / 49.6 Room Net Per Floor Percent Value Area of Total Envelope Gains/Losses Btu/h Btu/h Btu/h·ft²% External Walls -2,486 -2,486 -- Roofs -8,273 -8,273 -- Ground/Exposed Floors 0 0 -- External Doors 0 0 -- Windows Conduction -5,883 -5,883 -- Skylights Conduction 0 0 -- Solar 0 0 -- Infiltration -8,306 -8,306 -- Nat/Aux Vent 0 0 -- Internal Building Gains/Losses Internal Walls/Openings -2,632 -2,632 -- Internal Floors 0 0 -- Internal Air & Furniture 0 0 -- Ceilings 0 0 -- Sub Total -27,580 -27,580 0.0 Internal Gains Lights 0 0 -- People 0 0 -- Misc, Computers, Equip 0 0 -- Sub Total 0 0 0.0 TOTAL -27,580 -27,580 0.0 0 HEATING SUMMARY Sensible heating load (Btu/h):27,580 Design zone air temp for Supply Airflow calculation (°F):70.0 AREAS & THERMAL TRANSMITTANCE Total Area Glazing Glazing U-value1 ft²ft²%Btu/h·ft²·°F External Wall (above grade)1,451.2 472.7 32.6 0.20 Below Grade Walls ---- Windows2 472.7 472.7 100.0 0.43 Doors ---- Floors ---- Roofs3 11,579.7 --0.02 COMBINED 13,030.9 472.7 3.6 0.04 Internal Ceilings ---- Floors ---- Partitions4 3,558.8 --0.33 1 Area-weighted U-value; 2 Windows/glazing include glass and frames;3 Roofs incl. skylights; 4 Partitions incl. internal windows and doors. TEMPERATURES & SETPOINTS Cooling Heating °F °F Supply Air (design)55.0 90.0 Room Setpoint (design)82.0 70.0 Room (actual)82.0 70.0 Mean Radiant Temperature 83.1 68.7 Dry Resultant Temperature 82.5 69.3 RH (Design Max Setpoint) (%)60.0 60.0 AIRFLOW Cooling Heating cfm cfm Supply (design)5,439 5,439 Reheat Minimum (design)5,439 5,439 Leakage at Design Flow 0 0 Ventilation (requirement)5,439 5,439 Exhaust (requirement)4,079 4,079 Infiltration 272 272 CHECKS Number of People 0.00 ft²/Person - Average Ceiling Height (ft)14.09 Btu/h/ft² - Cooling (sensible)- Btu/h/ft² - Heating - ft²/ton - Cooling (sensible)- ft²/ton - Heating - cfm/ft² - Cooling - cfm/ft² - Heating - % Outside Air - Cooling 100.00 % Outside Air - Heating 100.00 Outdoor Air cfm/ft²- Outdoor Air cfm/person - Long Center Option2rev1 rooms loads | 2023/12/06 10:06 | Room Loads - Page 10 of 10 Document Page: 14 Data in this report is firstly from the Room Loads (.clg and .htg) results files and the VE model. When there is an associated ApacheHVAC file, additional data from that file is included; however, the reported values for loads and calculated design airflows in these Room Loads reports are not influenced by system operation. 1 HVAC LIFE CYCLE COST ANALYSIS SUMMARYClearwater Long Center Natatorium12/27/2023INSTALLATION 30 YEARS OF ENERGY 30 YEARS OF 30 YEARS OFOPTION DESCRIPTION COSTS COST MAINTENANCE COSTS REPLACEMENT COSTS1 Glazing = + $3,337,675.00 + = + = =2 Less Glazing = + $2,829,776 + = + = = Long Center Renovation GMP Proposal Date: Monday December 23rd, 2024 TO: Jeff Walker, P.E. City of Clearwater – Public Works Department 100 S. Myrtle Ave., Suite 200 Clearwater, FL 33756 RE: LONG CENTER RENOVATION (21-0026-PR) Creative Contractors is pleased to submit our GMP proposal for the Long Center renovation, installation of a new dehumidification system and the addition of the sun deck. (i.e. As requested, enclosed is the proposal for construction/demolition of City of Clearwater Long Natatorium Renovation submitted in accordance with technical specs/plans/study/clarifications of this letter/attached line-item work, etc., for a Guaranteed Maximum Price of 14,504,354. Scope of Work: Project consists of removing the entire glass façade and replacing with new insulated glass and stucco elements. It also includes a completely new dehumidification system, painting of the existing roof deck, new roofing system, pool equipment change-out, and an enclosed sundeck addition. The Scope of Work is further detailed in the Contract Documents. Cost Detail: Description Natatorium Renovation Amount Building Modifications $10,615,024 Design Evolution / Permit Comments 3% $318,451 Subtotal of Cost of Work (COW) $10,933,475 Subcontractor Default Insurance 1.25% $136,668 General Conditions $622,951 General Requirements $324,886 Subtotal COW and General Costs (GC) $12,017,980 Contingency: 3% Owner & 3% CMAR $721,079 Builders Risk Insurance (Allowance) .35% $42,063 Liability Insurance .62% $74,511 Pollution Liability By Owner Subtotal COW, GC, Contingency, & Insurance $12,855,633 Construction Manager Fee 5% $642,782 Performance $ Payment Bond .72% $97,189 GMP $13,595,604 Description Add Alt Sundeck Addition Building Modifications $535,312 Site Work (Allowance) $175,000 Design Evolution Contingency/ Permit Comments 2.5% $17,758 Subtotal Cost of Work (COW) $728,070 Subcontractor Default Insurance 1.25% $9,101 General Conditions $45,560 General Requirements $23,206 Subtotal COW and General Cost (GC) $805,937 Contingency: 3% Owner & 3% CMAR $48,356 Builders Risk Included above Liability Insurance $4,997 Pollution Insurance By Owner Subtotal COW, GC, Contingency, & Insurance $859,290 Construction Manager Fee 5% $42,964 Payment and Performance Bond $6,496 GMP $908,750 Total Guaranteed Maximum Price $14,504,354 Project Duration shall be 402 calendar days from the date of the Notice to Proceed to Substantial Completion. Existing Contract: This proposal is submitted in conjunction with the existing Construction Manager at Risk Services Continuing Contract entered into with the City of Clearwater on March 14, 2024, based on RFQ #07-24. The terms of that Contract shall continue to govern between the Parties. Upon execution, this Proposal shall be considered an amendment to that Contract only for purposes of establishing the Guaranteed Maximum Price. If GMP Exceeds $150,000: Per Section III, Article 5.1 of the Contract Specifications, the contractor shall provide to the public entity a certified copy of the recorded bond. Once the City receives a certified copy of the recorded bond, a Notice to Proceed may be issued. Include the attached bond form as well as the Power of Attorney. Code: 3157572-563600-C2202 For work performed, invoices shall be submitted to the City of Clearwater, Public Works Department/Engineering, Attention: Jamie Gaubatz, P.O. Box 4748, Clearwater, Florida, 33758- 4748. Contingency services may be billed only after written authorization is provided by the City to proceed with those services. CONTRACTOR COMPANY NAME By: _________________________________ Joshua Bomstein President _____________________________________ Date CITY OF CLEARWATER, FLORIDA Approved as to form: Attest: ____________________________ By: _______________________________ Jerrod Simpson Rosemarie Call Senior Assistant City Attorney City Clerk Countersigned: ____________________________ ___________________________________ Bruce Rector Jennifer Poirrier Mayor City Manager ____________________________ ___________________________________ Date Date Bond No.:________________ PUBLIC CONSTRUCTION BOND (1) This bond is given to comply with § 255.05, Florida Statutes, and any action instituted by a claimant under this bond for payment must be in accordance with the notice and time limitation provisions in subsections (2) and (10). Pursuant to § 255.05(1)(b), Florida Statutes, “Before commencing the work or before recommencing the work after a default or abandonment, the contractor shall provide to the public entity a certified copy of the recorded bond. Notwithstanding the terms of the contract or any other law governing prompt payment for construction services, the public entity may not make a payment to the contractor until the contractor has complied with this paragraph.” CONTRACTOR SURETY OWNER Creative Contractors, Inc 101 Creative Way Clearwater, Fl 33759 727-461-5522 Travelers Casualty and Surety Company of America One Town Square Hartford, CT 06183 City of Clearwater Public Works Department 100 S. Myrtle Avenue Clearwater, FL 33756 (727) 562-4747 PROJECT NAME: LONG CENTER RENOVATION PROJECT NO: 21-0026-PR PROJECT DESCRIPTION: Project consists of removing the entire glass façade and replacing with new glass and stucco elements. It also includes a completely new dehumidification system, painting of the existing roof deck, new roofing system, pool equipment change out, and an enclosed sundeck addition BY THIS BOND, We Creative Contractors, as Contractor, and Travelers, a corporation, as Surety, are bound to the City of Clearwater, Florida, herein called Owner, in the sum of $14,504,354, for payment of which we bind ourselves, our heirs, personal representatives, successors, and assigns, jointly and severally. THE CONDITION OF THIS BOND is that if Contractor: 1. Performs the proposal dated 12/2/24 between Contractor and Owner for construction of the Long Center Renovation (21-0026-PR), the contract documents being made a part of this bond by reference (which include the Advertisement for Bids, Proposal, Contract, Surety Bond, Instructions to Bidders, General Conditions, Plans, Technical Specifications and Appendix, and such alterations as may be made in said Plans and Specifications as therein provided for), at the times and in the manner prescribed in the contract; and 2. Promptly makes payments to all claimants, as defined in Section 255.05(1), Florida Statutes, supplying Contractor with labor, materials, or supplies, used directly or indirectly by Contractor in the prosecution of the work provided for in the contract; and 3. Pays Owner all losses, damages, expenses, costs, and attorney’s fees, including appellate proceedings, that Owner sustains because of a default by Contractor under the contract; and Bond No.:________________ PUBLIC CONSTRUCTION BOND (2) 4. To the limits of § 725.06(2), Florida Statutes, shall indemnify and hold harmless Owner, their officers and employees, from liabilities, damages, losses and costs, including, but not limited to, reasonable attorney’s fees, to the extent caused by the negligence, recklessness, or intentional wrongful misconduct of Contractor and persons employed or utilized by Contractor in the performance of the construction contract; and 5. Performs the guarantee of all work and materials furnished under the contract for the time specified in the contract, then this bond is void; otherwise it remains in full force. 6. Any action instituted by a claimant under this bond for payment must be in accordance with the notice and time limitation provisions in Section 255.05(2), Florida Statutes. 7. Any changes in or under the contract documents and compliance or noncompliance with any formalities connected with the contract or the changes does not affect Surety’s obligation under this bond, and Surety does hereby waive notice of any such change, extension of time, alteration or addition to the terms of the contract or to the work or to the specifications. IN TESTIMONY WHEREOF, witness the hands and seals of the parties hereto this __________ day of ________________, 20___. (If sole Ownership or Partnership, two (2) Witnesses required). (If Corporation, Secretary only will attest and affix seal). [TYPE LEGAL NAME OF CONTRACTOR] By: _____________________________ Title: VP / Chief Estimator Print Name: _Jim Cacini____________ WITNESS: WITNESS: _________________________________ _________________________________ Corporate Secretary or Witness Print Name: _______________________ Print Name: _______________________ (affix corporate seal) [Leave blank for Name of Corporate Surety] By: _____________________________ ATTORNEY-IN-FACT Print Name: _______________________ (affix corporate seal) (Power of Attorney must be attached) Cover Memo City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 File Number: ID#25-0001 Agenda Date: 1/16/2025 Status: Public HearingVersion: 1 File Type: Action ItemIn Control: City Attorney Agenda Number: 7.3 SUBJECT/RECOMMENDATION: Amend Clearwater Code of Ordinances Sections 2.413 and 2.418 to change the disability process for members of the pension plan and pass Ordinance 9813-25 on first reading. SUMMARY: The City of Clearwater Employees’ Pension Plan governs the payment of retirement benefits for City employees. Currently, the Pension Advisory Committee determines whether an applicant is entitled to a disability retirement benefit. In 2024, the City and labor unions agreed to a change in the disability process for members . Under the new process, the City Manager, after consideration of all relevant factors, may either enter into a stipulated approval for an applicant’s disability retirement benefit or schedule an evidentiary hearing. If the City Manager enters into a stipulated approval, an agenda item shall be brought before the Pension Trustees confirming the stipulation. If the City Manager opts for an evidentiary hearing, the hearing shall be conducted by the State of Florida Division of Administrative Hearings (DOAH). The DOAH hearing officer will review the application for a disability retirement, determine whether the claim meets the criteria for awarding a disability pension benefit, and issue a recommended order. The DOAH hearing officer shall then transmit the recommended order composed of findings of fact, conclusions of law, and disposition to the Pension Trustees. Page 1 City of Clearwater Printed on 1/14/2025 1 ORDINANCE NO. 9813-25 AN ORDINANCE OF THE CITY OF CLEARWATER, FLORIDA; AMENDING CHAPTER 2, ARTICLE V, DIVISION 3, EMPLOYEES’ PENSION PLAN, AMENDING SECTION 2.413 PLAN ADMINISTRATION; AMENDING SECTION 2.418 DISABILITY BENEFITS; PROVIDING FOR INCLUSION IN THE CODE; PROVIDING FOR SEVERABILITY; PROVIDING FOR A REPEALER; AND PROVIDING FOR AN EFFECTIVE DATE. WHEREAS, the City of Clearwater Employees’ Pension Plan (the “Plan”) governs the payment of retirement benefits for City employees; and WHEREAS, the City and labor unions have agreed to a change in the disability process for all members; and WHEREAS, the Plan’s actuary has studied the cost of this amendment; and WHEREAS, the City has determined that the adoption of this Ordinance to be in the best interest of the City. NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF CLEARWATER, FLORIDA, THAT: Section 1: Section 2.413 of the Code of Ordinances of the City of Clearwater is hereby amended to read as follows: Section 2.413. – Plan Administration. (a) Administration of the plan. The trustees, in conjunction with the committee, shall control and manage the operation and administration of the plan as provided in this section. (b) Trustees. (1) The members of the city council of the employer, whether elected or appointed, shall serve as the trustees. The term of office of each trustee shall be consistent with his term of office as a member of the city council. (2) The finance director of the employer shall be the treasurer for the trustees and shall provide such bond as may be prescribed by the trustees. (3) Each trustee shall be entitled to one vote. Three affirmative votes shall be necessary for any decision by the trustees at a meeting of the trustees. A trustee shall have the right to recuse himself from voting as the result of a 2 conflict of interest provided that the trustee states in writing the nature of the conflict. (4) The trustees shall not receive any compensation for service as a trustee, but may be reimbursed expenses as provided by law; provided, however, that the trustees may receive compensation for services as a member of the city council. (c) Powers and duties of trustees. The trustees shall have final authority and control over the administration of the plan herein embodied, with all powers necessary to enable them to carry out their duties in that respect. Not in limitation, but in amplification of the foregoing, the trustees shall have the power and discretion to interpret or construe this plan and to determine all questions that may arise as to the status and rights of the participants and others hereunder. The trustees shall be deemed the named fiduciary of the plan and shall discharge their responsibilities solely in the interest of the members and beneficiaries of the plan for the exclusive purpose of providing benefits to the members and their beneficiaries and to defray the reasonable expenses of the plan. The trustees shall exercise those fiduciary responsibilities with the care, skill, prudence and diligence that a prudent person acting in a like capacity and familiar with such matters would use in the conduct of an enterprise of a similar character and with similar aims under the circumstances then prevailing. The trustees may: (1) Invest and reinvest the assets of the pension fund to the extent permitted by Florida law. Notwithstanding any provision to the contrary, direct investments, including real estate investments, in businesses or property located within the City of Clearwater shall be prohibited; (2) Maintain such records as are necessary for calculating and distributing retirement benefits; (3) Maintain such records as are necessary for financial accounting and reporting of retirement plan funds; (4) Maintain such records as are necessary for actuarial evaluation of the retirement plan, including investigations into the mortality, service and compensation experience of its members and beneficiaries; (5) Compile such other administrative or investment information as is necessary for the management of the retirement plan; (6) Process, certify and respond to all correspondence, bills and statements received by the retirement plan, as well as all applications submitted to the board for retirement benefits; 3 (7) Establish and maintain communication with city departments and other agencies of government as is necessary for the management of the retirement plan, including preparing, filing and distributing such reports and information as are required by law to be prepared, filed or distributed on behalf of the retirement plan; (8) Determine all questions relating to, and process all applications for, eligibility, participation and benefits; (9) Distribute at regular intervals to employees a comprehensive summary plan description and periodic reports, not less than biennially, regarding the financial and actuarial status of the plan; (10) Retain and compensate such professional and technical expertise as is necessary to fulfill its fiduciary responsibilities; (11) Make recommendations regarding changes in the provisions of the plan; (12) Assure the prompt deposit of all member contributions, city contributions, and investment earnings; (13) Establish a uniform set of rules and regulations for the management of the trust; (14) Take such other action as the trustees shall deem, in their sole and exclusive discretion, as being necessary for the efficient management of the plan; (15) Cause any pension fund investment in securities to be registered in or transferred into its name as trustee or into the name of such nominee as it may direct, or it may retain them unregistered and in form permitting transferability, but the books and records shall at all times show that all investments are part of the pension fund; (16) Vote upon any stocks, bonds, or securities of any corporation, association, or trust comprising the pension fund, and give general or specific proxies or powers of attorney with or without power of substitution; participate in mergers, reorganizations, recapitalizations, consolidations, and similar transactions with respect to such securities; deposit such stock or other securities in any voting trust or any protective or like committee with the trustees or with depositories designated thereby; amortize or fail to amortize any part or all of the premium or discount resulting from the acquisition or disposition of assets; and generally exercise any of the powers of an owner with respect to stocks, bonds, or other investments comprising the pension fund which it may deem to be in the best interest of the pension fund to exercise; 4 (17) Retain in cash and keep unproductive of income such amount of the pension fund as it may deem advisable, having regard for the cash requirements of the plan; and (18) Retain the services of a custodian bank, an investment advisor registered under Investment Advisors Act of 1940 or otherwise exempt from such required registration, an insurance company, trust company or a combination of these, for the purposes of investment decisions and management. Such investment manager shall have discretion, subject to any guidelines as prescribed by the trustees, in the investment of all pension fund assets. (19) Arrange for the necessary physicians to pass upon all medical examinations required under this plan. Such physicians shall report in writing to the trustees their conclusions and recommendations. (20) Investigate and determine the eligibility of participants for disability pension as provided in section 2.418. (d) Pension advisory committee. (1) a. There shall be a pension advisory committee comprised of seven persons. Three members of the committee shall be employees who are active employees and participants in the plan; three members shall be city council members or appointees of the city council; and the seventh member, who shall be a resident of the City of Clearwater, shall be appointed by the other six members. b. Except as provided in subparagraph (3) below, terms of members shall be for two years. (2) Committee members representing the employees shall be elected by a majority of the active employees who are participants in the plan. Committee members representing the city council shall be appointed by a majority vote of the city council. The seventh member shall be appointed by a majority vote of the other six members of the committee. (3) Terms of office of employee elected committee members shall overlap, with two of the members to be initially elected for two years and the third member to be initially elected for one year. Terms of office of city council appointed members shall overlap, with two of the members to be initially appointed for two years and the third member to be initially appointed for one year. (4) a. Members of the committee last elected by employees on the date of adoption of this amended and restated plan shall continue to serve as the 5 employee elected committee members for the remainder of their respective terms. b. Not less than 60 days before each election to be scheduled for an employee elected committee member, the existing employee elected committee members shall select and appoint a nomination group composed of five persons from employees participating in the plan to conduct the election process. The department of the city clerk shall provide necessary assistance to the employees for the administration of elections. (5) Any vacancy on the committee, whether employee elected, city council appointed, or the committee appointed seventh member, shall be filled for the remainder of the term and in the same manner as the original committee member who vacated the position. (6) Members of the committee shall serve without compensation additional to that earned in their respective capacities as regular employees or elected city council members. (7) Each committee member shall be entitled to one vote. Four affirmative votes shall be necessary for any decision by the committee at any meeting. A committee member shall have the right to recuse himself from voting as a result of a conflict of interest provided that the committee member states in writing the nature of the conflict. (e) Powers and duties of committee. (1) The committee shall have authority to: a. Arrange for the necessary physicians to pass upon all medical examinations required under this plan. Such physicians shall report in writing to the committee their conclusions and recommendations. b. a. Investigate and recommend to the trustees, in conjunction with the actuaries, such mortality/service and other tables as shall be deemed necessary for the operation of the plan. c. b. Make recommendations to the trustees for improvements or changes in the plan. d. c. Receive all applications for benefits under this plan and determine all facts that are necessary to establish the right of an applicant to benefits under the plan. e. d. Prepare and distribute to the participants information relating to the plan. 6 f. Investigate and determine the eligibility of participants for disability pension as provided in section 2.418. (2) The committee shall, from time to time as it deems appropriate, submit recommendations to the trustees as to rules, procedures, forms and general administrative procedures relating to the responsibilities of the committee. (3) No benefits or relief shall be provided to any participant under the plan unless the same has been reviewed by the committee and a recommendation provided to the trustees. (4) The pension advisory committee members shall discharge their responsibilities solely in the interest of the members and beneficiaries of the plan and, in so doing, shall exercise their fiduciary responsibilities with the care, skill, prudence and diligence that a prudent person acting in a like capacity and familiar with such matters would use in the conduct of an enterprise of a similar character and with similar aims under the circumstances then prevailing. (f) Conflict in terms. In the event of any conflict between the terms of this plan and any explanatory booklet or other material, this plan shall control. (g) Final authority. Except to the extent otherwise required by law or by this plan, the decision of the trustees in matters within their jurisdiction shall be final, binding and conclusive upon the employer, the committee, each employee and beneficiary, and every other interested or concerned person or party. (h) Appointment of advisors. The trustees may appoint such actuaries, accountants, professional investment counsel, legal counsel, specialists, third party pension administrators, and other persons that they deem necessary and desirable in connection with the administration of this plan or to assist them in the performance of their duties as trustees. The trustees are authorized to pay for such services from the pension fund. (i) Actuarial valuation; actuarial standards. (1) At least once in each six-year period, the trustees shall cause an actuarial investigation to be made into the mortality, service and compensation experience of the members of the retirement plan. Taking into account the result of such investigation, the trustees shall adopt for the retirement plan such mortality, service and other tables as are necessary and proper. On the basis of these tables, an annual actuarial valuation of the assets and liabilities of the retirement plan shall be made. (2) Actuarial assumptions based on the six-year experience analysis may be modified by the trustees at such times as they deem appropriate. 7 (j) Defense of actions; trustee liability; indemnification. (1) The board is authorized to prosecute or defend actions, claims or proceedings of any nature or kind for the protection of the fund assets or for the protection of the board in the performance of its duties. (2) Neither the board nor any of its individual members shall have any personal liability for any action taken in good faith. The trustees individually and the board as a whole shall be entitled to the protections in F.S. § 768.28. The trustees shall also be authorized to purchase from the assets of the fund, errors and omission insurance to protect the trustees and staff in the performance of their duties. Such insurance shall not provide the individual trustees and staff with protection against a fiduciary's fraud, intentional misrepresentation, willful misconduct or gross negligence. (3) To the extent not covered by insurance contracts in force from time to time, the employer shall indemnify and hold harmless the trustees and the members of the committee from all personal liability for damages and costs, including court costs and attorneys' fees, arising out of claims, suits, litigation, or threat of same, herein referred to as "claims," against these individuals because of acts or circumstances connected with or arising out of their official duty as trustees or members of the committee. The employer reserves the right, in its sole discretion, to settle or not settle the claim at any time, and to appeal or to not appeal from any adverse judgment or ruling, and in either event will indemnify and hold harmless any trustees or members of the committee from the judgment, execution, or levy thereon. (4) This section shall not be construed so as to relieve from liability any insurance company or other entity liable to defend the claim or liable for payment of the judgment or claim, nor does this paragraph waive any provision of law affording the employer immunity from any suit in whole or part, or waive any other substantive or procedural rights the employer may have. (5) This section shall not apply to, nor shall the employer be responsible in any manner to defend or pay for claims arising out of, acts or omissions of the trustees or members of the committee which constitute felonies or gross malfeasance or gross misfeasance in office. Section 2: Section 2.418 of the Code of Ordinances of the City of Clearwater is hereby amended to read as follows: Sec. 2.418. – Disability benefits. 8 (1) a. A participant who is vested in his accrued benefit and who terminates employment by reason of his disability shall be entitled to receive, at the time and in the manner described in section 2.424, a disability benefit equal to his accrued benefit as of the date of termination of his employment. A disability application must be filed while the individual is still a participant in the plan. b. A participant who is deemed by the committee trustees to be disabled by reason of an injury suffered or an illness contracted in the line of duty need not satisfy the vesting requirement set forth in subparagraph (1)a. above; provided, further, that the monthly amount of the disability benefit payable to a participant described in this subparagraph (1)b. shall be 42 percent of such participant's average monthly compensation for a non-hazardous duty participant who is not eligible to retire as of the effective date of this restatement, and the monthly amount of the disability benefit payable to a participant described in this subparagraph (1)b. shall be 66⅔ percent of such participant's average monthly compensation for all hazardous duty participants and for non-hazardous duty participants who are eligible to retire as of the effective date of this restatement. (2) A participant shall be considered disabled for purposes of the plan if, in the opinion of the committee trustees, the participant is disabled due to sickness or injury, such disability is likely to be continuous and permanent from a cause other than specified in subparagraph (3) below, and such disability renders the participant unable to perform any useful, meaningful and necessary work for the employer in an available position for which the participant is reasonably qualified or for which the participant may be reasonably trained to perform, subject to the limitations below. a. Any police officer or firefighter participant who shall become totally and permanently disabled to the extent that he is unable, by reason of a medically determinable physical or mental impairment, to render useful and efficient service as a police officer or firefighter, shall, upon establishing the same to the satisfaction of the board, be entitled to a monthly pension provided for in subparagraph (1) above. Terminated persons, either vested or non-vested, are not eligible for disability benefits, except that those terminated by the city for medical reasons may apply for a disability pension within 30 days after termination. b. If a participant employed in a position other than as a sworn and state certified police officer or a sworn and state certified firefighter is disabled to the extent that he cannot reasonably continue to perform the functions of his specific position, but remains capable of performing useful, meaningful and necessary work, he may be assigned to an alternate position with the employer in lieu of receiving disability benefits under the plan. For this purpose, the participant may be assigned to any other position with the employer that is available for which the participant has the skill and knowledge to perform or for which the participant can reasonably be trained to perform, such assignment to be with no loss of base pay 9 regardless of whether the assignment to such position is at an equal or lower level. c. A line-of-duty disability based upon a mental injury shall not be granted unless it is proven by clear and convincing evidence that the injury was the result of sudden, unexpected and extraordinary stress directly related to the participant's employment. Extra duty assignments for police officers and firefighters shall be considered to be in the line of duty for disability benefit purposes. d. The trustees of the plan shall make the determination in each instance if a participant who has been found disabled may be assigned to an alternate position with the employer. (3)a. Each participant who is not a police officer or firefighter who is claiming disability benefits shall establish, to the satisfaction of the committee trustees, that such disability was not occasioned primarily by: 1. Excessive or habitual use of any drugs, intoxicants, or alcohol; 2. Injury or disease sustained while willfully and illegally participating in fights, riots or civil insurrections; 3. Injury or disease sustained while committing a crime; 4. Injury or disease sustained while serving in any branch of the Armed Forces; 5. Injury or disease sustained after his employment as an employee with the employer shall have terminated; 6. Willful, wanton or gross negligence of the participant; 7. Injury or disease sustained by the participant while working for anyone other than the employer and arising out of such employment; or 8. A condition pre-existing the participant's participation in the plan. No participant shall be entitled to a disability pension, whether in line of duty or not in line of duty, because of or due to the aggravation of a specific injury, impairment or other medical condition pre-existing at the time of participation in the plan, provided that such pre-existing condition and its relationship to a later injury, impairment or other medical condition be established by competent substantial evidence. b. Each police officer or firefighter participant who is claiming disability benefits shall establish, to the satisfaction of the committee trustees, that such disability was not occasioned primarily by (except that paragraph 5. is only applicable to police officers): 10 1. Excessive or habitual use of any drugs, intoxicants or narcotics. 2. Injury or disease sustained while willfully and illegally participating in fights, riots or civil insurrections or while committing a crime. 3. Injury or disease sustained while serving in any branch of the Armed Forces. 4. Injury or disease sustained by the participant after his employment as a police officer or firefighter with the City of Clearwater shall have terminated. 5. For police officer participants, injury or disease sustained by the participant while working for anyone other than the city and arising out of such employment. (4)a. A participant shall not become eligible for disability benefits until and unless he undergoes an examination by a qualified physician or physicians, who shall be selected by the committee trustees for that purpose. b.1. Any former participant receiving disability benefits under provisions of this plan may be periodically re-examined by a qualified physician or physicians who shall be selected by the committee trustees to determine if such disability has ceased to exist or if the former participant may be employed in an available position for which the participant is reasonably qualified. If the committee trustees finds that the former participant is no longer disabled or is capable of performing service for the employer, the committee trustees may request the former participant to return to the employ of the employer. If the former participant returns to the performance of duty as an employee, he shall again be eligible to participate in the plan. In the event a former participant is no longer disabled or is deemed capable of returning to employment with the employer and he does not return to employment with the employer pursuant to the committee's trustee’s request, he shall forfeit the right to his disability benefit; provided further, that if an employee accepts employment with another employer in an occupation or line of work similar to the occupation or line of work that resulted in the employee being eligible for a disability benefit hereunder, he shall forfeit the right to his disability benefit. 2. A participant who returns to employment with the employer and recommences participation in the plan shall not receive credited service for the period during which he received disability benefits under the plan. c. The cost of the medical examination and/or re-examination of the employee claiming and/or receiving disability benefits shall be borne by the plan. (5) A participant whose employment is terminated by reason of his death in the line of duty shall, for purposes of the plan, be deemed to have been disabled in the 11 line of duty, and the participant's beneficiary shall be entitled to receive a disability benefit as described in paragraph (1) above. (6) If a participant receives a disability benefit under the plan and workers' compensation benefits pursuant to F.S. Ch. 440 for the same disability, and the total monthly benefits received from both exceed 100 percent of the participant's average monthly wage as defined in F.S. Ch. 440, excluding overtime, the disability benefit shall be reduced so that the total monthly amount received by the participant does not exceed 100 percent of such wage. The amount of any lump sum workers' compensation payment shall be converted to an equivalent monthly benefit payable for ten years certain by dividing the lump sum amount by 83.9692. Notwithstanding the foregoing, in no event shall the disability pension benefit of a police officer or firefighter participant be reduced below the greater of 42 percent of average final compensation or two percent of average final compensation times years of credited service. (7) In-line of duty presumptions. a. Presumption. Any condition or impairment of health of a police officer or firefighter participant caused by hypertension or heart disease shall be presumed to have been suffered in line of duty unless the contrary is shown by competent evidence, provided that such participant shall have successfully passed a physical examination upon entering into such service, including cardiogram for police officer or firefighter participants, which examination failed to reveal any evidence of such condition; and provided further, that such presumption shall not apply to benefits payable or granted in a policy of life insurance or disability insurance. b. Additional presumption. The presumption provided for in this paragraph b. shall apply only to those conditions described in this paragraph b. that are diagnosed on or after January 1, 1996. 1. Definitions. As used in this subsection (7)b., the following definitions apply: (i) "Body fluids" means blood and body fluids containing visible blood and other body fluids to which universal precautions for prevention of occupational transmission of blood-borne pathogens, as established by the Centers for Disease Control, apply. For purposes of potential transmission of meningococcal meningitis or tuberculosis, the term "body fluids" includes respiratory, salivary, and sinus fluids, including droplets, sputum, and saliva, mucous, and other fluids through which infectious airborne organisms can be transmitted between persons. 12 (ii) "Emergency rescue or public safety member" means any participant employed full time by the city as a firefighter, paramedic, emergency medical technician, law enforcement officer, or correctional officer who, in the course of employment, runs a high risk of occupational exposure to hepatitis, meningococcal meningitis, or tuberculosis and who is not employed elsewhere in a similar capacity. However, the term "emergency rescue or public safety member" does not include any person employed by a public hospital licensed under F.S. Ch. 395, or any person employed by a subsidiary thereof. (iii) "Hepatitis" means hepatitis A, hepatitis B, hepatitis non-A, hepatitis non-B, hepatitis C, or any other strain of hepatitis generally recognized by the medical community. (iv) "High risk of occupational exposure" means that risk that is incurred because a person subject to the provisions of this subsection, in performing the basic duties associated with his employment: a) Provides emergency medical treatment in a non- health-care setting where there is a potential for transfer of body fluids between persons; b) At the site of an accident, fire, or other rescue or public safety operation, or in an emergency rescue or public safety vehicle, handles body fluids in or out of containers or works with or otherwise handles needles or other sharp instruments exposed to body fluids; c) Engages in the pursuit, apprehension, and arrest of law violators or suspected law violators and, in performing such duties, may be exposed to body fluids; or d) Is responsible for the custody, and physical restraint when necessary, of prisoners or inmates within a prison, jail, or other criminal detention facility, while on work detail outside the facility, or while being transported and, in performing such duties, may be exposed to body fluids. (v) "Occupational exposure," in the case of hepatitis, meningococcal meningitis, or tuberculosis, means an 13 exposure that occurs during the performance of job duties that may place a worker at risk of infection. 2. Presumption. Any emergency rescue or public safety participant who suffers a condition or impairment of health that is caused by hepatitis, meningococcal meningitis, or tuberculosis, that requires medical treatment and that results in total or partial disability or death, shall be presumed to have a disability suffered in the line of duty, unless the contrary is shown by competent evidence; however, in order to be entitled to the presumption, the participant must, by written affidavit as provided in F.S. § 92.50, verify by written declaration that, to the best of his knowledge and belief: (i) In the case of a medical condition caused by or derived from hepatitis, he has not: a) Been exposed, through transfer of bodily fluids, to any person known to have sickness or medical conditions derived from hepatitis, outside the scope of his employment; b) Had a transfusion of blood or blood components, other than a transfusion arising out of an accident or injury happening in connection with his present employment, or received any blood products for the treatment of a coagulation disorder since last undergoing medical tests for hepatitis, which tests failed to indicate the presence of hepatitis; c) Engaged in unsafe sexual practices or other high-risk behavior, as identified by the Centers for Disease Control or the Surgeon General of the United States or had sexual relations with a person known to him to have engaged in such unsafe sexual practices or other high-risk behavior; or d) Used intravenous drugs not prescribed by a physician. (ii) In the case of meningococcal meningitis, in the ten days immediately preceding diagnosis he was not exposed, outside the scope of his employment, to any person known to have meningococcal meningitis or known to be an asymptomatic carrier of the disease. (iii) In the case of tuberculosis, in the period of time since the participant's last negative tuberculosis skin test, he has not 14 been exposed, outside the scope of his employment, to any person known by him to have tuberculosis. 3. Immunization. Whenever any standard, medically recognized vaccine or other form of immunization or prophylaxis exists for the prevention of a communicable disease for which a presumption is granted under this section, if medically indicated in the given circumstances pursuant to immunization policies established by the Advisory Committee on Immunization Practices of the U.S. Public Health Service, an emergency rescue or public safety participant may be required by the city to undergo the immunization or prophylaxis unless the participant's physician determines in writing that the immunization or other prophylaxis would pose a significant risk to the participant's health. Absent such written declaration, failure or refusal by an emergency rescue or public safety participant to undergo such immunization or prophylaxis disqualifies the participant from the benefits of the presumption. 4. Record of exposures. The city shall maintain a record of any known or reasonably suspected exposure of an emergency rescue or public safety participant in its employ to the disease described in this section and shall immediately notify the participant of such exposure. An emergency rescue or public safety participant shall file an incident or accident report with the city of each instance of known or suspected occupational exposure to hepatitis infection, meningococcal meningitis, or tuberculosis. 5. Required medical tests; preemployment physical. In order to be entitled to the presumption provided by this section: (i) An emergency rescue or public safety participant must, prior to diagnosis, have undergone standard, medically acceptable tests for evidence of the communicable disease for which the presumption is sought, or evidence of medical conditions derived therefrom, which tests fail to indicate the presence of infection. This paragraph does not apply in the case of meningococcal meningitis. (ii) An emergency rescue or public safety participant may be required to undergo a preemployment physical examination that tests for and fails to reveal any evidence of hepatitis or tuberculosis. (8) Disability Retirement Process. 15 (a) Upon receipt of a complete application for a disability pension, which includes the most recent medical conclusions known to the applicant at the time of submittal, the trustees shall request and obtain an independent medical evaluation (“IME”). If disabilities are claimed that involve multiple specialties, one IME per specialty shall be selected. Any costs directly or indirectly relating to IME’s shall be paid by the pension plan. (b) After receiving the completed IME report(s), the application and any other records the trustees deem relevant to the application, the city attorney’s office shall either review or arrange for outside legal counsel to review, on behalf of the trustees, the merits of the application. The city attorney’s office, or legal counsel hired by the city attorney’s office for this purpose, shall recommend to the city manager either a stipulated approval or an evidentiary hearing. The city manager shall take the recommendation under advisement and consider any other factors he/she deems relevant to the application and determine on behalf of the trustees whether to enter a stipulated approval, or whether to schedule an evidentiary hearing. If the city manager enters into a stipulated approval, an agenda item shall be brought before the trustees confirming the stipulation. The role of the trustees in said approval shall be ministerial in nature. Upon approval by the trustees, the pension plan shall finalize and distribute the disability pension benefits to which the applicant is entitled. (c) If the city manager opts for an evidentiary hearing, the hearing shall be conducted by the State of Florida Division of Administrative Hearings (“DOAH”). The trustees will enter into a contract with DOAH for this purpose. It shall be the duty of the hearing officer to review the application for a disability retirement, determine whether the claim meets the criteria for awarding a disability pension benefit, and issue a recommended order. (d) During the formal hearing, the applicant and city shall have the right to be heard, to be represented by a person of their choice, and to present evidentiary facts. Each party shall pay its own expense for its representative, counsel, and witnesses. At the formal hearing, the technical rules of evidence shall not apply. The hearing officer shall have the power to administer oaths, issue subpoenas, compel the production of books, papers and other documents and receive evidence. The hearing officer shall utilize a procedure similar to that set forth in F.S. §§ 120.569 and 120.57. The hearing officer shall have no authority to award attorney’s fees to the prevailing party. All recommended orders prepared by the hearing officer shall conform with the requirements for such orders as set forth in F.S. §§ 120.569 and 120.57. The hearing officer shall then transmit the recommended order composed of findings of fact, conclusions of law, and disposition to the trustees. 16 (e). The trustees may adopt the recommended order as the final order. The trustees in its final order may reject or modify the conclusions of law over which it has substantive jurisdiction and interpretation of administrative rules over which it has substantive jurisdiction. When rejecting or modifying such conclusion of law or interpretation of administrative rule, the trustees must state with particularity its reasons for rejecting or modifying such conclusion of law or interpretation of administrative rule and must make a finding that its substituted conclusion of law or interpretation of administrative rule is as or more reasonable than that which was rejected or modified. Rejection or modification of conclusions of law may not form the basis for rejection or modification of findings of fact. The trustees may not reject or modify the findings of fact unless the trustees first determine from a review of the entire record, and states with particularity in the order, that the findings of fact were not based upon competent substantial evidence or that the proceedings on which the findings were based did not comply with essential requirements of law. The trustees may accept the recommendation in the recommended order but may not reduce or increase it without a review of the complete record and without stating with particularity its reasons therefore in the order, by citing to the record in justifying the action. (f). Any party adversely affected shall have the right to have the administrative proceeding reviewed by filing a petition for certiorari with the circuit court of Pinellas County as provided by Rule 9.100 of the Florida Rules of Appellate Procedure. Coding: Words in strikeout type are deletions from existing text. Words in underline type are additions. Section 3: It is the intention of the City Council, and it is hereby ordained that the provisions of this Ordinance shall become and be made a part of the Code of Ordinances of the City Clearwater, that the sections of the Ordinance may be renumbered or relettered to accomplish such intentions; and that the word “Ordinance” shall be changed to “Section” or other appropriate word. Section 4: If any clause, section, or other part or application of this Ordinance shall be held in any court of competent jurisdiction to be unconstitutional or invalid, such unconstitutional or invalid part or application shall be considered as eliminated and shall not affect the validity of the remaining portions or applications which shall remain in full force and effect. Section 5: All ordinances or parts of ordinances, resolutions or parts of resolutions in 17 conflict herewith are hereby repealed to the extent of such conflict. Section 6: This Ordinance shall become effective immediately upon adoption, unless otherwise provided. PASSED ON FIRST READING ____________________ PASSED ON SECOND AND FINAL ____________________ READING AND ADOPTED ____________________________ Bruce Rector Mayor Approved as to form: Attest: _________________________ ____________________________ David Margolis Rosemarie Call City Attorney City Clerk January 9, 2025 Mr. Owen Kohler Lead Assistant City Attorney City of Clearwater - City Attorney’s Office 600 Cleveland Street, Suite 600 Clearwater, Florida 33755 Re: City of Clearwater Employees’ Pension Plan – No Actuarial Impact Letter for Proposed Ordinance Dear Mr. Kohler: We have reviewed proposed ordinance #9813-25, which would amend Sections 2.413 and 2.418 of the City Code to change the disability approval process. Under the new process, the City Attorney’s office will review disability applications and any records the trustees deem relevant and then recommend to the City Manager either a stipulated approval or an evidentiary hearing. The City Manager will then take the recommendation under advisement and determine, on behalf of the trustees, to enter a stipulated approval of the disability application or to schedule an evidentiary hearing. If the City Manager enters a stipulated approval, an agenda item will be brought before the trustees to confirm the stipulation. If the City Manager opts for an evidentiary hearing, the hearing shall be conducted by the State of Florida Division of Administrative Hearings (“DOAH”), and then the DOAH will recommend approval or denial of the disability. The pension trustees may either adopt, reject or modify the recommended order of the DOAH. Following the passage of this Ordinance, we do not expect the number of approved disabilities to change in a material way, as the revised process for seeking disability approval seems fair – this Ordinance simply streamlines and more clearly defines the process. As such, it is our opinion that this Ordinance will not have an actuarial impact on the cost of the Pension Plan. Therefore, a formal Actuarial Impact Statement is not required. We recommend you send a copy of this letter and the ordinance to the Bureau of Local Retirement Systems. Peter N. Strong is a member of the American Academy of Actuaries and meets the Academy’s Qualification Standards to render the actuarial opinion contained herein. The signing actuary is independent of the plan sponsor. Please let us know if there are any questions. Sincerely yours, Gabriel, Roeder, Smith & Company Peter N. Strong, FSA, EA, MAAA, FCA Senior Consultant and Actuary This communication shall not be construed to provide tax advice, legal advice or investment advice. cc: Mr. Jay Ravins, Finance Director Cover Memo City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 File Number: 25-02 & 25-03 Agenda Date: 1/16/2025 Status: Public HearingVersion: 1 File Type: ResolutionIn Control: City Attorney Agenda Number: 7.4 SUBJECT/RECOMMENDATION: Adopt Resolutions 25-02 and 25-03 relating to Council rules. SUMMARY: On December 16, 2024, a supermajority of the City Council directed the City Attorney to update City Council rules regarding the order of business and topics of discussion during council meetings. The City Attorney has drafted a resolution incorporating those changes. A companion resolution updates and clarifies Council decorum rules. Both resolutions are submitted for Council’s consideration. Page 1 City of Clearwater Printed on 1/14/2025 Resolution No. 25-02 RESOLUTION NO. 25-02 A RESOLUTION OF THE CITY OF CLEARWATER, FLORIDA, AMENDING COUNCIL RULES; PROVIDING AN EFFECTIVE DATE. WHEREAS, Section 2.08 of the Clearwater City Charter requires the City Council to determine its own rules and order of business; and WHEREAS, the Courts have ruled that said meetings are considered limited public forums for purposes of First Amendment analyses; and WHEREAS, the purpose of City Council meetings is to conduct an orderly meeting, to receive input from citizens regarding matters on the agenda, and to vote on Council business; and WHEREAS, name-calling against physically present identifiable individuals tends to disrupt meetings by provoking a response from the person(s) targeted by the abusive language; and WHEREAS, any person who prefers to communicate via name-calling retains ample opportunities to do so – for example, by speaking or holding a sign displaying such messages outside the entrance to the building in which the Council meeting is held; and WHEREAS, the Mayor serves as the officer presiding over City Council meetings, pursuant to Section 2.05 of the Clearwater City Charter; and WHEREAS, a citizen’s plea for action should be directed either to the Mayor as the Chair of the meeting, or to the Council as a collegial body, because only the collegial body is authorized under Section 2.01(b) of the Clearwater City Charter to legislate; and WHEREAS, other local government entities have implemented reasonable rules of decorum to facilitate an orderly meeting; now therefore BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF CLEARWATER, FLORIDA: Section 1. Rule 15, Rules of Conduct, be amended as follows: At all times during regular and special City Council meetings, along with meetings of the Pension Trustees, the Council, staff and public shall conduct themselves in accordance with these Rules of Conduct. 2 Resolution 25-02 Because the Council functions as a collegial body, with the Mayor serving as presiding officer, all comments, requests, displays on the overhead projector, and questions shall be directed toward the Mayor or the Council as a collegial body.. In addition, the Council has adopted a non-exclusive list of examples of behaviors that disrupt the meeting and will, in the exercise of reasonable discretion, be ruled out of order by the Mayor. Those disruptive behaviors include: (1) interrupting another citizen, City staff member, or Council member when not recognized; (2) shouting or speaking in a manner that threatens or incites a criminal offense; (3) engaging in or displaying name- calling against a named individual who is present in the room, regardless of whether said individual is a fellow citizen, a City vendor or partner, a member of the media, City staff, or elected official; (4) broadcasting, displaying, or verbalizing obscenity, as defined by the most recent decision(s) of the U.S. Supreme Court and the Eleventh Circuit Court of Appeals; (5) refusing to leave the podium once the allotted time to speak has expired; (6) preventing or attempting to prevent a member of the audience from seeing or hearing Councilmembers; (7) standing on chairs or tables, or attempting to rearrange the City’s seating; (8) bringing signs or banners into the Council meeting room, unless advance permission is obtained from the Mayor and the sign or banner relates solely to an item on the agenda; (9) wearing any article of clothing or accessory that contains obscenity or expressly advocates for the election or defeat of a named individual for any public office, or displaying such materials on the overhead projector; (10) verbally identifying oneself as a candidate for election or reelection to any public office while the person is speaking from the podium or the dais; (11) verbally endorsing a candidate for election or reelection to any public office while the person is speaking from the podium or the dais. When ruling a person out of order, the Mayor shall warn the person that compliance with Rule 15 is required. If the person refuses to correct their behavior, or if the person continues to violate the rule after having already been warned during that same meeting, then the Mayor may either, in the exercise of reasonable discretion, direct the individual to yield the floor, or direct the person to leave the City Council meeting. Upon request by the Mayor, the Clearwater Police Department shall escort the person from the Council Chambers. In such cases, the person shall not be readmitted to the same meeting, but shall be permitted to return to future meetings. The Mayor may also recess the meeting at any time during or after a breach of decorum in order to restore order. To facilitate an orderly meeting, the determination of the Mayor shall be final regarding all decorum matters unless appealed by another Councilmember in the manner and timing described in Robert’s Rules of Order, as amended from time to time. 3 Resolution 25-02 *** Section 2. This resolution shall take effect immediately upon adoption. PASSED AND ADOPTED this _______ day of _____________, 2025. ____________________________ Bruce Rector Mayor Approved as to form: Attest: __________________________ _____________________________ David Margolis Rosemarie Call City Attorney City Clerk 1 Resolution No. 25-03 RESOLUTION NO. 25-03 A RESOLUTION OF THE CITY OF CLEARWATER, FLORIDA, AMENDING COUNCIL RULES; PROVIDING AN EFFECTIVE DATE. WHEREAS, Section 2.08 of the Clearwater City Charter requires the City Council to determine its own rules and order of business; and WHEREAS, the purpose of City Council meetings is to conduct an orderly meeting, and to vote on Council business; and WHEREAS, Florida Statute § 286.0114 entitles the public to be heard regarding a proposition before the City Council prior to the Council voting on said proposition; and WHEREAS, the City Council wishes to devote its regular and special meetings to discussing and hearing citizen perspectives regarding agenda items to be voted on; WHEREAS, the City Council’s rules were last updated via resolution number 24- 15; now therefore BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF CLEARWATER, FLORIDA: Section 1. Rule 6, Council Rules is hereby amended as follows: (1) The order of business for a regular or special meeting of the City Council or Pension Trustees shall ordinarily be: A. Invocation B. Pledge C. Special recognitions and presentations (Proclamations, service awards, or other special recognitions. Presentations by government agencies or groups providing formal updates to Council will be limited to ten minutes.) D. Minutes of previous meetings E. Consent agenda F. Public hearings (not before 6:00 p.m.) Legislative and administrative matters: 2 Resolution No. 25-03 1. Presentation of issues by City staff 2. Statement of case by applicant or representative (5 minutes) 3. Council questions 4. Comments in support and comments in opposition (See subsection (3) below regarding time limitations for speakers.) 5. Council questions 6. Final rebuttal by applicant or representative (5 minutes) 7. Council motion to determine disposition Quasi-judicial Hearings: 1. Staff states its recommendation and briefly summarizes its reasons for the recommendation and submits records (minutes, staff report, and application) adduced before the Community Development Board (2 minutes) 2. Applicant presents case, including its testimony and exhibits (15 minutes) 3. Staff presents further evidence (10 minutes) 4. Public comment (See subsection (3) below regarding time limitations for speakers.) 5. City Council discussion 6. Applicant may call witnesses in rebuttal (5 minutes) 7. Conclusion by applicant (3 minutes) 8. Council motion to determine disposition Second Reading of Ordinances: 1. Public comment (See subsection (3) below regarding time limitations for speakers.) 2. Council motion to determine disposition All time limits may be extended upon request, and if upon approval of request by a majority of the City Council. 3 Resolution No. 25-03 G. City Manager reports H. City Attorney reports I. Council discussion items (work session only) J. Other Council action (if agenda from work session) K. Closing comments by Councilmembers (limited to 3 minutes) L. Closing comments by Mayor *** Section 2. This resolution shall take effect immediately upon adoption. PASSED AND ADOPTED this _______ day of _____________, 2025. ____________________________ Bruce Rector Mayor Approved as to form: Attest: __________________________ _____________________________ David Margolis Rosemarie Call City Attorney City Clerk Cover Memo City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 File Number: ANX2024-10008 2nd rdg Agenda Date: 1/16/2025 Status: Second ReadingVersion: 1 File Type: Planning CaseIn Control: Planning & Development Agenda Number: 8.1 SUBJECT/RECOMMENDATION: Adopt Ordinance 9802-25 on second reading, annexing certain real property whose post office address is 1755 St. Anthony Drive, Clearwater, Florida 33759, into the corporate limits of the city and redefining the boundary lines of the city to include said addition. Page 1 City of Clearwater Printed on 1/14/2025 Ordinance No. 9802-25 ORDINANCE NO. 9802-25 AN ORDINANCE OF THE CITY OF CLEARWATER, FLORIDA, ANNEXING CERTAIN REAL PROPERTY LOCATED ON THE EAST SIDE OF ST. ANTHONY DRIVE APPROXIMATELY 340 FEET SOUTH OF ST. CROIX DRIVE, WHOSE POST OFFICE ADDRESS IS 1755 ST. ANTHONY DRIVE, CLEARWATER, FLORIDA, 33759, INTO THE CORPORATE LIMITS OF THE CITY, AND REDEFINING THE BOUNDARY LINES OF THE CITY TO INCLUDE SAID ADDITION; PROVIDING AN EFFECTIVE DATE. WHEREAS, the owner of the real property described herein and depicted on the map attached hereto as Exhibit “A” has petitioned the City of Clearwater to annex the property into the City pursuant to Section 171.044, Florida Statutes, and the City has complied with all applicable requirements of Florida law in connection with this ordinance; now, therefore, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF CLEARWATER, FLORIDA: Section 1. The following described property is hereby annexed into the City of Clearwater and the boundary lines of the City are redefined accordingly: Lot 5, Block C, Virginia Groves Terrance Fifth Addition, according to the map or plat therefore as recorded as Plat Book 51, Page(s) 43 and 44, of the Public Records of Pinellas County, Florida. (ANX2024-10008) The map attached as Exhibit “A” is hereby incorporated by reference. Section 2. The provisions of this ordinance are found and determined to be consistent with the City of Clearwater Comprehensive Plan. The City Council hereby accepts the dedication of all easements, parks, rights-of-way and other dedications to the public, which have heretofore been made by plat, deed or user within the annexed property. The City Engineer, the City Clerk and the Community Development Coordinator are directed to include and show the property described herein upon the official maps and records of the City. Section 3. This ordinance shall take effect immediately upon adoption. The City Clerk shall file certified copies of this ordinance, including the map attached hereto, with the Clerk of the Circuit Court and with the County Administrator of Pinellas County, Florida, within 7 days after adoption, and shall file a certified copy with the Florida Department of State within 30 days after adoption. Ordinance No. 9802-25 PASSED ON FIRST READING PASSED ON SECOND AND FINAL READING AND ADOPTED Bruce Rector Mayor Approved as to form: Matthew J. Mytych, Esq. Senior Assistant City Attorney Attest: Rosemarie Call, MPA, MMC City Clerk Exhibit “A” PROPOSED ANNEXATION Owner(s): Jonathan Fitts and Contessa Boecker Case: ANX2024-10008 Site: 1755 St. Anthony Drive Property Size(Acres): ROW (Acres): 0.150 Land Use Zoning PIN: 5-29-16-94410-003-0050 From: Residential Urban (RU) R-3, Single Family Residential Atlas Page: 264B To: Residential Urban (RU) Low Medium Density Residential (LMDR) LOCATION MAP Owner(s): Jonathan Fitts and Contessa Boecker Case: ANX2024-10008 Site: 1755 St Anthony Drive Property Size(Acres): ROW (Acres): 0.150 Land Use Zoning PIN: 05-29-16-94410-003-0050 From: Residential Urban (RU) R-3, Single Family Residential Atlas Page: 264B To: Residential Urban (RU) Low Medium Density Residential (LMDR) AERIAL PHOTOGRAPH Owner(s): Jonathan Fitts and Contessa Boecker Case: ANX2024-10008 Site: 1755 St Anthony Drive Property Size(Acres): ROW (Acres): 0.150 Land Use Zoning PIN: 05-29-16-94410-003-0050 From: Residential Urban (RU) R-3, Single Family Residential Atlas Page: 264B To: Residential Urban (RU) Low Medium Density Residential (LMDR) EXISTING SURROUNDING USES MAP Owner(s): Jonathan Fitts and Contessa Boecker Case: ANX2024-10008 Site: 1755 St. Anthony Drive Property Size(Acres): ROW (Acres): 0.150 Land Use Zoning PIN: 05-29-16-94410-003-0050 From: Residential Urban (RU) R-3, Single Family Residential Atlas Page: 264B To: Residential Urban (RU) Low Medium Density Residential (LMDR) Detached Dwellings Detached Dwellings Detached Dwellings Detached Dwellings Detached Dwellings ANX2024-10008 Jonathan Fitts and Contessa Boecker 1755 St. Anthony Drive View looking east at the subject property 1755 St. Anthony Drive Across the street, to the west of the subject property North of the subject property South of the subject property View looking northerly along St. Anthony Drive View looking southerly along St. Anthony Drive Cover Memo City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 File Number: Ord 9803-25 2nd rdg Agenda Date: 1/16/2025 Status: Second ReadingVersion: 1 File Type: Planning CaseIn Control: Planning & Development Agenda Number: 8.2 SUBJECT/RECOMMENDATION: Adopt Ordinance 9803-25 on second reading, amending the future land use element of the Comprehensive Plan of the city to designate the land use for certain real property whose post office address is 1755 St. Anthony Drive, Clearwater, Florida 33759, upon annexation into the City of Clearwater, as Residential Urban (RU). Page 1 City of Clearwater Printed on 1/14/2025 Ordinance No. 9803-25 ORDINANCE NO. 9803-25 AN ORDINANCE OF THE CITY OF CLEARWATER, FLORIDA, AMENDING THE FUTURE LAND USE ELEMENT OF THE COMPREHENSIVE PLAN OF THE CITY, TO DESIGNATE THE LAND USE FOR CERTAIN REAL PROPERTY LOCATED ON THE EAST SIDE OF ST. ANTHONY DRIVE APPROXIMATELY 340 FEET SOUTH OF ST. CROIX DRIVE, WHOSE POST OFFICE ADDRESS IS 1755 ST. ANTHONY DRIVE, CLEARWATER, FLORIDA 33759, UPON ANNEXATION INTO THE CITY OF CLEARWATER, AS RESIDENTIAL URBAN (RU); PROVIDING AN EFFECTIVE DATE. WHEREAS, the amendment to the Future Land Use Element of the Comprehensive Plan of the City as set forth in this ordinance is found to be reasonable, proper and appropriate, and is consistent with the City's Comprehensive Plan; now, therefore, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF CLEARWATER, FLORIDA: Section 1. The Future Land Use Element of the Comprehensive Plan of the City of Clearwater is amended by designating the land use category for the hereinafter described property, upon annexation into the City of Clearwater, as follows: Property Land Use Category Lot 5, Block C, Virginia Groves Terrance Fifth Addition, according to the map or plat therefore as recorded as Plat Book 51, Page(s) 43 and 44, of the Public Records of Pinellas County, Florida. Residential Urban (RU) (ANX2024-10008) The map attached as Exhibit “A” is hereby incorporated by reference. Section 2. The City Council does hereby certify that this ordinance is consistent with the City’s Comprehensive Plan. Section 3. This ordinance shall take effect immediately upon adoption, contingent upon and subject to the adoption of Ordinance No. 9802-25. Ordinance No. 9803-25 PASSED ON FIRST READING PASSED ON SECOND AND FINAL READING AND ADOPTED Bruce Rector Mayor Approved as to form: Matthew J. Mytych, Esq. Senior Assistant City Attorney Attest: Rosemarie Call, MPA, MMC City Clerk Exhibit “A” PROPOSED FUTURE LAND USE MAP Owner(s): Jonathan Fitts and Contessa Boecker Case: ANX2024-10008 Site: 1755 St. Anthony Drive Property Size(Acres): ROW (Acres): 0.150 Land Use Zoning PIN: 5-29-16-94410-003-0050 From: Residential Urban (RU) R-3, Single Family Residential Atlas Page: 264B To: Residential Urban (RU) Low Medium Density Residential (LMDR) LOCATION MAP Owner(s): Jonathan Fitts and Contessa Boecker Case: ANX2024-10008 Site: 1755 St Anthony Drive Property Size(Acres): ROW (Acres): 0.150 Land Use Zoning PIN: 05-29-16-94410-003-0050 From: Residential Urban (RU) R-3, Single Family Residential Atlas Page: 264B To: Residential Urban (RU) Low Medium Density Residential (LMDR) AERIAL PHOTOGRAPH Owner(s): Jonathan Fitts and Contessa Boecker Case: ANX2024-10008 Site: 1755 St Anthony Drive Property Size(Acres): ROW (Acres): 0.150 Land Use Zoning PIN: 05-29-16-94410-003-0050 From: Residential Urban (RU) R-3, Single Family Residential Atlas Page: 264B To: Residential Urban (RU) Low Medium Density Residential (LMDR) EXISTING SURROUNDING USES MAP Owner(s): Jonathan Fitts and Contessa Boecker Case: ANX2024-10008 Site: 1755 St. Anthony Drive Property Size(Acres): ROW (Acres): 0.150 Land Use Zoning PIN: 05-29-16-94410-003-0050 From: Residential Urban (RU) R-3, Single Family Residential Atlas Page: 264B To: Residential Urban (RU) Low Medium Density Residential (LMDR) Detached Dwellings Detached Dwellings Detached Dwellings Detached Dwellings Detached Dwellings ANX2024-10008 Jonathan Fitts and Contessa Boecker 1755 St. Anthony Drive View looking east at the subject property 1755 St. Anthony Drive Across the street, to the west of the subject property North of the subject property South of the subject property View looking northerly along St. Anthony Drive View looking southerly along St. Anthony Drive Cover Memo City of Clearwater Main Library - Council Chambers 100 N. Osceola Avenue Clearwater, FL 33755 File Number: Ord 9804-25 2nd rdg Agenda Date: 1/16/2025 Status: Second ReadingVersion: 1 File Type: Planning CaseIn Control: Planning & Development Agenda Number: 8.3 SUBJECT/RECOMMENDATION: Adopt Ordinance 9804-25 on second reading, amending the Zoning Atlas of the city by zoning certain real property whose post office address is 1755 St. Anthony Drive, Clearwater, Florida 33759, upon annexation into the City of Clearwater, as Low Medium Density Residential (LMDR). Page 1 City of Clearwater Printed on 1/14/2025 Ordinance No. 9804-25 ORDINANCE NO. 9804-25 AN ORDINANCE OF THE CITY OF CLEARWATER, FLORIDA, AMENDING THE ZONING ATLAS OF THE CITY BY ZONING CERTAIN REAL PROPERTY LOCATED ON THE EAST SIDE OF ST. ANTHONY DRIVE APPROXIMATELY 340 FEET SOUTH OF ST. CROIX DRIVE, WHOSE POST OFFICE ADDRESS IS 1755 ST. ANTHONY DRIVE, CLEARWATER, FLORIDA 33759, UPON ANNEXATION INTO THE CITY OF CLEARWATER, AS LOW MEDIUM DENSITY RESIDENTIAL (LMDR); PROVIDING AN EFFECTIVE DATE. WHEREAS, the assignment of a zoning classification as set forth in this ordinance is found to be reasonable, proper and appropriate, and is consistent with the City's Comprehensive Plan; now, therefore, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF CLEARWATER, FLORIDA: Section 1. The following described property located in Pinellas County, Florida, is hereby zoned as indicated upon annexation into the City of Clearwater, and the Zoning Atlas of the City is amended, as follows: The map attached as Exhibit “A” is hereby incorporated by reference. Section 2. The City Engineer is directed to revise the Zoning Atlas of the City in accordance with the foregoing amendment. Section 3. This ordinance shall take effect immediately upon adoption, contingent upon and subject to the adoption of Ordinance No. 9802-25. Property Zoning District Lot 5, Block C, Virginia Groves Terrance Fifth Addition, according to the map or plat therefore as recorded as Plat Book 51, Page(s) 43 and 44, of the Public Records of Pinellas County, Florida. Low Medium Density Residential (LMDR) (ANX2024-10008) Ordinance No. 9804-25 PASSED ON FIRST READING PASSED ON SECOND AND FINAL READING AND ADOPTED Bruce Rector Mayor Approved as to form: Matthew J. Mytych, Esq. Senior Assistant City Attorney Attest: Rosemarie Call, MPA, MMC City Clerk Exhibit “A” PROPOSED ZONING MAP Owner(s): Jonathan Fitts and Contessa Boecker Case: ANX2024-10008 Site: 1755 St. Anthony Drive Property Size(Acres): ROW (Acres): 0.150 Land Use Zoning PIN: 5-29-16-94410-003-0050 From: Residential Urban (RU) R-3, Single Family Residential Atlas Page: 264B To: Residential Urban (RU) Low Medium Density Residential (LMDR) LOCATION MAP Owner(s): Jonathan Fitts and Contessa Boecker Case: ANX2024-10008 Site: 1755 St Anthony Drive Property Size(Acres): ROW (Acres): 0.150 Land Use Zoning PIN: 05-29-16-94410-003-0050 From: Residential Urban (RU) R-3, Single Family Residential Atlas Page: 264B To: Residential Urban (RU) Low Medium Density Residential (LMDR) AERIAL PHOTOGRAPH Owner(s): Jonathan Fitts and Contessa Boecker Case: ANX2024-10008 Site: 1755 St Anthony Drive Property Size(Acres): ROW (Acres): 0.150 Land Use Zoning PIN: 05-29-16-94410-003-0050 From: Residential Urban (RU) R-3, Single Family Residential Atlas Page: 264B To: Residential Urban (RU) Low Medium Density Residential (LMDR) EXISTING SURROUNDING USES MAP Owner(s): Jonathan Fitts and Contessa Boecker Case: ANX2024-10008 Site: 1755 St. Anthony Drive Property Size(Acres): ROW (Acres): 0.150 Land Use Zoning PIN: 05-29-16-94410-003-0050 From: Residential Urban (RU) R-3, Single Family Residential Atlas Page: 264B To: Residential Urban (RU) Low Medium Density Residential (LMDR) Detached Dwellings Detached Dwellings Detached Dwellings Detached Dwellings Detached Dwellings ANX2024-10008 Jonathan Fitts and Contessa Boecker 1755 St. Anthony Drive View looking east at the subject property 1755 St. Anthony Drive Across the street, to the west of the subject property North of the subject property South of the subject property View looking northerly along St. Anthony Drive View looking southerly along St. Anthony Drive