The URL can be used to link to this page

01/29/2018Monday, January 29, 2018 1:00 PM City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 Council Chambers Council Work Session Work Session Agenda January 29, 2018Council Work Session Work Session Agenda 1. Call to Order 2. Presentations Police Oaths2.1 Growing Greatness - Michael A. Grego, Ed.D., Superintendent Pinellas County Schools 2.2 SR60 Study - Sarah Ward, Planning Division Manager, Forward Pinellas2.3 3. Finance Approve an agreement with Commercial Risk Management, Inc., of Tampa, Florida, for the management and administration of workers compensation claims, for a one-year term and three annual renewal terms, pursuant to City Code Section 2.564 (l) (i), services associated with Workers Compensation exempt from bidding; and authorize the appropriate officials to execute same. (consent) 3.1 4. Parks and Recreation Approve funds awarded to the City from Senior Citizens Services, Inc. in the amount of $8,000 to fund educational, cultural and recreational day trips and creative activities for older adults. (consent) 4.1 Ratify and confirm the City Manager’s approval of a contract with Contractor-at-Risk Khors Construction, Inc. of Thonotosassa, FL, in the amount of $196,125.36 to complete the construction of the Jack Russell Memorial Park located at Jack Russell Memorial Stadium and authorize the appropriate officials to execute same. 4.2 5. Police Department Approve an agreement between the City of Clearwater and the School Board of Pinellas County, Florida providing for the continuation of the School Resource Officer program at Clearwater High School, Countryside High School and Oak Grove Middle School for a one-year period, commencing July 1, 2017 through June 30, 2018, and authorize the appropriate officials to execute same. (consent) 5.1 6. Engineering Page 2 City of Clearwater Printed on 1/25/2018 January 29, 2018Council Work Session Work Session Agenda Approve a proposal from Construction Manager at Risk Keystone Excavators Inc., of Oldsmar, Florida, in the amount of $104,555.00 for the construction of Arlie Avenue Stormwater Improvements (17-0068-EN) and authorize the appropriate officials to execute same. (consent) 6.1 Approve a contract and work order to Stantec Consulting Services Inc., of Tampa, Florida, in the amount of $834,238 for Imagine Clearwater design Phase I (17-0031-EN), and authorize the appropriate officials to execute same. (consent) 6.2 7. Planning Approve a funding agreement between the City of Clearwater and the Pinellas Suncoast Transit Authority (PSTA) to provide enhanced Jolley Trolley service during Spring Break, for period February 19, 2018 through April 29, 2018, with the City contributing a lump sum not to exceed $65,000; and authorize the appropriate officials to execute same. (consent) 7.1 8. Public Utilities Approve an Interlocal Agreement between the City of Clearwater and Pinellas County for Flow Monitoring Equipment and authorize the appropriate officials to execute same. (consent) 8.1 9. Solid Waste Approve a purchase order to Coastal Alternative Fuel Systems in Odessa, FL, in the amount of $130,000.00 for Ford vehicle up-fitting services (CNG Conversion); in accordance with City Code Section 2.564(b) Exceptions to Bid; and authorize the appropriate officials to execute same. (consent) 9.1 Approve the award of Invitation to Bid Number 27-17, Vehicle Upfitting Services to Enforcement One, Inc., of Oldsmar, Florida, in the amount of $250,000 for upfitting services; and authorize the appropriate officials to execute same. (consent) 9.2 10. Legal Adopt Ordinance 9092-18 on second reading, amending the future land use plan element of the Comprehensive Plan of the city to change the land use designation for certain real property whose post office address is 1005 Old Coachman Road, Clearwater, Florida 33765, from Recreation/Open Space (R/OS) to Transportation/Utility (T/U). 10.1 Page 3 City of Clearwater Printed on 1/25/2018 January 29, 2018Council Work Session Work Session Agenda Adopt Ordinance 9093-18 on second reading, amending the Zoning Atlas of the city by rezoning certain real property whose post office address is 1005 Old Coachman Road, Clearwater, Florida 33765, from Open Space/Recreation (OS/R) to Institutional (I). 10.2 Adopt Ordinance 9094-18 on second reading, amending the future land use plan element of the Comprehensive Plan of the city to change the land use designation for certain real property whose post office address is 1528 Lakeview Road, Clearwater, Florida 33756, from Residential Low (RL) and Residential High (RH) to Residential/Office General (R/OG). 10.3 Adopt Ordinance 9095-18 on second reading, amending the Zoning Atlas of the city by rezoning certain real property whose post office address is 1528 Lakeview Road, Clearwater, Florida 33756, from Low Medium Density Residential (LMDR) and High Density Residential (HDR) to Office (O). 10.4 Adopt Ordinance 9097-18 on second reading, amending the future land use plan element of the Comprehensive Plan of the city to change the land use designation for certain real property whose post office address is 720 Tuskawilla Street, Clearwater, Florida 33756, from Residential/Office General (R/OG) to Institutional (I). 10.5 Adopt Ordinance 9098-18 on second reading, amending the Zoning Atlas of the city by rezoning certain real property whose post office address is 720 Tuskawilla Street, Clearwater, Florida 33756, from Office (O) to Institutional (I). 10.6 Adopt Ordinance 9099-18 on second reading, amending the future land use plan element of the Comprehensive Plan of the city to change the land use designation for certain real property whose post office address is 1524 South Highland Avenue, Clearwater, Florida 33756, from Residential Low (RL) to Residential/Office General (R/OG). 10.7 Adopt Ordinance 9100-18 on second reading, amending the Zoning Atlas of the city by rezoning certain real property whose post office address is 1524 South Highland Avenue, Clearwater, Florida 33756, from Low Medium Density Residential (LMDR) and Office (O) to Medium Density Residential (MDR). 10.8 Continue second reading of Ordinance 9101-18 to April 19, 2018, relating to a Future Land Use Map Amendment from the Residential/Office General (R/OG) category to the Commercial General (CG) category for 300 South Duncan Avenue. 10.9 Continue second reading of Ordinance 9102-18 to April 19, 2018, relating to a Zoning Atlas Amendment from the Office (O) District to the Commercial (C) District for 300 South Duncan Avenue. 10.10 Page 4 City of Clearwater Printed on 1/25/2018 January 29, 2018Council Work Session Work Session Agenda Continue second reading of Ordinance 9103-18 to March 1, 2018 making amendments to the Clearwater Downtown Redevelopment Plan repealing and replacing Chapters 1-3 which update goals, objectives and policies; increasing density and intensity and revise height; modifying Character District boundaries; and expanding the Old Bay Character District boundaries northward. 10.11 11. City Manager Verbal Reports Downtown Merchant Petition on Parking11.1 12. City Attorney Verbal Reports 13. Council Discussion Item Fence Landscaping - Councilmember Jonson13.1 LED Light Conversion - Councilmember Jonson13.2 Quarterly Project Update through Dec 31, 2017 - Councilmember Jonson13.3 Historic, Old and Authentic - Councilmember Jonson13.4 Winter Park Experience - Councilmember Jonson13.5 14. New Business (items not on the agenda may be brought up asking they be scheduled for subsequent meetings or work sessions in accordance with Rule 1, Paragraph 2). 15. Closing Comments by Mayor 16. Adjourn 17. Presentation(s) for Council Meeting Chi Chi Rodriguez Foundation - Tom James, Board Chair17.1 USA Softball - Ken Ericksen, USA Softball National Team Head Coach17.2 Outback Bowl Beach Day - Mike Schulze, Director of Communications and Sponsorships 17.3 2017 Florida School Crossing Guard Program/Agency of the Year17.4 Page 5 City of Clearwater Printed on 1/25/2018 Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: ID#18-4240 Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: PresentationIn Control: Council Work Session Agenda Number: 2.1 SUBJECT/RECOMMENDATION: Police Oaths SUMMARY: Kyle Bingham Justin Buis Joel Delatorre-Catellanos Michael Diaz Johan Waterman Ortiz Stephen Warrior APPROPRIATION CODE AND AMOUNT: USE OF RESERVE FUNDS: Page 1 City of Clearwater Printed on 1/25/2018 Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: ID#18-4263 Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: PresentationIn Control: Council Work Session Agenda Number: 2.2 SUBJECT/RECOMMENDATION: Growing Greatness - Michael A. Grego, Ed.D., Superintendent Pinellas County Schools SUMMARY: APPROPRIATION CODE AND AMOUNT: USE OF RESERVE FUNDS: Page 1 City of Clearwater Printed on 1/25/2018 Growing Greatness One Student at a Time Michael A. Grego, Ed.D. Superintendent Pinellas County Schools 71.96% 71.89% 76.10% 78.30% 80.10% 82.90% 66.00% 68.00% 70.00% 72.00% 74.00% 76.00% 78.00% 80.00% 82.00% 84.00% 2012 2013 2014 2015 2016 2017 GRADUATION RATE Graduation Rate Eight Largest School Districts in Florida District 2016-17 % Point / Change Over 5 Years Palm Beach 85.0% 8.7% Orange 84.7% 8.8% Pinellas 82.9% 11.0% Hillsborough 82.9% 8.8% Broward 81.0% 5.7% Duval 80.8% 8.7% Dade 80.7% 3.5% Polk 75.4% 6.0% State 82.3% 6.7% 5 9,069 10,233 10,920 11,517 12,765 0 2,000 4,000 6,000 8,000 10,000 12,000 14,000 2013 2014 2015 2016 2017 Number of AP Exams Taken Exams Taken Trendline 40.8% increase since 2013 6 4,049 4,387 4,640 5,147 5,769 0 1,000 2,000 3,000 4,000 5,000 6,000 7,000 2013 2014 2015 2016 2017 Number of Exams with a Score of 3, 4 or 5 Exams with scores of 3, 4 or 5 Trendline 42.3% increase since 2013 7 11th Grade PSAT and SAT 10th Grade PSAT/NMSQT 9th Grade PSAT/NMSQT 8th Grade PSAT 8/9 7th Grade Talent Identification Program SAT College Board SAT Suite of Assessments 11,956 AP, IB, Dual Enrollment or Cambridge AICE $12,418,725.60 20,781 (college courses) x $597.60 (average cost of 3-credit class at public 4-year university in Florida) = $12,418,725.60 Saving Students & Families 20,781 Participating Students College Level Courses 8 Pinellas $43,000 Sarasota $42,000 Collier* $41,280 Miami-Dade* $40,800 Polk* $40,672 Duval* $40,300 Osceola $40,100 Lee $40,000 Orange $39,500 Pasco* $38,650 Hillsborough* $38,200 Starting Instructional Salary *Negotiations for 2017-2018 have not been finalized. 9 10 11 Year Number of Industry Certifications 2016-2017 12,915 2015-2016 10,357 2014-2015 7,517 2013-2014 4,135 2012-2013 3,815 2011-2012 2,222 Growth in Career Academies and Industry Certifications Pinellas Technical High School – Seminole Pinellas Technical College Pinellas Technical College - Clearwater Renderings of Tarpon Springs High School, Pinellas Park Middle School and Melrose Elementary School 16 Elementary School Science Labs Grades 2-5 Growing Greatness One Student at a Time Michael A. Grego, Ed.D. Superintendent Pinellas County Schools PINELLAS COUNTY SCHOOL BOARD Peggy L. O' Shea - Chairperson Rene Flowers - Vice Chairperson Carol J. Cook Terry Krassner Joanne Lentino Linda S. Lerner Eileen Long Dr. Michael A. Grego - Superintendent PINELLASCOUNTYSCHOOLS DISTRICTSTRATEGICPLAN2017- 2018PINELLASCOUNTYSCHOOLS, clv PINELLAS COUNTY SCHOOLS 2 Printed October 2017 PINELLAS COUNTY SCHOOLS 23 Model for Successful Strategic Plan Implementation Strategic Planning ID Vision, Mission, Values, Strategic Directions ( 5), Strategic Goals ( 7) and Performance Indicators WHAT) ID IyAction Goals and Projects HOW) ImprovementActivitiesAdjust Action Goals Revise Project Action Plans Provide PD r Project Management Choose Annual Agenda of ProjectsDevelop Project Action PlansLaunch and Manage ProjectsSTUDYPeriodic Plan Checks Review Leading Indicators Assess Project Progress Determine Changes Needed J Pinellas County School Board Our District Strategic Plan is comprised of the vision, mission, values, strategic directions and goals for Pinellas County Schools. Our Strategic Plan is a dynamic, active document that guides decision- making at the school and District levels. Annually, our Strategic Plan is developed and approved in conjunction with the District' s budget. The goals of the Strategic Plan are the focus and driving force of the District with all other plans, resources, programs and initiatives affecting the plan year supporting these goals. Input into the District Strategic Plan includes analysis of student, school and District performance, a review of progress on last year' s Strategic Plan, requirements of state and federal legislation, content from the state strategic plan and recommendations from District and school staff, focus groups, partners, stakeholders, research, as well as our input as School Board members. This District Strategic Plan is for all of us as it is designed to bring together the most important efforts that define our success. Our intent is that everyone in the District understands the Strategic Plan, finds their role in the plan and works to accomplish the goals of the plan in order to achieve our vision of 100% Student Success. Dr. Michael A. Grego Linda Lerner Rene Flowers Joanne LentinoPeggy L. 0' Shea Eileen Long Terry Krassner Carol Cook 3 Table of Contents/ Overview Overview 4 Vision, Mission, Values 5 Strategic Directions 6 Strategic Goals 7 Goal 1 8 Goal 2 10 Goal 3 12 Goal 4 14 Goal 5 16 Goal 6 18 Goal 7 20 Overview The District Strategic Plan is founded on the vision, mission, values, strategic directions and strategic goals of Pinellas County Schools. To accomplish the plan and its longer- term strategic goals, aligned shorter - term action goals are developed and owned by administrators who manage and monitor the work structured to achieve the strategic goals. These action goals are reviewed and revised annually and are used as the basis for Department Improvement Plans and School Improvement Plans. This cascaded system of strategic goals, action goals, and Department or School Improvement Plans engages all from the classroom to the Board room in accomplishing the District' s vision, mission and core values. 4 Provide quality technology and business services to optimize operations, communications and academic results. Action Goals: 8) Continue the Superintendent' s focus group meetings for teachers, staff, community members, and administrators to gather input and feedback as it relates to student achievement, instruction and District' s continuous improvement efforts. 9) Ensure that each school has an updated brochure identifying leadership and major accomplishments, programs, and needed parent information. 10) Develop a process for using site analytics and stakeholder feedback to drive decisions on District/ school website content delivery and design. 11) Enhance and create promotional strategies focused on educating and engaging stakeholders and promoting areas where Pinellas County Schools is a regional, state, and national leader for quality teaching, learning, and student achievement. 12) Provide customized training solutions to school and department leaders that increase the effectiveness of their communication processes with internal and external stakeholders. 13) Expand course offerings and professional development/ technical support for distance leaming lab teachers in order to provide the necessary opportunity for students to eam their online course credit required for graduation and to increase FTE eamed by PVS by at least 10% until PVS becomes self- sufficient. Highlights in 2016- 17 The Beyond the Classroom initiative provides students free access to online educational resources. A related initiative, Connect for Success, provided laptop computers to 5, 960 students at 45 high - poverty elementary schools for home use in 2016- 17. Pinellas County Schools developed and launched a new School Profiles dashboard as part of updating real- time data for schools, including academic, behavior and attendance metrics. Pinellas County Schools promotes major initiatives, announcements and news items through the Newsroom, district website, videos, newsletters and social media. More than 11. 8 million site visitors accessed the website and more than 350 stories were published online during the 2016- 17 school year. Pinellas County Schools developed and produced Inspiring Teacher videos, called IT Factor, in the 2016- 17 school year. The Strategic Communications team produced the IT Factor segments every week for the entire school year so students, staff and stakeholders could see the amazing work of teachers. STRATEGICGOAL 7 21 STRATEGICGOAL7 20 Provide quality technology and business services to optimize operations, communications and academic results. Action Goals: 1) Maintain a District dashboard of Key Performance Indicators forthe communication of District data to inform the Board, administrators, teachers, staff and the public on the District' s progress. 2) Ensure the computer refresh model meets the needs of each school for curriculum, credit recovery, common assessments, and state/ standardized assessments. 3) Purchase and implement Enterprise Resource Planning ( ERP) software to improve the efficiency of our business practices and to enhance our productivity. 4) Implement the 2017- 18 Pinellas County Digital Classroom Plan to outline digital learning and student performance outcomes for progress in digital leaming. 5) Provide interactive technology in all classrooms to strengthen teaching, leaming and improve student achievement. 6) Continue the communication and number of offerings of the Superintendent' s Annual State of the District event to address community leaders of the progress on the District Strategic Plan. 7) Continue the Superintendent' s Educator of the Year Teacher Task Force to provide input and feedback as it relates to student achievement, instruction, and the District' s continuous improvement efforts. Vision, Mision, Values VISION100% Student Success MISSIONEducate and prepare each studentfor college, career and life CORE VALUESCommitment to Children, Families and Community Making decisions and committing resources to attain each student' s succes Seeking out and connecting with families and community Respectful and Caring Relationships Establishing positive relationships among all stakeholders Using the district vision to guide intentions, motives and actions Cultural CompetenceUnderstanding individual differences and capitalizing on the beneficial valuethese differences bring to our school District Honoring the values, rights and responsibilities of each individual IntegrityMaintaining the highest standards of behavior, ethics, fairness andhonesty with ourselves and others Committing to doing the right things for the right reasons Demonstrating fairness in our judgments and actions ResponsibilityFulfilling commitments and promises through fact - based decision- making and problem solving Taking ownership of our own behaviors Seeking opportunities for continuous improvement ConnectednessTeaming through internal and external partnerships by aligning efforts for the common purpose of each student' s success Willing to share and transfer knowledge with others 5 Strategic Directions Strategic Direction 1 - Student Achievement Strategic Direction 2 - Learning in a Safe Environment Strategic Direction 3 - Equity with Excellence for All Strategic Direction 4 - Career- and College - Readiness Strategic Direction 5 - Effective and Efficient Use of Resources 6 Develop and sustain effective and efficient use of all resources for improved student achievement and fiscal responsibility. Action Goals: 9) Decrease the number of vacant teacher positions daily in each school from the first day of school and improve teacher attendance overall. 10) Decrease the number of unfilled substitute positions daily in each school from the first day of school by monitoring the substitute fill rate. 11) Improve the review and processing of FTE data, including transportation records, to ensure the District receives all FTE monies entitled. 12) Ensure any audit comments are corrected within a calendar year. 13) Examine all new state mandates to determine funding sources and identify significant unfunded mandates as a part of the District' s legislative efforts. 14) Ensure that the budget process includes steps that incorporate appropriate stakeholders and a timely sequence of all essential components. 15) Monitor School Improvement Plans ( SIP) for alignment of goals, action plans, professional development and budget with the District Strategic Plan ensuring that strategies are capable of increasing student achievement and closing any gaps. 16) Incorporate the AdvancED Report in the District Strategic Plan and in school, department and work site plans to ensure accomplishment of Priority Improvement plans, maintain successful Powerful Practices and prepare for the 2020 re- accreditation. 17) Monitor the progress on the plans forTumaround schools for 2017- 18 and communicate improvements forTumaround Schools. Highlights in 2016- 17 Pinellas County Schools continues to maintain districtwide AdvancED Accreditation Commission' s Systems Accreditation. This globally recognized distinction of quality is the highest level of accreditation a school system can receive from the organization. In May 2017, Pinellas County Schools engaged in a progress assessment process and, based on the AdvancED findings, the district has demonstrated growth meeting or exceeding expectations in all areas. Pinellas County Schools continues to ensure new/ retrofit buildings and maintenance activities comply with state standards for sustainability. The Largo High School building, opened in the 2016- 17 school year, met all green requirements for sustainability in accordance with Green Globes standards. Pinellas County Schools increased its contingency fund from 3. 3% in 2013- 14 to 4. 5% in 2014- 15. The fund continued to climb to 5% in 2015- 16 and 5. 4% in 2016- 17. STRATEGICGOAL 6 19 Strategic Goal STRATEGICGOAL6 18 Develop and sustain effective and efficient use of all resources for improved student achievement and fiscal responsibility. Action Goals: 1) Ensure that 100% of all Title land IDEA expenditures can be correlated with student growth scores or leaming gains using reviews of progress monitoring data with school staff to track student progress and make necessary adjustments. 2) Review, evaluate and enhance the District Application Program process ( School Choice Option) including application, student selection, selection of offerings and locations resulting in positive family feedback. 3) Increase and promote the opportunities for school choice in the District by offering an engaging curriculum, competitive school programs, and attractive campuses selected by parents and students. 4) Continue to reduce the number of Portable Classrooms to keep students in the main school building( s). 5) Maintain and continuously improve the established process for class size as measured by the number of schools meeting class size. 6) Improve and document the process for allocation of units at schools and District work sites including evidence of school - level autonomy over staffing, scheduling and budgeting to support student achievement. 7) Provide safe, healthy and efficiently operated schools including the recommended Green" initiatives and sustainable design certifications in new construction, retrofits and maintenance activities. 8) Provide safe and efficiently operated bus transportation to ensure the success of our students by increasing on time performance, reducing accidents, breakdowns and fuel costs. 20181614121086420 Pinellas County Schools State Accountability Data of Schools in State Turnaround Status 2015 5 2016 2017 Strategic Goals Strategic Goal 1 Increase student achievement resulting in improvements for each school' s learning gains, grade level proficiency rates, graduation rates, and school grade designations of A, B or C. Strategic Goal 2 Ensure curriculum, instruction, and assessment are designed and delivered with a focus on content rigor, student engagement, and continuous improvement of academic achievement. Strategic Goal 3 Develop and sustain a healthy, respectful, caring, safe learning environment for students, faculty, staff, and community resulting in individual employee learning, student achievement and overall school improvement. Strategic Goal 4 Provide equity and excellence of education by increasing overall performance and eliminating the gaps between minority and non - minority student outcomes by reducing the disparity in graduation rates, proficiency scores on assessments, participation and performance in accelerated courses, disciplinary infractions, and placement in Exceptional Student Education programs. Strategic Goal 5 Achieve the District' s mission for college and career - readiness for all students by adopting high quality standards, interdisciplinary curriculum content, aligned instructional practices, appropriate student supports, necessary resource allocations, and parent and community engagement. 6 Develop and sustain effective and efficient use of all resources for improved student achievement and fiscal responsibility. Strategic Goal 7 Provide quality technology and business services to optimize operations, communications and academic results. 7 STRATEGIC GOAL 1 Increase student achievement resulting in improvements for each school' s learning gains, grade level proficiency rates, graduation rates and school grade designations of A, B or C. Action Goals: 1) Increase successful promotion rates to achieve 95% for each grade K- 11 and each student subgroup. 2) Increase graduation rates for each student group leading to the achievement of at least 85% district wide graduation rate and increase the standard diploma graduation rates of students qualifying for ESE services to at least 70%. 3) Increase the performance of the K- 8 gifted students by subgroup on state required assessments to surpass the state average for gifted students scoring at least Level 4. 4) Increase the percentage of K - 12th grade English Language Leamers ( ELL) who achieve proficiency on the required state assessments in ELA, math, and science. 5) Increase the percentage of K - 12th grade Exceptional Student Education ( ESE) students who achieve proficiency and learning gains on the required state assessments in ELA, math, and science. 6) Increase ELA proficiency rates for each subgroup at each grade level to exceed the state average using Florida Standards Assessment comparisons. 7) Eliminate gender achievement gaps in ELA as measured by ELA standardized assessments in grades K- 5. 8) Increase mathematics proficiency rates for each subgroup at each grade level to exceed the state average using Florida Standards Assessment comparisons. 9) Increase the percentage of students scoring proficient on Science Standards Assessment in grade 5 and 8 and the Biology EOC to exceed the state average by at least 5%. Increase the percentage of students scoring proficient on the US History EOC and Civics EOC to exceed the state average by at least 3%. Increase participation and scores for Music Performance Assessments ( MPA), All - State Auditions and Ensemble Participation, Thespian Festival events and participation and music achievement levels for elementary music. Increase participation in and selections for Visual Arts exhibits and participation and passing scores for AP Art courses. Increase the percentage of freshmen eaming at least 6 credits by the end of freshman year and the percent of freshmen maintaininga 2. 0 minimum Grade Point Average GPA) to 85% by continuing to implement and monitor a District - wide freshmen orientation and mentoring system to ensure that the transition of students from middle school to high school is successful. 14) Increase the District average in Accelerated Performance in middle and high school to at least 80% by 2020. 8 Achieve the District' s mission for career- and college - readiness for all students by adopting high quality standards, interdisciplinary curriculum content, aligned instructional practices, appropriate student supports, necessary resource allocations, and parent and community engagement. Action Goals: 10) Increase the percentage of graduates who meet the College and Career Readiness benchmarks ( SAT Suite of Assessments) and provide the guidance and instruction necessary to expand eligibility for FL Bright Futures. Targets include: i. 90% of students in grades 8- 10 participate in PSAT School Day ii. 30% of students in grade 11 participate in PSAT/ NMSQT iii. 90% of students in grade 11 participate in SAT School Day iv. 3% increase in the students recognized as National Merit Semifinalists and Hispanic Scholars v. 3% increase in graduates meeting the SAT Evidence - Based Reading and Writing College Readiness Benchmark vi. 3% increase in graduates meeting the SAT Mathematics College Readiness Benchmark vii. 3% increase in graduates who achieve qualifying scores for FL Bright Futures Academic and Medallion scholarship awards 11) Maintain AVID Site Certification for 35 traditional secondary schools and continue to expand AVID Elementary to at least two additional sites per year. 12) Increase the percentage of students with disabilities who are found to be ( 1) enrolled in higher education, or ( 2) competitively employed, or ( 3) enrolled in any other postsecondary education or training program or employed in some other employment in the year followingtheir exit from public school to surpass the state average for students with disabilities as reported by the Florida Education and Training Placement Information Program ( FETPIP) data. 13) Increase the enrollment of PCS graduates who show an interest in Pinellas Technical College by 10%. 14) Increase the percentage of 8th grade students who have a completed four year high school plan to 100%. 15) Increase the percentage of seniors who meet the standardized test eligibility and community service requirement for Medallion and Academic Bright Futures. 16) Increase the percentage of graduating seniors who are eligible for Bright Futures with a completed Florida Financial Aid Application to 100%. 17) Increase the number of students with a completed Free Application for Federal Student Aid ( FAFSA) to 40% District - wide. 18) Increase the percentage of graduating seniors applying to a four year post - secondary institution by 5%. 19) Build parent and community awareness of the importance of College and Career Readiness through public " town hall" style sessions. 20) Increase the percentage of students who take the PSAT and have a linked account between College Board and SATpractice. orgto 100%. 21) Increase the percent of graduating seniors with a completed Pinellas Education Foundation Scholarship Application by 5% at every high school. STRATEGIC GOAL 5 17 STRATEGICGOAL5 Achieve the District' s mission for career- and college - readiness for all students by adopting high quality standards, interdisciplinary curriculum content, aligned instructional practices, appropriate student supports, necessary resource allocations, and parent and community engagement. 16 Action Goals: 1) Increase the number of college credits eamed by graduating seniors by at least 3% by increasing the number of AP, IB and AICE exam scores that articulate to college credit and the number of dual enrollment college credits eamed. 2) Increase the percentage of graduates who eam a nationally/ internationally recognized diploma ( AICE, AP Capstone, IB) or an Associate Degree to at least 10%. 3) Increase overall secondary student participation in advanced and accelerated courses by 3%. 4) Increase yearly the number and percentage of students eaming industry certifications to enable each school to reach 50% of graduates receiving industry certification by 2020. 5) Administer Future Plans to ensure 100% of graduating seniors will graduate with a plan for post - secondary education. 6) Increase the percentage of high school students demonstrating potential for success in an Advanced Placement ( AP) course and completing at least one AP course in high school to 90%. 7) Increase the number of students participating in youth pre - apprentice work - based teaming programs in all appropriate occupational areas with an emphasis on high demand occupations. 8) Increase the number of industry/ corporate advisory committees for all high school career technical programs of study ensuring all career technical programs of study have an industry/ corporate advisory committee. 9) Increase the number of feeder middle school academy programs to Academies of Pinellas high school programs. Career and Technical Education Growth 20, 000 15, 000 10, 000 5, 0000 Industry Certifications — U— Academy Enrollment 13. 492 13, 680 11, 776 7, 517 4, 135 10. 194 16, 020 13, 234 2013- 14 2014- 15 2015- 16 2016- 17 Increase student achievement resulting in improvements for each school' s learning gains, grade level proficiency rates, graduation rates and school grade designations of A, B or C. Action Goals: 15) Increase the percentage of District VPK students who score at or above the state set requirements as measured by the VPK Assessment for each assessment period Assessment Period 2, Assessment Period 3). 16) Increase the percentage of District Pre - K Students With Disabilities ( SWD) who score at or above grade level to 85% as measured by the GOLD Assessment. 17) Increase the number of high quality Pre - K classrooms in Pinellas County and the percentage of students that are prepared for kindergarten through participation and collaboration with other agencies in the Kindergarten Readiness Collaborative. 18) Use yearly comparisons of Measures of Academic Progress ( MAP) results for grades K- 2 to determine readiness for grades 1, 2 and 3 as measured by the percentage of students performing at progressively higher Rasch Unit Scale ( RIT) scores. 19) Increase the number of AVID students that demonstrate success on all three school grade indicators by 10%. 20) Increase District attendance rate of 95% for all schools and conduct attendance monitoring for students missing 10% or more days in order to reduce the number of students missing 10% or more days of school by 5%. 21) Increase completion rates for students enrolled in Pinellas Virtual School from 65% to 80% to accelerate or maintain grade level performance. Highlights in 2016- 17 Students showed improvements over the last three years in reading and language arts ( writing) proficiency rates across elementary and middle schools. FSA English/ Language Arts results for 2016- 17 show increases in performance from 3rd through 8th grade, with the strongest improvement seen in 8th grade. Students demonstrated significant improvements over the last three years in mathematics proficiency rates at various grade levels. FSA Mathematics results for 2016- 17 show increases in performance from 3rd through 10th grades, with Algebra I and Algebra II results showing the strongest improvement. All student subgroups in Pinellas County Schools have trended positively in graduation rates, and the overall district graduation rate increased 8. 1 percentage points since 2011 to 80. 1% in 2015- 16. The 2016- 17 Graduation Rate will be released by the Florida Department of Education in December 2017. Nearly half of all schools have an A or B rating and 92. 1% have an A, B, or C as rated by the Florida Department of Education' s accountability system. In 2016- 17, seven schools improved to an A and eleven schools improved to a B. STRATEGICGOAL1 9 STRATEGIC GOAL 2 10 Ensure curriculum, instruction and assessment are designed and delivered with a focus on content rigor, student engagement and continuous improvement of academic achievement. Action Goals: 1) Increase the percentage of standards- based instruction with rigorous tasks, student - centered classrooms, and differentiation of teaching and leaming as measured by evidence collected during ISM visits. 2) Improve implementation of District - developed curriculum guides in all subject areas through professional development support to classroom teachers. 3) Ensure effective instructional decisions by collecting data during ISM visits to support the development of effective lesson plans, demonstrate the use of cycle assessments aligned to Florida Standards in ELA, math and science at all levels as demonstrated in the District assessment plan and the use of improved lesson plans. 4) Develop a repository of exemplary lesson plans by subject, standard and grade level. 5) Analyze Summer Bridge pre - post assessment data to ensure students demonstrate academic growth throughout the summer. 6) Increase enrollment and attendance of targeted students participating in Summer Bridge to ensure increased opportunities for improving proficiency levels. 7) Increase participation in District - wide summer reading and math programs for students and schools. 8) Increase participation in Beyond the Classroom activities for all students by monitoring usage reports for students and schools. 9) Reduce the number of students who are overage and are academically behind two to three years through the implementation of targeted interventions and monitoring systems. 10) Increase the proficiency in core academic courses and courses recovered by monitoring and improving Extended Learning Programs ( academic remediation and/ or academic enrichment) in all schools. Provide equity and excellence of education by increasing overall performance and eliminating the gaps between minority and non - minority student outcomes by reducing the disparity in graduation rates, proficiency scores on assessments, participation and performance in accelerated courses, disciplinary infractions and placement in Exceptional Student Education programs. Action Goals: 11) Ensure all schools have approved, research based, and fully operational behavior plans that include teachers and staff training to assure effective implementation and the use of best practices to reduce minority student referrals and in- and out- of school suspension rates. 12) Develop, implement and monitor plans to decrease minority student absences by executing an incentive program and other efforts to increase daily attendance and decrease the number of students missing 10% or more days of school. 13) Engage parents and the community in efforts of the District to close minority and non - minority student outcome gaps. 14) Increase access to data tracking systems and reports for minority student outcomes to monitor efforts and guide users on how to access the information for decision- making, closing gaps, and reducing disparity among subgroups. 15) Increase the percentage of minority and socio - economically disadvantaged students who complete an industry certification. 16) Implementthe comprehensive action plan to support school leaders and teachers in incorporating Culturally Responsive Instructional strategies that accelerate academic achievement and close the gap for minority students. 17) Increase teacher recruitment and retention efforts to ensure faculty diversity mirrors the student population by recruiting at institutions noted for graduating Black, Hispanic and other needed educators; mentoring teachers; providing incentives; and hosting job fairs to ensure minority educator percentages represent the District minority population percentages. STRATEGIC GOAL 4 95 90 85 80 75 70 65 60 55 50 Pinellas County Schools / Graduation Rate 5 - Year Trend 5 - Year Change 8. 1% Increase ! ALL 10. 9% Increase / BLACK 15. 1% Increase/ HISPANIC 72. 0 71. 9 602 62. 6 76. 2 78. 3 80. 1 54. 6 56. 4 2012 2013 712 60. 7 75. 1 64. 6 75. 3 65. 5 2014 2015 2016 10— All Students — 0— Black Students — 0— Hispanic Students PCS / Assessment, Accountability and Reasearch Department 15 STRATEGICGOAL4 Provide equity and excellence of education by increasing overall performance and eliminating the gaps between minority and non - minority student outcomes by reducing the disparity in graduation rates, proficiency scores on assessments, participation and performance in accelerated courses, disciplinary infractions and placement in Exceptional Student Education programs. Action Goals: 1) In recognition of the District' s ongoing commitment to its African- American community and as further described in the Bridging the Gap plan, the District shall: 1. Eliminate the gap between the graduation rate for black and non - black students. ii. Eliminate the gap between the proficiency rates on state required assessments for black and non - black students. iii. Eliminate the gap between accelerated participation and performance rates for black and non - black students. Reduce the disparity in the rates of disciplinary infractions between black and non - black students. Reduce the number of black students being found eligible for Exceptional Student Education programs. Increase the number of black teachers and administrators to closely mirror the student enrollment by ethnicity. Increase the number of K - 12th grade minority students who score on or above grade level on the Florida Standards state test and End of Course ( EOC) exams in reading, math, and science by providing needed resources, research - based strategies, and needed support to students, teachers, and staff. 3) Increase the enrollment of minority students in effective PreK programs and the percentage of minority students who score at or above the state set requirements on the VPK assessment ( AP2, AP3). 4) Increase the percentage of minority and socioeconomically disadvantaged students enrolled in 6th grade Advanced level or higher courses focusing on Math, Science, and ELA by 5%. Implement Plan B ( Florida Rule 6A- 6. 03019) to increase the number of underrepresented ELL and socio - economically disadvantaged students in gifted programs. 6) Reduce the minority/ non- minority and socioeconomic gap in participation in advanced, accelerated, Advanced Placement and Dual Enrollment courses by 3%. 7) Increase overall secondary students with successful completion of advanced, accelerated Advanced Placement and Dual enrollment courses by 3% and reduce the minority/ non- minority successful completion gap by 5%. 8) Increase the percentage of minority students who demonstrate readiness for college and careers upon graduation as measured by the PSAT, SAT, ACT, or PERT by at least 5%. 9) Embed an inquiry - based peer tutoring program modeled after AVID Tutorials into the Extended Leaming Program at each secondary site with the intent to provide support for minority students who fall below a C in accelerated courses. 10) Ensure the implementation of plans to provide one- to- one and group mentoring for minority students. 14 Ensure curriculum, Instruction and assessment are designed and delivered with a focus on content rigor, student engagement and continuous improvement of academic achievement. Action Goals: 11) Implement a data analysis and action planning process for the SAT Suite of Assessments that includes monitoring each school' s fidelity to their action plan that begins with grade 7 TIP participation and culminates with grade 11- 12 SAT School Day. 12) Increase participation in enrichment and academic opportunities in mathematics, science, and technology competitions, fairs, and clubs at the elementary, middle, and high school levels. 13) Improve instructional leadership skills of principals and assistant principals through monthly curriculum professional development as observed during school visits and informed by the Administrative Appraisal trend data. 14) Refine the Talent Development work of gifted teachers with a focus on structured curriculum and goal - oriented expectations using 2017- 18 data as a baseline to determine the impact of Talent Development on student leaming gains. Highlights in 2016- 17 In the 2016- 17 school year, more than 4, 500 students participated in STEM Academies at 93 schools. In addition to STEM Academies, Pinellas County Schools offers a yearly STEM Expo for students and families. Pinellas County Schools expanded on- site gifted education services to all elementary schools, eliminatingthe need to bus students to select sites for services. Pinellas County Schools is empowering more students to take ownership of their leaming. More than 25 Pinellas schools are implementing personalized leaming or developing new personalized leaming programs. Personalized leaming tailors leaming experiences to each student' s individual needs, skills and interests. The goal is to engage students in their own learning and better prepare them for success in college, careers and life. Pinellas County Schools earned a top - 10 ranking in the annual Digital School Districts Survey as a district that implements technology benchmarks in the evolution of digital education. The award recognizes exemplary use of technology for innovative curriculum and improved student leaming. For the second year in a row, Pinellas County Schools eamed the top score in Florida and is ranked as a top - 10 district in the nation for school choice for families by the Brookings Institute in Washington, D. C. STRATEGICGOAL2 11 STRATEGIC GOAL 3 12 Develop and sustain a healthy, respectful, caring, safe learning environment for students, faculty, staff and community resulting in individual employee learning, student achievement and overall school improvement. Action Goals: 1) Ensure that 100% of School Counselors are trained and complete a Comprehensive School Counseling Program following Florida Core Standards to better serve students and parents/ guardians. 2) Ensure that 100% of elementary school counselors provide curriculum on social skills related to bullying in grades K- 2. 3) Implementthe District - wide plan to ensure an advocate for each studentthroughout the District 4) Provide a continuous support system through a high quality teacher induction program ( Embrace Pinellas) focused on effective and equitable instruction for all students by incrementally building the expertise of our developing teachers in their first three years using mentoring, coaching and job - embedded professional development. 5) Provide professional development offerings based on prioritized needs identified through teacher appraisal data and deliberate practice processes evaluated by teacher survey results. 6) Increase teacher use of Project Based Learning in lessons leading to higher achievement levels for students who are in a Pinellas Innovates school program through teacher participation in Personalized Leaming and Project - Based Leaming professional development. 7) Ensure the use of cross - training to develop a pool of successors for employees at every level with candidates capable of filling identified positions. 8) Enhance the Employee Wellness Program to encourage and reward employee participation in preventive screenings, fitness and nutrition/ weight loss programs and carrier provided clinical programs. 9) Establish a recognition process for employees with outstanding attendance records. 10) Engage schools in wellness efforts through the Alliance for a Healthier Generation' s Healthy Schools Program and provide all physical education students the opportunity to achieve the level of Healthy Fitness Zone ( HFZ) in the Presidential Youth Fitness Program. 11) Continue School Board members' participation in Florida School Boards Association professional development. 12) Conduct Parent/ PTA cadre meetings throughout the District. 13) Conduct speaking engagements at civic associations such as Chambers of Commerce and Rotary meetings and have District representation on education committees. 14) Participate in meetings with local and state officials on issues directly impacting education and the community. 15) Participate in meetings with state, college and university officials. 16) Participate in meetings with various education and business groups throughout the community, state and nation to represent the District. 17) Develop and sustain partnerships with universities and community colleges that deliver teacher and leader preparation for the development and recruitment of teachers for the District. Develop and sustain a healthy, respectful, caring, safe learning environment for students, faculty, staff and community resulting in individual employee learning, student achievement and overall school improvement. Action Goals: 18) Increase the percent of District- and site- based administrators ( including minority candidates) selected to receive training on effective school' s research through Level 2 Principal Preparation, Aspiring Leaders, and Targeted Selection. 19) Implement a Turnaround Leader Program to strengthen the skill and capacity of school leaders resulting in prepared leaders for lower performing schools. 20) Conduct progressive discipline professional development for administrators and staff using an effective training model and monitor training results from a scaled survey for effectiveness from the administrators and staff attending. 21) Ensure schools have an active and documented Principal' s Multicultural Advisory Committee ( PMAC) program that addresses an environment reflective of the District' s core value of cultural competence. 22) Improve the professional culture and morale at each school site by targeting related areas identified in the SIP using data from the annual District and school- based AdvancED survey. 23) Ensure all schools have fully operational behavior plans reflecting positive behavior supports and restorative practices as part of the SIP with the implementation of these preventative strategies resulting in improved student behavior, reduction of referrals and suspension rates, and the use of recommended practices for in - school suspension altematives to decrease out- of- school suspensions. 24) Decrease the number of infractions leading to arrests as measured by monthly reports of arrests and year- to- date comparisons. 25) Increase safety in each school through collaborations and agreements among administrators, School Resource Officers, and Campus Activity Monitors to proactively address behavior and safety issues. 26) Monitor and review District and school emergency plans to ensure thatthe documented plans address the unique issues and location of each school, are reviewed by school personnel and ready to execute in the event of an emergency. 20, 000 18, 000 16, 000 14, 000 12, 000 10, 000 8, 000 6, 000 4, 000 2, 000 0 PCS / Total Out - of School Suspensions / 5 - Year Trend 17, 998 18 215 16, 838 8, 552 8, 536 7, 890 10, 598 9, 6% decrease— f1VP. l S ram 4, 892 4 42. 8% decrease over 5 years 2012- 13 2013- 14 2014- 15 2015- 16 2016- 17 4— Total # of Suspensions — 4— Total # of Students Suspended Source: PCS, Assessment, Accountability and Reasearch. Updated July, 2017 STRATEGICGOAL 3 13 Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: ID#18-4214 Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: PresentationIn Control: Council Work Session Agenda Number: 2.3 SUBJECT/RECOMMENDATION: SR60 Study - Sarah Ward, Planning Division Manager, Forward Pinellas SUMMARY: Link to SR60 Study and Appendices: <https://jftt.jacobs.com/download.aspx? ID=c579c6d1-53d7-41dc-bb64-58401c67639f&RID=3837f723-c8db-4e03-8173-8a22d9a822 25> APPROPRIATION CODE AND AMOUNT: USE OF RESERVE FUNDS: Page 1 City of Clearwater Printed on 1/25/2018 City of Clearwater City Council January 29, 2018 Connecting People and Places within the SR 60 Corridor 1 SR 60 Multimodal Implementation Strategies Study Area 2 Complete Streets Strategies Bike Lane Transit Pedestrian Bulb Out Buffered Sidewalk Street Furniture Narrowed Auto Lanes Crosswalk Landscaped Buffer On-street Parking Pavement Markings 3 An incomplete street… 4 …can become a Complete Street. 5 Public Outreach •Developed through Public & Stakeholder Outreach Continued agency outreach Engaged stakeholders and neighborhood associations Hosted public workshops 6 Short Term Implementation Strategies 7 Existing Conditions – Population 8 Existing Conditions – Employment 9 Existing Conditions – Crashes 10 Gap Analysis 11 Evaluation Criteria Mobility 1.Existing population within ½ mile 2.Future population within ½ mile 3.Existing transit dependent population densities within ½ mile 4.Future transit dependent population densities within ½ mile 5.Provides or improves connection to activity centers 6.Provides or improves a connection within a corridor of critical importance 12 Evaluation Criteria Safety 1.Fills a gap at a high crash location 2.Provides best practice safety measure. (Roadway Classification) 13 Evaluation Criteria Land Use and Economics 1.Existing employment densities within ½ mile 2.Future employment densities within ½ mile 3.Makes a first or last mile connection to transit 4.Presence of K-12, Colleges/ Universities, and Vocational/Technical Institutions within ¼ mile 5.Number of Local, State, and/or Federal Parks within ½ mile 6.Hotel/Motel Unit density within ½ mile of proposed project 14 Implementation Plan Priority Network Gap Projects 15 Facility From To Network Gap 1a. Beach to TIA Express TIA Clearwater Beach Premium Express Transit 1b. Memorial Causeway Busway for trolleys and the planned TIA to Beach Express Court Street Clearwater Beach Transit Center Premium Express Transit 2. SR 60/Chestnut Street Court Street Martin Luther King Jr. Avenue Bicycle Accommodations 3. SR 60/Gulf to Bay Boulevard US 19 Highland Avenue Multi-use Accommodations 4. Missouri Avenue Belleair Road Drew Street Bicycle Accommodations 5. SR 60/Gulf to Bay Boulevard McMullen Booth Road US Highway 19 Multi-use Accommodations 6. Drew Street North Myrtle Avenue Saturn Avenue Multi-use Accommodations 7. SR 60/Gulf to Bay Boulevard Court Street Cleveland Street Bicycle Accommodations 8. Clearwater Beach Connector Trail Pinellas Trail Martin Luther King Jr. Avenue Multi-use Accommodations 9. Cleveland Street Gulf to Bay Boulevard Missouri Avenue Bicycle Accommodations 10. Martin Luther King Jr. Ave. Chestnut Street Lakeview Road Bicycle Accommodations Implementation Plan Priority Network Gap Projects 16 Implementation Plan Most Important Crosswalk Needs Intersections Drew Street at US 19 Gulf to Bay Boulevard at S. Belcher Road Gulf to Bay Boulevard at S. Keene Road Gulf to Bay Boulevard at US 19 Gulf to Bay Boulevard at S. Arcturas Avenue Drew Street at Belcher Road 17 •Pinellas Trail at Drew Street Trail Crossing •Duke Energy Trail at Spectrum Field Driveway Conflicts •Bike Route Designation & Signage Drew St., Keene Rd., Cleveland St. Causeway to Pinellas Trail •Clearwater High School Safe Crossings Additional Considerations 18 Long Term Implementation Strategies 19 SR 60 – Land Use Character 20 Drew Street – Land Use Character 21 Druid Road – Land Use Character 22 Implementation Plan Complete Streets 23 SR 60 - Long Term Vision 24 SR 60 - Long Term Vision 25 SR 60 - Long Term Vision 26 SR 60 - Long Term Vision 27 SR 60 - Long Term Vision 28 Drew Street – Long Term Vision 29 Drew Street - Long Term Vision 30 Drew Street - Long Term Vision 31 Drew Street - Long Term Vision 32 Drew Street - Long Term Vision 33 Druid Road - Long Term Vision 34 Transit 35 Beach to TIA Express Name Description Stop Locations Park-N-Ride 2016 Annual Weekday Ridership 2040 Annual Weekday Ridership Alternative 1 Express Bus Service TIA, Clearwater Mall, Downtown Clearwater, & Clearwater Beach N/A 115,700 125,580 Alternative 2 Express Bus Service TIA, Clearwater Mall , Downtown Clearwater, & Clearwater Beach Clearwater Mall 134,680 146,120 Alternative 3 Express Bus Service TIA, N. Rocky Point Drive, Clearwater Mall, Belcher Road, Downtown Clearwater, & Clearwater Beach Clearwater Mall 216,320 233,740 Alternative 4 Express Bus (Fixed Guideway: Downtown Clearwater to Clearwater Beach) TIA, N. Rocky Point Drive, Clearwater Mall, Belcher Road, Downtown Clearwater, & Clearwater Beach Clearwater Mall 264,680 286,000 36 Name Span of Service Frequency Total Travel Time (Peak) Total Travel Time (Off-Peak) Annual Operational Cost Alternative 4 7 Days a Week 5am to Midnight Every 30 minutes 52 Minutes 47 Minutes $2.8 Million Best Performing Alternative 37 Beach to TIA Express Memorial Causeway – Beach to TIA Express Today 38 Memorial Causeway – Beach to TIA Express A vision for the future 39 First Mile, Last Mile Solutions Potential bike share locations Electric vehicle valet Autonomous vehicle connecting downtown to beach Existing pedestrian network Existing transit network 40 Project Costs Short Term – Top 10 Projects 41 Facility From To Network Gap Capital Cost 1a.Beach to TIA Express TIA Clearwater Beach Premium Express Transit $3.4 – 4.9 Million 1b. Memorial Causeway Busway Court Street Clearwater Beach Transit Center Premium Express Transit $8.1 Million SR 60/Chestnut Street Court Street Martin Luther King Jr. Avenue Bicycle Accommodations $0.54 Million SR 60/Gulf to Bay Boulevard US 19 Highland Avenue Multi-use Accommodations $0.72 Million Missouri Avenue Belleair Road Drew Street Bicycle Accommodations $18.0 Million SR 60/Gulf to Bay Boulevard McMullen Booth Road US Highway 19 Multi-use Accommodations $1.9 Million Drew Street North Myrtle Avenue Saturn Avenue Multi-use Accommodations $3.45 Million SR 60/Gulf to Bay Boulevard Court Street Cleveland Street Bicycle Accommodations $2.8 Million Clearwater Beach Connector Trail Pinellas Trail Martin Luther King Jr. Avenue Multi-use Accommodations $0.3 Million Cleveland Street Gulf to Bay Boulevard Missouri Avenue Bicycle Accommodations $3.7 Million Martin Luther King Jr. Avenue Chestnut Street Lakeview Road Bicycle Accommodations $4.6 Million Project Costs Long Term – Corridor Vision 42 Facility From To Cost SR 60 Courtney Campbell Causeway Hampton Road $4.52 Million SR 60 Hampton Road Lake Drive $1.38 Million SR 60 Lake Drive Martin Luther King Jr. Avenue $4.30 Million SR 60 Martin Luther King Jr. Avenue Pierce Street $1.80 Million SR 60 Pierce Street Clearwater Beach $8.10 Million Drew Street McMullen Booth Road Hampton Road $0.83 Million Drew Street Hampton Road Saturn Avenue $4.40 Million Drew Street Saturn Avenue Myrtle Avenue $4.90 - $10.50 Million Drew Street Myrtle Avenue N. Osceola Avenue $0.16 Million Druid Road US 19 Orange Avenue $23.4 Million Questions? 43 Connecting People and Places within the SR 60 Corridor 44 Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: ID#18-4232 Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: Action ItemIn Control: Finance Agenda Number: 3.1 SUBJECT/RECOMMENDATION: Approve an agreement with Commercial Risk Management, Inc., of Tampa, Florida, for the management and administration of workers compensation claims, for a one-year term and three annual renewal terms, pursuant to City Code Section 2.564 (l) (i), services associated with Workers Compensation exempt from bidding; and authorize the appropriate officials to execute same. (consent) SUMMARY: The Risk Management Division of the Finance Department has a short-term agreement as of June 2017 with Commercial Risk Management (CRM), a third-party administrator, for administration of workers compensation claims including lost time claims, claims involving litigation, complex medical claims, and medical only claims (when warranted). This agreement was implemented to supplement claims handling by our current workers compensation Risk Management Specialist. In June 2017, when the Senior Risk Management Specialist resigned, it was determined that pending claims and new claims did not justify filling this vacancy. CRM was retained on a trial basis to handle designated complex claims that were received after June 2017. CRM was chosen based on their experienced staff which has low turnover and longevity with their clients. The annual contract retains the same fee structure as the current short-term agreement, effective June 2017 through January 2018. For Indemnity/Lost Time claims the fee is $1,000, and for Medical only claims, $250. Complicated Medical Only claims, and/or Claims needing investigation have a fee of $500. The initial annual term of the Agreement will commence February 1, 2018. Subsequent annual renewals will be documented in writing by both parties, for up to three renewals of one -year each. Each annual renewal will be brought back to Council for approval. The retention of Commercial Risk Management to administer and manage our more complex and litigative claims will provide Risk Management and the City greater effectiveness in the investigative and fiscal management of our Workers Compensation claims program. Staff projects that a maximum of 20 - 25 claims annually will be referred for their services. APPROPRIATION CODE AND AMOUNT: Account # 590-07590-545800-519-000-0000 $25,000 Page 1 City of Clearwater Printed on 1/25/2018 File Number: ID#18-4232 Page 2 City of Clearwater Printed on 1/25/2018 Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: ID#18-4211 Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: Action ItemIn Control: Parks & Recreation Agenda Number: 4.1 SUBJECT/RECOMMENDATION: Approve funds awarded to the City from Senior Citizens Services, Inc. in the amount of $8,000 to fund educational, cultural and recreational day trips and creative activities for older adults. (consent) SUMMARY: The City has been awarded funds in the amount of $8,000 to offer educational, cultural and recreational day trips and creative programs to improve older adults’ quality of life through enhanced community engagement for Clearwater adults age 55 and older. The funding provides support for coordinated recreational day trips for adults 55 and older. The funding would allow for a licensed driver and an ADA accessible bus to transport participants to educational, cultural and community events in the Tampa Bay area. Trips would originate at the Aging Well Center and/or other city facilities as the funding allows. The funding provides support for Creative Activities for adults age 55 and older at City of Clearwater Recreation Centers, which includes the Aging Well Center. Senior Citizens Services funding categories for October 2017 define Senior Recreational trips and Creative Activities as a targeted category for their funding. No matching funds are required. This grant was approved by the Resource Management Committee at their October 2017 meeting. No additional operating impacts are needed to support this program. APPROPRIATION CODE AND AMOUNT: A first quarter budget amendment will increase special program 181-98607, Senior Citizens Services -Trips by $8,000 in donation revenue. USE OF RESERVE FUNDS: N/A Page 1 City of Clearwater Printed on 1/25/2018 SENIOR CITIZENS SERVICES, INC. PO BOX 1229 CLEARWATER, FL 33757 727-442-8104 November 30, 2017 City of Clearwater-Office on Aging ATTN: Kerry Kimball Marsalek, Office on Aging 1501 N. Belcher Rd. Clearwater, FL 33765 Dear Kerry: We are pleased to inform you that the Board of Directors of Senior Citizens Services, Inc. approved a grant in the amount of $8,000 for your proposed project. Please have a representative of your agency join us for the Grant Award Ceremony on Tuesday, December 19, 2017 at 9:00 am at 1204 Rogers Street, Clearwater, FL. The grant check will be provided to you at this ceremony. Before a check may be issued, we will need to have your W9 on file. It is very IMPORTANT to us that your organization be represented at the Award Ceremony. This event is a celebration of your idea, and we want you to receive your check on that day. Please notify us if you are not attending. If your agency is not present, your check will be presented at the next regular Board Meeting in 60 days, February 20, 2018. This award is restricted to the project specified in your grant application and must be used to serve seniors 55 and over in Pinellas County. Impact Reports are due by July 15, 2018 (semi-annual) and Jan. 15, 2019 (annual). Failure to submit the reports will impact future funding requests. Your applications are scored. “Please use ALL current forms on our website to get the highest considerations.” This is IMPORTANT! www.seniorcitizenservices.org Enclosed is a list of organizations receiving grant funding in 2016/2017. We encourage you to collaborate with these organizations to enhance the delivery of services. Also enclosed for your reference is the list of focus areas for each of the four quarterly funding cycles. If you have any questions regarding this award, please contact us via email at Sheila@seniorcitizenservices.org. We appreciate this opportunity to assist you in your efforts and look forward to hearing about the implementation of your project. This Approval Letter will also be Mailed. Respectfully, Bill Sturtevant, President Senior Citizens Services, Inc. Enclosures: Grant Funding Focus Areas Current List of Grantees Award Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: ID#18-4251 Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: Action ItemIn Control: Parks & Recreation Agenda Number: 4.2 SUBJECT/RECOMMENDATION: Ratify and confirm the City Manager’s approval of a contract with Contractor-at-Risk Khors Construction, Inc. of Thonotosassa, FL, in the amount of $196,125.36 to complete the construction of the Jack Russell Memorial Park located at Jack Russell Memorial Stadium and authorize the appropriate officials to execute same. SUMMARY: On August 4, 2016, the Council approved the use of Construction Manager at Risk Services (CMR) for Continuing Contracts Biltmore Construction Co., Inc. of Belleair, FL; Cathey Construction and Development, LLC of Mexico Beach, FL; Certus Builders, Inc. of Tampa, FL; J. Kokolakis Contracting, Inc. of Tarpons Springs, FL; J.O. Delotto & Sons, Inc. of Tampa, FL; Keystone Excavators, Inc. of Oldsmar, FL; Khors Construction, Inc. of Thonotosassa, FL; and Wharton-Smith, Inc. of Sanford, FL for a period of four years. These firms were selected in accordance with Florida Statutes 255.103 and 287.055 under Request for Qualifications 24-16 based upon construction experience, financial capability, availability of qualified staff, local knowledge and involvement in the community. The City Council approved a capital improvement project in Fiscal Year 2017/18 to construct a memorial park at Jack Russell Stadium to honor the history of Jack Russell Stadium. Unfortunately, the design for the memorial and research needed for the correct wording on the plaques took longer than anticipated therefore a contract needed to construct the park was delayed. City staff received a proposal for Contractor-at-Risk Khors during the first week in January. Since the dedication was tentatively scheduled for March 8, 2018 when the Philadelphia Phillies organization as well as MLB will be in town for the dedication, it became imperative to approve the contract with Khors to construct the memorial. This contract consists of the installation of a walkway of brick pavers and concrete, seat wall and memorial plaques mounted on granite stones. Landscaping will be completed in house and/or by others. Visitors to the site will be able to enjoy and be reminded of the individuals who have previously played at Jack Russell Memorial Stadium. A total of 10 bronze plaques including the History of the Stadium, History of Jack Russell, 5 Philadelphia Hall of Fame players, a list of all Hall of Fame players who played at Jack Russell, Hall of Fame players who were once Phillies but went in the Hall from another team and 1980 Worlds Series Plaque. Page 1 City of Clearwater Printed on 1/25/2018 File Number: ID#18-4251 To stay on schedule and complete the project prior to the tentative dedication of March 8, 2018, the City Manager approved the contract with Khors. APPROPRIATION CODE AND AMOUNT: A first quarter budget amendment will provide a transfer of $45,000 from capital improvement project 315-93674, Jack Russel Stadium Practice Field Renovations, to capital improvement project 315-93673, Jack Russel Stadium Improvements, to fund this contract. USE OF RESERVE FUNDS: N/A Page 2 City of Clearwater Printed on 1/25/2018 Construction Manager at Risk Contract This CONTRACT made and entered into this 22Y41 da.1cj.So+L2D to by and between the City of Clearwater, Florida, a municipal corporation, hereinafter designated as the "City" or "Owner", and ko' Y-ka-aa a7aw. , Pr stiko : of the Kha, s(onOrvai: a.. InL, County Pinellas and State of Florida, hereinafter designated as the "Construction Manager". The contracting entities shall collectively be known as the "Parties." WITNESSETH: WHEREAS, the Clearwater City Council has approved using the Construction Manager at Risk approach on appropriate projects as determined by the City's Engineering Department; and WHEREAS, the City desires that the Construction Manager perform the management of the necessary construction, design, and preconstruction services (collectively referred to as the Services) on an as- needed basis subject to the terms and conditions set forth in this agreement and any agreement incorporated into this agreement by reference. NOW, THEREFORE, IT IS AGREED BY THE PARTIES: ARTICLE 1: SCOPE OF WORK AND CONTRACT DOCUMENTS 1.1 The Construction Manager and its successors, assigns, executors or administrators, in consideration of the sums of money, as herein after set forth to be paid by the City to the Construction Manager, shall and will at its own cost and expense perform all labor, furnish all materials, tools and equipment for all individual projects assigned as a result of this contract. 1.2 For each individual project assigned, in accordance with such proposal and technical supplemental specifications and such other special provisions and drawings, if any, which will be submitted by the City, together with any advertisement, instructions to bidders, general conditions, proposal and bond, which may be hereto attached, and any drawings, if any, which may be herein referred to, are hereby made a part of this contract, and all of said work to be performed and completed by the contractor and its successors and assigns shall be fully completed in a good and workmanlike manner to the satisfaction of the City. 1.3 Unless otherwise specified in this contract, all work shall be completed in accordance with Section III and Section IV of the City of Clearwater Contract Specifications (the Specifications). For the purposes of this contract, the term Contractor in Section III shall include the Construction Manager. The Specifications, as may be supplemented and changed, along with this Contract constitute the Contract Documents." In the event there is any conflict between this Contract and the Specifications, this Contract shall take precedence except that the GMP PROPOSAL dated Tf5 D in the amount of $ T B D is expressly incorporated and made part of this Agreement. Further, the GMP Proposal shall be determinative and control in the event of any conflict, discrepancy, absence of information and / or term or condition to the contrary. Page 1 of 12 ARTICLE 2: CONSTRUCTION MANAGER'S DUTIES AND STATUS 2.1 The Construction Manager recognizes the relationship of trust and confidence established between it and the City by this Agreement, and agrees with the City to furnish its best skill and judgment and the overall supervision of its executives; to furnish efficient business administration and superintendence; and to use every effort to keep upon the project site at all times an adequate supply of workforce and materials to secure its execution and completion in the most expeditious and economical manner. 2.2 The Construction Manager represents that it has made a thorough examination of the premises and is thoroughly familiar with the conditions under which it is to work. 2.3 The Construction Manager agrees to perform and complete the Services in accordance with laws, rules, and regulations of all governmental authorities and departments thereof. 2.4 The Construction Manager agrees to cooperate with the City, Architect - Engineer, or any other Design Professional in all respects, including, but not limited to, providing necessary preconstruction services, such as evaluation of methods, availability and costs of the various components of the Services while under design consideration; supervising the Services and the progress thereof; the coordination of the Services and suggesting changes in the Services; and supplying information as to costs and availability of materials and methods of construction in order, amongst other things, to reduce costs wherever the same may be practicably consistent with the quality of the Services presented in the Contract Documents. 2.5 The Construction Manager agrees to the following: a) In connection with the performance of work under this Contract, the Construction Manager agrees not to discriminate against any employee or applicant for employment because of race, sex, religion, color, or national origin. The aforesaid provision shall include, but not be limited to, the following employment: upgrading demotion or transfer recruitment or recruitment advertising lay -off or termination rates of pay or other forms of compensation; and selection for training, including apprenticeship b) The Construction Manager agrees to post hereafter in conspicuous places, available for employees or applicants for employment, notices to be provided by the contracting officer setting forth the provisions of the non - discrimination clause. C) The Construction Manager further agrees to insert the foregoing provisions in all contracts hereunder, including contracts or agreements with labor unions and /or worker's representatives, except sub - contractors for standard commercial supplies or raw materials. ARTICLE 3: SCOPE OF THE SERVICES 3.1 The services that the Construction Manager shall provide include, but are not limited to those described in the following sections. 3.2 Reporting - Written reports shall be provided with the monthly pay requests as follows: Page 2 of 12 a) Monthly Executive Summary which provides an overview of current decisions, future developments and expected achievements, and any including code violations found by any permitting agency. b) A Monthly Construction Progress Report that includes a cost narrative, a and that summarizes the work of the various subcontractors. This information from the weekly job site meetings as applicable such as: general conditions long lead supplies current deliveries safety and labor relations programs permits construction problems and recommendations; and plans for the succeeding month issues and pending problems or delays, scheduling narrative report shall include 3.3 Scheduling a) Upon award of this Contract, the Construction Manager shall submit a master project schedule covering the planning and design approvals, construction and Owner occupancy of the Project. This schedule will serve as the framework for the subsequent development of all detailed schedules. The master project schedule shall be produced and updated monthly throughout the project. b) Within thirty (30) days after the date of the Owner's issuance of a Notice to Proceed, the Construction Manager shall prepare and submit to the Owner two copies of a Critical Path Method (CPM) construction schedule graphically depicting the activities contemplated to occur as a necessary incident to performance of the work required to complete the project, showing the sequence in which the Construction Manager proposes for each such activity to occur and duration (dates of commencement and completion, respectively) of each activity. c) Following development and submittal of the construction schedule the Construction Manager shall, at the end of each calendar month during the project, or at such earlier intervals as circumstances may require, update and /or revise the construction schedule to show the actual progress of the work performed and the occurrences of all events which have affected the progress of performance of work already performed or will affect the progress of the performance of the work yet to be performed in contrast with the planned progress of performance of such work, as depicted on the original construction schedule and all updates and /or revisions thereto as reflected in the updated and /or revised construction schedule last submitted prior to submittal of each such monthly update and revision. Each such update and /or revision to the construction schedule shall be submitted to the Owner in duplicate. d) The Construction Manager shall provide current scheduling information and provide direction and coordination regarding milestones, beginning and finishing dates, responsibilities for performance and the relationships of the Construction Manager's work to the work of his subcontractors and suppliers to enable them to perform their respective tasks so that the development of construction progresses in a smooth and efficient manner in conformance with the overall project schedule. The schedule shall include all phases of the construction work, material supplies, long lease procurement, approval of shop drawings, change orders in progress, schedules for change orders, and performance testing requirements. The Construction Manager shall advise the Owner, its representatives and the Architect - Engineer of their required participation in any meeting or inspection giving each at least one week notice unless such notice is made impossible by conditions beyond his control. The Page 3 of 12 Construction Manager shall hold job -site meetings at least once each month with the Construction Team and at least once each week with the subcontractors and the Architect - Engineer's Field Representative, or more frequently as required by work progress, to review progress, discuss problems and their solutions and coordinate future work with all subcontractors. e) Twice per month corresponding as closely as possible with progress review meetings, a "two week" look ahead report shall be prepared and submitted to Owner and Architect / Engineer. 3.4 Design Review and Recommendations a) The Construction Manager shall familiarize himself thoroughly with the evolving architectural, civil, mechanical, plumbing, electrical and structural plans and specifications and shall follow the development of design through Contract Documents. The Construction Manager shall make recommendations with respect to the selection of systems and materials, and cost reducing alternatives including assistance to the Architect- Engineer and Owner in evaluating alternative comparisons versus long term cost effect. The evaluation shall speak to the benefits of the speed of erection and early completion of the project. The Construction Manager shall furnish pertinent information as to the availability of materials and labor that will be required. The Construction Manager shall submit to the Owner and Architect - Engineer such comments as may be appropriate concerning construction, feasibility, and practicality. The Construction Manager shall bring to the Owner and the Architect - Engineer's attention any apparent defects in the design, drawing and specifications, or other documents. The Construction Manager shall prepare an estimate of the construction cost at appropriate milestones during the design and shall evaluate such estimate with the project budget. The Construction Manager shall recommend cost saving alternatives, as appropriate, at each design milestone. At each design milestone the Owner, Architect Engineer and Construction Manager shall conduct a value engineering review. b) After receiving the Construction Documents for each phase of the project, the Construction Manager shall perform a specific review thereof. Promptly after completion of the review, the Construction Manager shall submit to the Owner, with a duplicate to the Architect - Engineer, a written report covering suggestions or recommendations previously submitted, additional suggestions or recommendations as the Construction Manager may deem appropriate, and all actions taken by the Architect - Engineer with respect to same, any comments he may deem to be appropriate with respect to separating the work into separate contracts and /or alternative materials. c) At completion of the Construction Manager's review of the plans and specifications, except only as to specific matters as may be identified by appropriate comments pursuant to this section, the Construction Manager shall warrant, without assuming any architectural or engineering responsibility, that the plans and specifications are consistent, practical, feasible and constructible. The Construction Manager shall warrant that the work described in the plans and specifications for the various bidding packages is constructible within the scheduled construction time. d) The Construction Manager shall review the design for the purpose of identifying long lead procurement items (i.e. machinery, equipment, materials and supplies). When each item is identified, the Construction Manager shall notify the subcontractors, the Owner, and the Architect - Engineer of the required procurement and schedule. Such information shall be included in the bid documents and made a part of all affected sub - contracts. As soon as the Architect- Engineer has completed drawings and technical specifications and the Construction Manager has obtained permitting approval, the Construction Manager shall Page 4 of 12 prepare invitations for bids. The Construction Manager shall keep informed of the progress of the respective subcontractors or suppliers, manufacturing or fabricating such items and advise Project Director, Owner and Architect - Engineer of any problems or prospective delay in delivery. 3.5 Staffing - Key personnel assigned to City projects by the Construction Manager shall not be removed from the project until alternate personnel acceptable to the City are approved in writing by the City. 3.6 Soliciting Bids a) Without assuming responsibilities of the Architect- Engineer, and unless waived in writing by the Owner, the Construction Manager shall prepare invitations for bids, or requests for proposal when applicable, for all procurements of long lead items, materials and services, and for Subcontractor contracts. Such invitations for bids shall be prepared in accordance with the following guidelines: i) Contracts totaling $1,000 but not exceeding $10,000 may be entered into by the Construction Manager with the firm which is qualified and submits the lowest verbal quotation. The Construction Manager shall obtain a minimum of two (2) verbal quotations. These quotations shall be entered on a bid tabulation sheet and a copy of such tabulation sent to the Owner, Architect - Engineer and to each firm. The successful quotation shall be confirmed by written contract or purchase order to the low bid firm defining the scope and quality of work to be provided. ii) Contracts totaling $10,000 but not exceeding $200,000 may be entered into by the Construction Manager with the firm who is qualified and submits the lowest responsive proposal. The Construction Manager shall request at least three (3) firms to submit sealed written proposals based on written drawings and /or specifications. The written proposals shall all be opened publicly at the location, date and time named by the Construction Manager in his request for proposal. A tabulation of the results shall be furnished to the Owner, Architect- Engineer and to each firm. iii) Contracts totaling $200,000 but not exceeding $500,000 may be entered into by the Construction Manager with the firm who is pre - qualified and submits the lowest responsive proposal. The Construction Manager shall advertise these projects at least once with the last advertisement appearing at least 21 calendar days prior to the established bid opening date. These proposals shall be based on approved plans and specifications. Bids shall be received and opened publicly at the location, date and time established in the bid advertisement. iv) Contracts totaling $500,000 or greater shall be treated the same as described under iii above except that the advertisement shall be run for at least 30 days prior to the established bid opening and at least 5 days prior to any scheduled pre -bid conference. v) Individual purchases of materials or rentals or leases of equipment of up to $999.99 each may be made without bids or quotes when reasonably necessary to expedite work on the project; however, the Construction Manager shall not divide or separate a procurement in order to avoid the requirements set forth above. vi) Site utilities may be acquired at market rates from the entity(ies) providing such in the franchise area. Page 5 of 12 b) For each separate construction contract exceeding $35,000, the Construction Manager shall, unless waived by Owner, conduct a pre -bid conference with prospective bidders, the Architect - Engineer and the Owner. In the event questions are raised which require an interpretation of the bidding documents or otherwise indicate a need for clarification or correction of the invitation, the Construction Manager shall transmit these to the Architect - Engineer and upon receiving clarification or correction in writing shall prepare an addendum to the bidding document, and issue same to all of the prospective bidders. 3.7 Quality Control - The Construction Manager shall develop and maintain a program, acceptable to the Owner and Architect - Engineer that assures quality control of the construction. The Construction Manager shall supervise the work of all subcontractors providing instruction to each when their work does not conform to the requirements of the plans and specifications and shall continue to assert influence and control over each subcontractor to ensure that corrections are made in a timely manner so as to not affect the efficient progress of the work. Should disagreement occur between the Construction Manager, the Owner or the Architect - Engineer over acceptability of work and conformance with the requirements of the specifications and plans, the Owner shall be the final judge of performance and acceptability. 3.8 Subcontractor Interfacing - The Construction Manager shall be the single point of interface with all subcontractors for any work done under this Contract. The Construction Manager shall negotiate all change orders, field orders and request for proposals, with all affected subcontractors and shall review the costs of those proposals and advise the Owner and Architect - engineer of their validity and reasonableness, acting in the Owner's best interest prior to requesting approval of each change order from the Owner. Before any work is begun on any change order, a written authorization from the Owner must be issued. When health and safety are threatened, however, the Construction Manager shall act immediately to remove such threat to health and safety. The Construction Manager shall also carefully review all shop drawings and then forward the same to the Architect - Engineer for review and actions. The Architect- Engineer will transmit them back to the Construction Manager who will then issue the shop drawings to the affected subcontractor for fabrication or revision. The Construction Manager shall maintain a record to promote expeditious handling. The Construction Manager shall request the Architect - Engineer to make interpretations of the drawings or specifications requested of him by the subcontractors and shall maintain a record to promote timely response. The Construction Manager shall advise the Owner and Architect - Engineer when timely response is not occurring on any of the above. The Construction Manager shall collect, review and submit to the Owner, all project closeout documentation including operation, maintenance and training manuals. ARTICLE 4: MAXIMUM PROJECT COST AND FEES FOR SERVICES 4.1 Guaranteed Maximum Price for Construction a) When the Construction Documents are sufficiently complete to establish the scope of work for the project or any portion thereof, the Construction Manager will establish and submit in writing to the Owner for his approval a Guaranteed Maximum Price (GMP) guaranteeing the maximum price to the Owner, for the construction cost of the project or designated part thereof. Such Guaranteed Maximum Price will be subject to modification for changes in the project as provided in article 4.1(e) below. Actual price paid for the work by the Owner, however, shall be the actual cost of all work subcontracts, supply contracts, direct labor costs, direct supervision costs and direct job costs, plus the Construction Manager's fees or the GMP, whichever is Tess when the work is complete. Invoicing shall occur monthly for completed work with 5% retainage withheld until final completion and acceptance of all work covered in the contract documents in accordance to the City's General Conditions. Page 6 of 12 b) At the time of submission of a Guaranteed Maximum Price, the Construction Manager will verify the time schedule for activities and work which were adopted and used to determine the Construction Manager's cost of work. In addition to the cost of work, a GMP will include an agreed upon sum as the construction contingency which is included for the purpose of defraying the expenses due to unforeseen circumstances relating to construction. The Construction Manager will be required to furnish documentation evidencing expenditures charged to the contingency prior to the release of funds by the Owner. If bids are received below the applicable line items in the GMP, the surplus will be added to the contingency. c) If bids are received above the applicable line item in the GMP, the deficiency will be taken from the contingency; however, such occurrence shall not be cause to increase the GMP. d) If bids are not received for a portion of the work at or below the applicable line item amount in the GMP, the Construction Manager reserves the right to perform that portion of the work as acknowledged by the Owner or negotiate for its performance for the specified line item lump sum amount or less. e) The increase or decrease in the Guaranteed Maximum Price resulting from a change in the Project shall be determined in one or more of the following ways: By mutual acceptance of a lump sum properly itemized and supported by sufficient substantiating data to permit evaluation by the Architect Engineer and owner; ii. By unit prices stated in the Agreement or subsequently agreed upon; If none of the methods is agreed upon, the Construction Manager, provided it has received a signed written order by the Owner, shall promptly proceed with the work involved. The cost of such work shall then be determined on the basis of the reasonable expenditures and savings of those performing the work attributed to the change. In the event a Change Order is issued under these conditions, however, the Architect - Engineer will establish an estimated cost of the work and the Construction Manager shall not perform any work whose cost exceeds that estimate without prior written approval by the Owner. In such case, the Construction Manager shall keep and present, in such form as the Owner may prescribe, an itemized accounting together with appropriate supporting data of the increase in the Cost of the Project. The amount of decrease in the Guaranteed Maximum Price to be allowed by the Construction Manager to the Owner for any deletion or change which results in a net decrease in cost will be the amount of the actual net decrease; iv. The Architect - Engineer will have authority to order minor changes in the Project not involving an adjustment in the Guaranteed Maximum Price or an extension of the Construction Completion Date and not inconsistent with the intent of the Drawings and Specifications. Such changes shall be effected by written order. Documentation of changes shall be determined by the Architect- Engineer.. Changes shall be approved by the Architect - Engineer 4.2 Construction Manager's Fee - In consideration of the performance of the contract, the Owner agrees to pay the Construction Manager as compensation for his services, fees as set forth below : Page 7 of 12 Preconstruction Phase Fee - shall be based on design costs if applicable, constructability review, value engineering and fee determination of Guaranteed Maximum Price. The fee for this phase in the amount of $ TBD shall be paid at the negotiated price upon receipt of the Guaranteed Maximum Price. a) Construction Phase Fee - Prior to commencement of the Construction Phase, the Owner will direct the Construction Manager in writing to proceed into the Construction Phase. The Construction Manager's compensation for work or service performed during the Construction Phase shall be a fee of TBD . The Construction Phase Fee shall be invoiced and paid in TBD months. Payments will be remitted monthly at the cost of TBD each and one final monthly payment of TBD The first monthly payment shall become due thirty days following the issuance of the first Construction Authorization and the final monthly payment shall be paid only when construction of the project is completed and occupancy of the project accepted by the Owner. If construction is authorized only for a part of the project, the fee paid shall be proportionate to the amount of work authorized by the Owner. ARTICLE 5: TERMINATION AND TIME OF THE ESSENCE 5.1 If the Construction Manager is adjudged bankrupt or makes a general assignment for the benefit of creditors, or if a receiver is appointed on account of its insolvency, or if refuses or fails, except in cases for which an extension of time is provided, to supply enough properly skilled workmen or proper materials for the Services, or otherwise be guilty of a substantial violation of any provision of this Agreement as determined by the certificate of the Architect, the Owner may, without prejudice and reserving any other right or remedy the Owner may have, after giving the Construction Manager seven (7) days' written notice, terminate the employment of the Construction Manager and take possession of the premises and all materials, tools, and appliances thereon and finish the Project in whatever manner the Owner may deem expedient. 5.2 It is mutually agreed between the parties hereby that time is of the essence of this contract, and in the event that the Substantial Completion Date is not achieved within the time stipulated herein, it is then further agreed that the City may deduct from such sums or compensation as may be due to the Construction Manager, the sum of $1,000.00 per day for each day that the work to be performed by the Construction Manager remains incomplete beyond the time limit specified herein, which sum of 1,000.00 per day shall only and solely represent damages which the City has sustained by reason of the failure of the Construction Manager to complete the work within the time stipulated, it being further agreed that the sum is not to be construed as a penalty but is only to be construed as liquidated damages for failure of the Construction Manager to complete and perform all work within the time period as specified in this contract. ARTICLE 6: INDEMNIFICATION 6.1The Construction Manager and his or its successors and assigns does hereby agree to assume the defense of any legal action which may be brought against the City as a result of the Construction Manager's activities arising out of this contract and furthermore, in consideration of the terms, stipulations and conditions as contained herein, agrees to hold the city free and harmless from any and all claims for damages, costs of suits, judgments or decrees resulting from any claims made under this contract against the city or the contractor or the contractor's sub - contractors, agents, servants or employees resulting from activities by the aforementioned contractor, sub - contractor, agent servants or employees. Page 8 of 12 6.2 Nothing contained herein shall be construed as a waiver of any immunity from or limitation of liability the City (Owner) may be entitled to under the doctrine of sovereign immunity or section 768.28, Florida Statutes. ARTICLE 7: TITLE TO THE PROJECT 7.1 The title of all work, completed portions of the Project and in the course of construction, and of all materials on account of which payment has been made shall be in the Owner. ARTICLE 8: ASSIGNMENT 8.1 This Agreement shall be binding upon and inure to the benefit of the Parties hereto and their respective successors and assigns, except that this Agreement may not be assigned by either party without the prior written consent of the other party. Any assignment made without such prior written consent shall not vest rights in the assignee. ARTICLE 9: ADDITIONAL PROVISIONS 9.1 This Agreement shall be governed by and construed in accordance with the laws of the State of Florida, and the venue for any dispute under this Agreement shall be an appropriate court of competent jurisdiction in Pinellas County, Florida. 9.2 Any notice required to be given by the terms and provisions of this Agreement or by any law or governmental regulation, either by the Owner or Construction Manager, shall be in writing unless otherwise required by such law or regulation and shall be deemed to have been served and given when deposited in either Registered or Certified Mail in United States Branch Post Office, addressed to the party hereto to whom directed, at the address specified in the Specifications,. 9.3 The language in this Agreement shall be construed according to its customary meaning within the Florida building industry. Whenever used, the singular shall include the plural, the plural the singular, and the use of any gender shall be applicable to all genders. 9.4 If any provision of the Contract Documents is invalid or unenforceable as against any person or party, the remainder of the Contract Documents and the applicability of such provision to other persons or parties shall not be affected thereby. 9.5 Nothing contained in this Agreement shall be construed to mean that the Construction Manager and Owner are joint venturers or partners. 9.6 In addition to all other contract requirements as provided by law, the contractor executing this agree- ment agrees to comply with public records law. IF THE CONTRACTOR HAS QUESTIONS REGARDING THE APPLICATION OF CHAPTER 119, FLORIDA STATUTES, THE CONTRACTORS DUTY TO PROVIDE PUBLIC RECORDS RELATING TO THIS CONTRACT. CONTACT THE CUTODIAN OF PUBLIC RECORDS AT 727 - 562 -4092, Rosemarie .Call @myclearwater.com, 112 S. Osceola Ave., Clearwater, FL 33756 Page 9 of 12 The contractor's agreement to comply with public records law applies specifically to: a) Keep and maintain public records required by the City of Clearwater hereinafter "public agency ") to perform the service being provided by the contractor hereunder. b) Upon request from the public agency's custodian of public records, provide the public agency with a copy of the requested records or allow the records to be inspected or copied within a reasonable time at a cost that does not exceed the cost provided for in Chapter 119, Florida Statutes, as may be amended from time to time, or as otherwise provided by law. c) Ensure that the public records that are exempt or confidential and exempt from public records disclosure requirements are not disclosed except as authorized by law for the duration of the contract term and following completion of the contract if the contractor does not transfer the records to the public agency. d) Upon completion of the contract , transfer, at no cost, to the public agency all public records in possession of the contractor or keep and maintain public records required by the public agency to perform the service. If the contractor transfers all public records to the public agency upon completion of the contract, the contractor shall destroy any duplicate public records that are exempt or confidential and exempt from public records disclosure requirements. If the contractor keeps and maintains public records upon completion of the contract, the contractor shall meet all applicable requirements for retaining public records. All records stored electronically must be provided to the public agency, upon request from the public agency's custodian of public records, in a format that is compatible with the information technology systems of the public agency. e) A request to inspect or copy public records relating to a public agency's contract for services must be made directly to the public agency. If the public agency does not possess the requested records, the public agency shall immediately notify the contractor of the request and the contractor must provide the records to the public agency or allow the records to be inspected or copied within a reasonable time. f) The contractor hereby acknowledges and agrees that if the contractor does not comply with the public agency's request for records, the public agency shall enforce the contract provisions in accordance with the contract. Page 10 of 12 g) A contractor who fails to provide the public records to the public agency within a reasonable time may be subject to penalties under Section 119.10, Florida Statutes. h) If a civil action is filed against a contractor to compel production of public records relating to a public agency's contract for services, the court shall assess and award against the contractor the reasonable costs of enforcement, including reasonable attorney fees, if: 1. The court determines that the contractor unlawfully refused to comply with the public records request within a reasonable time; and 2. At least 8 business days before filing the action, the plaintiff provided written notice of the public records request, including a statement that the contractor has not complied with the request, to the public agency and to the contractor. i) A notice complies with subparagraph (h)2. if it is sent to the public agency's custodian of public records and to the contractor at the contractor's address listed on its contract with the public agency or to the contractor's registered agent. Such notices must be sent by common carrier delivery service or by registered, Global Express Guaranteed, or certified mail, with postage or shipping paid by the sender and with evidence of delivery, which may be in an electronic format. j) A contractor who complies with a public records request within 8 business days after the notice is sent is not liable for the reasonable costs of enforcement. Page 11 of 12 IN WITNESS WHEREOF, the parties to the agreement have hereunto set their hands and seals and have executed this Agreement, in duplicate, the day and year first above written. CITY OF CLEARWATER IN PINELLAS COUNTY, FLORIDA By: Liu,' u,+A-4 William B. Horne II Countersigned: City Manager By: — ,, e0ritr\Crt\t -t05 George Cretekos, Mayor - Councilmember Contractor must indicate whether Corporation, Partnership, company or Individual) The person signing shall, in his own handwriting sign the Principal's name, his own name and his title; where the person is signing for a Corporation he must, by Affidavit, show his authority to bind the Corporation). Page 12 of 12 Attest: Rosemarie CaII, o form: sistant City Attorney ltiors L° oas4ro,c:4- o r , Contractor) I nn By: bfi JO r5c,hC11c61 (.(40- (Seal) TRUTH -IN- NEGOTIATION CERTIFICATE In compliance with the Consultants' Competitive Negotiation Act, Section 287.055, Florida Statutes, and The Truth in Negotiations Act (TINA), Khvrs Ctjns$tut -kbr> 3 4nC Contractor hereby certifies that wage rates, fringe rates and other factual unit costs supporting the compensation for the CD or\ services of pc% (° Pi54ru 1 On,\ht. to be provided under this Agreement, concerning CM 014 WIsk Servrr-c 4MA. 2') -I1. are accurate, complete and current as of the time of contracting. The hereby undersigned representative submits this certification that they are an authorized representative of the proposer who may legally bind the proposer attest to the accuracy of the information: STATE OF F=-lccrcJq II Authorized SignaturejCoc lorsare P p C'eS G -Psn Printed Name 6 — \(\f f' S rDns4FUd-i on ' krkc Title Name of Entity /Corporation COUNTY OF 4 111S borou.slr The foregoing instrument was acknowledged before me on this 22-4 day ofAULne— , 20 ILs , by ' -Or; IC-ANN-Sec najCI name of person whose si nature is being notarized) as the V gceert4 (title) of .1.1 p rs rOn.&4rML t Dn + jr'1 [ . (name of corporation /entity), personally known to me as described herein did / did not take oath. or produced a type of identification) as identification, and who Public to A ( 1 tt Printed Name My Commission Expires: NOTARY SEAL ABOVE ANN LOCKE Notary Pi,Oifc - State of Ftor!1 My Comm, Expires Feb 27, 201 Commission # EF 0969915 SCRUTINIZED COMPANIES AND BUSINESS OPERATIONS WITH CUBA AND SYRIA CERTIFICATION FORM THIS FORMMUST BE COMPLETED AND SUBMITTED WITH PROPOSAL FOR PROJECTS THAT MAY EXCEED $1,000,000. FAILURE TO SUBMIT THIS FORM AS REQUIRED, MAY DEEM YOUR SUBMITTAL NONRESPONSIVE. The affiant, by virtue ofthe signature below, certifies that: 1. The vendor, company, individual, principal, subsidiary, affiliate, or owner is aware of the requirements of section 287.135, Florida Statutes, regarding companies on the Scrutinized Companies with Activities in Sudan List, the Scrutinized Companies with Activities in the Iran Petroleum Energy Sector List, or engaging in business operations in Cuba and Syria; and 2. The vendor, company, individual, principal, subsidiary, affiliate, or owner is eligible to participate in this solicitation and is not listed on either the Scrutinized Companies with Activities in Sudan List, the Scrutinized Companies with Activities in the Iran Petroleum Sector List, or engaged in business operations in Cuba and Syria; and 3. Business Operations means, for purposes specifically related to Cuba or Syria, engaging in commerce in any form in Cuba or Syria, including, but not limited to, acquiring, developing, maintaining, owning, selling, possessing, leasing or operating equipment, facilities, personnel, products, services, personal property, real property, military equipment, or any other apparatus of business or commerce; and 4. If awarded the Contract (or Agreement), the vendor, company, individual, principal, subsidiary, affiliate, or owner will immediately notify the City of Clearwater in writing, no later than five (5) calendar days after any of its principals are placed on the Scrutinized Comp s with Activities in Sudan List, the Scrutinized Companies with Activities in the Iran Pe '" or bus' ss operations in Cuba and Syria. uthorized Signature Kor-i h-ors cl,r1c 0.n Printed Name Title 11V 001)4'`:-1) s )) Name ofEntity /Corporation STATE OF T-716 r COUNTY OF W,11Sboroo1 In The fore oing instrument was acknowledged before me on this Z2 day of Jt.tn t , 2014. , by 6 r Z 11 o rsccr r1 l Ct ,n (name of person whose signature is being notarized) as the J res t Gt €r1.4 (title) of 1`-AA Dr 5 ConS1-SVC4- 1 a n , -l 1 c - (name of corporation/entity), personally kno to me as described herein '( , or produced a (type of identification) tificatio .1 d who did/did not take an oath. Notary Public Printed Name My Commission Expires: 2 Z.cx . '' __ Notary P ai';c - state of Ftar!.aa My Comm. Expires Feb 27, 201yJ"t i35 NOTARY SEAL ABOVE 4 " .9; ?" Commission # FF 096915 Airs LOCK€ AMENDMENT NO. 1 TO CONSTRUCTION MANAGER AT RISK SERVICES CONTINUING CONTRACT, DATED JUNE 15, 2016, BETWEEN KHORS CONSTRUCTION. ("Contractor") AND THE CITY OF CLEARWATER ("City") The City of Clearwater's RFQ #24-16 Construction Management at Risk Services for Continuing Contracts will be for a four (4) year period. This contract will be from Aug 4, 2016 Aug. 4, 2020 and will be for projects up to $2,000,000. Khors Construction By: Name: r akit,h Title: Date: 2/ 3/I Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: ID#18-4223 Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: Action ItemIn Control: Police Department Agenda Number: 5.1 SUBJECT/RECOMMENDATION: Approve an agreement between the City of Clearwater and the School Board of Pinellas County, Florida providing for the continuation of the School Resource Officer program at Clearwater High School, Countryside High School and Oak Grove Middle School for a one-year period, commencing July 1, 2017 through June 30, 2018, and authorize the appropriate officials to execute same. (consent) SUMMARY: Under the terms of the one-year agreement between the School Board of Pinellas County and the City of Clearwater, the City will provide law enforcement and related services to Clearwater High School, Countryside High School and Oak Grove Middle School during the regular school year. The assigned officers (1 per school) will provide instruction in law education, will serve as resource persons, conduct investigations, provide security and maintain the peace, make arrests and provide support services as necessary. The annual cost of salaries and benefits of three officers over the one-year period will be $298,773. Total annual reimbursement from the School Board will be $57,944.64 for each officer, for a total reimbursement of $173,833.92, reflecting a 3% increase in reimbursement to the City for SRO services during the 2017/2018 contract period. Additional funding needed will be provided by a transfer of Florida Contraband Forfeiture Fund revenues. The cost incurred by the Police Department is offset by the benefit of the program to the community and the Police Department. The Police Department has maintained a good working relationship with the School Board. School Resource Officers have been assigned to Clearwater High School since January 1, 1985 and Countryside High School since January 1, 1986 and Oak Grove Middle School since August 27, 2007. APPROPRIATION CODE AND AMOUNT: A first quarter budget amendment will increase special project 181-99264, School Resource Officers by $173,833.92 in reimbursement revenues to recognize Pinellas County’s portion of funding. An amendment will also transfer $124,939 in fine revenue from special program 181-99330, Florida Contraband Forfeiture Fund, to 181-99264, School Resource Officers to fund the balance needed for the year. Page 1 City of Clearwater Printed on 1/25/2018 Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: ID#18-4233 Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: Action ItemIn Control: Engineering Department Agenda Number: 6.1 SUBJECT/RECOMMENDATION: Approve a proposal from Construction Manager at Risk Keystone Excavators Inc., of Oldsmar, Florida, in the amount of $104,555.00 for the construction of Arlie Avenue Stormwater Improvements (17-0068-EN) and authorize the appropriate officials to execute same. (consent) SUMMARY: August 4, 2016, City Council approved the use of Construction Manager at Risk Services (CMR) for Continuing Contracts Biltmore Construction Co., Inc. of Belleair, FL; Cathey Construction and Development, LLC of Mexico Beach, FL; Certus Builders, Inc. of Tampa, FL; J. Kokolakis Contracting, Inc. of Tarpons Springs, FL; J.O. Delotto & Sons, Inc. of Tampa, FL; Keystone Excavators, Inc. of Oldsmar, FL; Khors Construction, Inc. of Thonotosassa, FL; and Wharton-Smith, Inc. of Sanford, FL for a period of four years. These firms were selected in accordance with Florida Statutes 255.103 and 287.055 under Request for Qualifications 24-16 based upon construction experience, financial capability, availability of qualified staff, local knowledge and involvement in the community. The existing storm system is currently located in unincorporated Pinellas County and is nearing the end of its useful lifespan. This project consists of removing the aged storm system and constructing a new storm conveyance system within the City’s right of way. This project also includes the demolition of the existing nonfunctioning stormwater pump station located at the west end of Arlie Avenue. Construction duration is 60 calendar days with an anticipated start in mid-February 2018. Future maintenance of the system upgrades will be performed by the Stormwater Maintenance Division. APPROPRIATION CODE AND AMOUNT: 0315-96124-563700-539-000-0000 $104,555 Funds are available in capital improvement project 315-96124, Storm Pipe System Improvements, to fund this contract. Page 1 City of Clearwater Printed on 1/25/2018 August 19, 2016 Keystone Excavators, Inc. Attention: Robert Fornwalk 371 Scarlet Blvd. Oldsmar, FL 34677 RE: 2016 – 2020 Construction Management at Risk Services for Continuing Contracts Dear Mr. Fornwalk: Keystone Excavators. Inc., has been awarded the 2016 – 2020 Construction Management at Risk Services for Continuing Contracts by the City of Clearwater Engineering Dept. and City Council. Enclosed are the contract documents for your files. Per the Request for Qualifications RFQ # 24-16, the following insurance documents are required. Please submit the insurance documents references below no later than Friday, Sept, 2, 2016 to: City of Clearwater Attn: Engineering Contract Specialist, RFQ #24-16 P.O. Box 4748 Clearwater, FL 33758-4748 Or via email to Lisa.Bayly@myclearwater.com INSURANCE REQUIREMENTS. The Contractor (respondent) shall, at its own cost and expense, acquire and maintain (and cause any subcontractors, representatives or agents to acquire and maintain) during the term with the City, sufficient insurance to adequately protect the respective interest of the parties. Coverage shall be obtained with a carrier having an AM Best Rating of A-VII or better. In addition, the City has the right to review the Contractor’s deductible or self-insured retention and to require that it be reduced or eliminated. Specifically the Contractor must carry the following minimum types and amounts of insurance on an occurrence basis or in the case of coverage that cannot be obtained on an occurrence basis, then coverage can be obtained on a claims-made basis with a minimum three (3) year tail following the termination or expiration of this Agreement. Specific work may require additional coverage on a case by case basis: a.Commercial General Liability Insurance coverage, including but not limited to, premises operations, products/completed operations, products liability, contractual liability, advertising injury, personal injury, death, and property damage in the minimum amount of $1,000,000 (one million dollars) per occurrence and $2,000,000 (two million dollars) general aggregate. b.Commercial Automobile Liability Insurance coverage for any owned, non-owned, hired or borrowed automobile is required in the minimum amount of $1,000,000 (one million dollars) combined single limit. DATE (MM/DD/YYYY)CERTIFICATE OF LIABILITY INSURANCE THIS CERTIFICATE IS ISSUED AS A MATTER OF INFORMATION ONLY AND CONFERS NO RIGHTS UPON THE CERTIFICATE HOLDER. THISCERTIFICATE DOES NOT AFFIRMATIVELY OR NEGATIVELY AMEND, EXTEND OR ALTER THE COVERAGE AFFORDED BY THE POLICIESBELOW. THIS CERTIFICATE OF INSURANCE DOES NOT CONSTITUTE A CONTRACT BETWEEN THE ISSUING INSURER(S), AUTHORIZED REPRESENTATIVE OR PRODUCER, AND THE CERTIFICATE HOLDER. IMPORTANT: If the certificate holder is an ADDITIONAL INSURED, the policy(ies) must be endorsed. If SUBROGATION IS WAIVED, subject tothe terms and conditions of the policy, certain policies may require an endorsement. A statement on this certificate does not confer rights to the certificate holder in lieu of such endorsement(s). CONTACTPRODUCERNAME:FAXPHONE(A/C, No):(A/C, No, Ext):E-MAILADDRESS: INSURER(S) AFFORDING COVERAGE NAIC # INSURER A : INSURED INSURER B : INSURER C : INSURER D : INSURER E : INSURER F : COVERAGES CERTIFICATE NUMBER:REVISION NUMBER: THIS IS TO CERTIFY THAT THE POLICIES OF INSURANCE LISTED BELOW HAVE BEEN ISSUED TO THE INSURED NAMED ABOVE FOR THE POLICY PERIODINDICATED. NOTWITHSTANDING ANY REQUIREMENT, TERM OR CONDITION OF ANY CONTRACT OR OTHER DOCUMENT WITH RESPECT TO WHICH THISCERTIFICATE MAY BE ISSUED OR MAY PERTAIN, THE INSURANCE AFFORDED BY THE POLICIES DESCRIBED HEREIN IS SUBJECT TO ALL THE TERMS,EXCLUSIONS AND CONDITIONS OF SUCH POLICIES. LIMITS SHOWN MAY HAVE BEEN REDUCED BY PAID CLAIMS. ADDL SUBRINSR POLICY EFF POLICY EXPTYPE OF INSURANCE LIMITSPOLICY NUMBERLTR (MM/DD/YYYY) (MM/DD/YYYY)INSD WVD COMMERCIAL GENERAL LIABILITY EACH OCCURRENCE $DAMAGE TO RENTEDCLAIMS-MADE OCCUR $PREMISES (Ea occurrence) MED EXP (Any one person) $ PERSONAL & ADV INJURY $ GEN'L AGGREGATE LIMIT APPLIES PER:GENERAL AGGREGATE $ PRO-POLICY LOC PRODUCTS - COMP/OP AGG $JECT $OTHER:COMBINED SINGLE LIMITAUTOMOBILE LIABILITY $(Ea accident) BODILY INJURY (Per person) $ANY AUTOALL OWNED SCHEDULED BODILY INJURY (Per accident) $AUTOS AUTOSNON-OWNED PROPERTY DAMAGE $HIRED AUTOS (Per accident)AUTOS $ UMBRELLA LIAB EACH OCCURRENCE $OCCUR EXCESS LIAB CLAIMS-MADE AGGREGATE $ $DED RETENTION $PER OTH-WORKERS COMPENSATION STATUTE ERAND EMPLOYERS' LIABILITY Y / NANY PROPRIETOR/PARTNER/EXECUTIVE E.L. EACH ACCIDENT $N / AOFFICER/MEMBER EXCLUDED?(Mandatory in NH)E.L. DISEASE - EA EMPLOYEE $If yes, describe under E.L. DISEASE - POLICY LIMIT $DESCRIPTION OF OPERATIONS below DESCRIPTION OF OPERATIONS / LOCATIONS / VEHICLES (ACORD 101, Additional Remarks Schedule, may be attached if more space is required) CERTIFICATE HOLDER CANCELLATION SHOULD ANY OF THE ABOVE DESCRIBED POLICIES BE CANCELLED BEFORETHE EXPIRATION DATE THEREOF,NOTICE WILL BE DELIVERED INACCORDANCE WITH THE POLICY PROVISIONS. AUTHORIZED REPRESENTATIVE © 1988-2014 ACORD CORPORATION. All rights reserved. The ACORD name and logo are registered marks of ACORDACORD 25 (2014/01) KEYST-1 OP ID: BT 09/19/2016 Case J. Fessler, AAI, CICFessler Agency-Clearwater3165 N McMullen Booth Road G-2Clearwater, FL 33761-2020Case J. Fessler, AAI, CIC 727-726-3377 727-725-4698 cfessler@fessleragency.com National Trust 20141 FCCI Insurance Company 10178Keystone Excavators, Inc.371 Scarlet Blvd.Oldsmar, FL 34677 Allied World Assurance Co. Travelers Insurance Company 40282 AX 1,000,000 X GL000954837 12/01/2015 12/01/2016 100,000 5,000 X Per Proj Agg 1,000,000 2,000,000 X 2,000,000 1,000,000 AX CA00148527 12/01/2015 12/01/2016 XX PIP 10,000 XX 5,000,000 B UMB00098587 12/01/2015 12/01/2016 5,000,000 10000X X B 60855 12/01/2015 12/01/2016 1,000,000N1,000,000 1,000,000 C POLLUTION 51521322 11/02/2015 11/02/2016 LIMITS 2,000,000 D EQUIPMENT FLOATER 6603842B003 12/01/2015 12/01/2016 LIMITS 300,000 Certificate holder is included as additional insured on the GL & Auto Liability *Limited Professional(Contractors E&O)Policies are primary & non-contributory.Waiver of Subrogation is included on the GL; Auto Liability & Workers Compensation.Includes Separation of Insured *30 days notice of cancellation,10 days for nonpayment CITYCL9 City of ClearwaterEngineering ContractSpecialistRFQ#24-16 Po Box 4748Clearwater, FL 33758-4748 BAYSHORE BLVDMAXIMO AVESAN JOSE ST ARLIE AVE S A N D O M I N G O S T SAN CARLOS ST SAN GABRIEL ST ROSE RDAlligator Lake LOCATION MAP ²Prepared by:Engineering DepartmentGeographic Technology Division100 S. Myrtle Ave, Clearwater, FL 33756Ph: (727)562-4750, Fax: (727)526-4755www.MyClearwater.com PROJECTSITE ^ CRM PV N.T.S.274B 09-29s-16e9/11/2008Map Gen By:Reviewed By:S-T-R:Grid #:Date:Scale: ARLIE AVEDRAINAGE IMPROVEMENTS BRAESIDE PL OLD TAM PA BAYDocument Path: V:\GIS\Engineering\Location Maps\ArlieAveStorm.mxd Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: ID#18-4280 Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: Action ItemIn Control: Engineering Department Agenda Number: 6.2 SUBJECT/RECOMMENDATION: Approve a contract and work order to Stantec Consulting Services Inc., of Tampa, Florida, in the amount of $834,238 for Imagine Clearwater design Phase I (17-0031-EN), and authorize the appropriate officials to execute same. (consent) SUMMARY: The Imagine Clearwater master plan was commissioned by the City and work began in June 2016. Over the next six months, the City and the consultant team hosted numerous conversations with residents and stakeholders, including seven large-scale public workshops. February 2, 2017, City Council approved Imagine Clearwater master plan. May16, 2017, the City of Clearwater issued a Request for Qualifications (RFQ #13-17) for Imagine Clearwater engineering design and consulting services. October 19, 2017, City Council approved Stantec as design consultant of Imagine Clearwater at the recommendation of the City’s selection committee consisting of the Assistant City Manager, CRA Director, Planning and Development Director, Parks and Recreation Director and Engineering Director following presentations from the top four ranked firms: Stantec, Sasaki and Associates, Wantman Group, and Cardno. November 7, 2017, Citizens of Clearwater overwhelmingly approved the referendum to amend the city charter to allow for construction/improvements along the downtown waterfront. This work order includes the necessary professional services needed to complete the Concept Validation of the Imagine Clearwater Master Plan and Pre-Design Plans (15% Plans). In addition, this work order will provide design investigation and costing needed to budget and schedule the implementation of the Phase 1 and 2 project improvements. APPROPRIATION CODE AND AMOUNT: 0315-94892-561000-579-000-0000 $834,238 Funds are available in capital improvement project 315-94892, Imagine Clearwater Implementation, to fund this work order. Page 1 City of Clearwater Printed on 1/25/2018 Attachment “B” 323 Hardscape Amenities / Site Furnishings $21,520 $21,520 324 Water Features $18,800 $18,800 325 Playground $16,560 $16,560 326 Tree, Palm, Ornamental Plantings $18,640 $18,640 327 Site Lighting Fixtures $10,920 $10,920 328 Signage $15,800 $15,800 329 Irrigation $4,960 $4,960 Total Task 320 $127,600 330 Architecture Master Plan/Pre-Design 331 Bandshell & Support Services $103,600 $103,600 332 Plaza Shade Structure/Storage/Restrooms/ Retail Shell $69,200 $69,200 333 Marina Facility/Ticket Booth/Restrooms $20,000 $20,000 334 Monument Signage $16,200 $16,200 335 Library Façade/Connections $3,040 $3,040 336 Pedestrian Bridges $16,200 $16,200 Total Task 330 $228,240 Subtotal, Labor and Subcontractors $758,238 890 Contingency (w/City Staff Approval $66,000 900 Reimbursable $10,000 Total Fee $834,238 1509 W. Swann Avenue, Suite 225 Tampa, FL 33606 (813) 258-8818 | Fax (813) 258-8525 www.moffattnichol.com January 3, 2018 Stantec 777 S Harbour Island Boulevard Suite 600 Tampa, Florida 33602-5729 Attn: Hamid Sahebkar, P.E. Subject: Concept Validation – Marine Components Dear Hamid: The proposed Imagine Clearwater Master Plan for the City of Clearwater includes an inland estuary area and improved public water access in the vicinity of the existing marina. Construction of the estuary area is expected to require removal of some parking areas currently used by the marina. The estuary may also affect access by delivery and service vehicles to the marina. Public water access in the vicinity of the marina needs to consider the safety of the users as well as maintaining marina functionality. This proposal is to support Stantec in validating and updating these component of the concept to meet these goals. M&N will use our industry experience in planning and designing marinas and urban waterfronts as well as existing available information, including relevant master plans and studies, related to the project to evaluate impacts to marina operations due to the proposed estuary and to identify potential water access opportunities. M&N will review the proposed parking for the waterfront area with regards to marina operations and waterfront access. M&N will meet with City staff, including the marina manager, to review the marina parking plans and functionality under existing and proposed conditions as well as safety related to the water access feature. M&N will summarize the estuary impacts to marina operations and potential water access features in a letter report or summary memorandum for inclusion in an overall concept validation report. This scope of work is for concept validation and development only and does not include design of these features. Concept drawings, if needed, will be depicted as hand sketches. The fee to complete this study is a lump sum of $12,000. M&N also proposes an additional $3,000 T&M task for meetings with stakeholders, city staff, and other parties as needed. The total proposed fee is $15,000. M&N looks forward to the opportunity to work with Stantec on this exciting project. Should you have any questions or comments, please contact me at mherrman@moffattnichol.com or (813) 469-4463. Sincerely, MOFFATT & NICHOL Michael Herrman, P.E. Senior Project Manager Attachment "B" Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: ID#18-4258 Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: Action ItemIn Control: Planning & Development Agenda Number: 7.1 SUBJECT/RECOMMENDATION: Approve a funding agreement between the City of Clearwater and the Pinellas Suncoast Transit Authority (PSTA) to provide enhanced Jolley Trolley service during Spring Break, for period February 19, 2018 through April 29, 2018, with the City contributing a lump sum not to exceed $65,000; and authorize the appropriate officials to execute same. (consent) SUMMARY: Alternatives for traveling to Clearwater Beach during the Spring Break season are critical to the economic vitality of Clearwater and our tourism industry. The City and PSTA propose utilizing the Harborview Center and City Hall parking lots as park and ride lots for the 70-day period commencing February 19, 2018 through April 29, 2018. City Hall parking meters will be suspended during this period. Users will have the option of taking the Clearwater Ferry Taxi Service or the Trolley service to and from the Beach instead of driving. Trolley service will be provided free to Clearwater Beach visitors. PSTA currently provides several routes between Downtown and Clearwater Beach, as well as north and south along the Beach. PSTA operates the Suncoast Beach Trolley which runs from Downtown Clearwater south to St. Pete Beach, and has an agreement with the Jolley Trolley to operate a Beach circulator (North and South Beach routes) and the Coastal Route connecting to Tarpon Springs. PSTA has developed a service plan that will increase the number of vehicles that will serve the Beach during the Spring Break season The proposed agreement sets forth the City’s commitment to contribute a lump sum not to exceed $65,000 towards PSTA’s additional financial obligations, including PSTA’s agreement with the Jolley Trolley to provide enhanced service on its Beach circulator routes during the Spring Break season. Trolley services this season will be provided free of charge and riders who board at the two designated free Downtown parking lots will be provided a complimentary day-pass for their trip to the Beach. This complimentary day pass may be used all day - on and off the Beach. Riders will have significantly shorter wait times this season with a change in the service pulsing, as service headway is scheduled to be at 15-minute intervals (i.e., 4 vehicles per hour) at the City Hall lot, and every 10-15 minutes at the Harborview Center with 5 vehicles per hour. The free park and ride service is planned to start at 9:00 AM and end at the regular close of service (approximately 10:00 PM Sunday-Thursday and 12:00 AM Friday/Saturday). The City and PSTA have developed a marketing plan that includes a media campaign and promotional components. Directional signs for park and ride locations and variable sign massages will also be deployed. Coordination with, and information about, other transportation alternatives such as Page 1 City of Clearwater Printed on 1/25/2018 File Number: ID#18-4258 the Clearwater Ferry will be included in the materials developed. APPROPRIATION CODE AND AMOUNT: A first quarter budget amendment will increase cost code 435-01333-581000, Payment to Agencies, by $65,000 to fund this contract. This increase will be funded with available Parking fund operating revenues. USE OF RESERVE FUNDS: N/A Page 2 City of Clearwater Printed on 1/25/2018 Page 1 of 3 [A04-01420 /215124/1] CLEARWATER BEACH SPRING BREAK 2018 ROUTE FUNDING AGREEMENT THIS FUNDING AGREEMENT (Agreement) is entered into on this day of , 2018, by and between the PINELLAS SUNCOAST TRANSIT AUTHORITY, an independent special district (“PSTA”), with its principal place of business located at 3201 Scherer Drive North, St. Petersburg, FL 33716, and the CITY OF CLEARWATER, FLORIDA, a municipal corporation of the State of Florida with its principal place of business located at 112 South Osceola Avenue, Clearwater, Florida 33756 (the “City of Clearwater”) (collectively referred to as the “Parties”). WHEREAS, the Spring Break seasonal enhanced service promotion began as a partnership between PSTA and the City in 2017; WHEREAS, both parties agree that the Spring Break seasonal pilot in 2017 was a valuable method that encouraged residents, visitors and employees to use alternative transportation options to access all that Clearwater Beach has to offer; WHEREAS, PSTA, by and through an agreement with Jolley Trolley Transportation of Clearwater, Inc. (the “Jolley Trolley Agreement”), engages the Jolley Trolley to provide fixed route trolley services including the fixed route services on Clearwater Beach as part of the Beach Routes (the “Clearwater Beach Route”) and other routes serving Clearwater Beach; WHEREAS, the Jolley Trolley Agreement provides that PSTA will make certain funding contributions to Jolley Trolley in exchange for the Clearwater Beach Route services; WHEREAS, whereas PSTA and the City of Clearwater have entered into a Clearwater Beach Route Funding Agreement wherein the City will provide funding to PSTA for Fiscal Year 2017/18 for the services provided pursuant to the Jolley Trolley Agreement; WHEREAS, PSTA regularly operates bus service from downtown Clearwater and beach communities along Gulf Boulevard on the Suncoast Beach Trolley; WHEREAS, both the city and PSTA understand the significant auto congestion on Clearwater Beach and need for expanded alternative ways for residents, visitors, and employees to access the beach; WHEREAS, PSTA desires to provide enhanced downtown to beach service on the Suncoast Beach Trolley and Jolley Trolley South Beach Route during the 2018 Spring Break period of February 19, 2018 through April 29, 2018 including stops at parking locations at the Clearwater Downtown Marina (behind the Harbor View Center) and Clearwater City Hall; WHEREAS, PSTA will not extend existing bus services to these parking locations without the shared contribution of the City of Clearwater, as contemplated by this Agreement. Page 2 of 3 [A04-01420 /215124/1] NOW, THEREFORE, the Parties for and in receipt of the mutual promises and consideration described herein, hereby mutually agree that: 1. RECITALS. The above recitals are true and correct and, together with all exhibits, are incorporated herein by reference. 2. BASE SERVICE COSTS. City of Clearwater will contribute toward PSTA’s costs of enhanced service on the Suncoast Beach Trolley and Jolley Trolley South Beach Route during the 2018 Spring Break period of February 19, 2018 and April 29, 2018 at a lump sum cost not to exceed Sixty-five Thousand ($65,000.00) Dollars, which will be paid to PSTA by the City of Clearwater by March 31, 2018. 3. FAILURE TO MAKE PAYMENT. In the event City of Clearwater fails to make the payment provided in Section 2 above, PSTA may cancel this Agreement, which may result in the termination of the enhanced trolley services. 4. JOINT MARKETING. The parties agree to coordinate a joint marketing effort to advertise this enhanced service and other transportation services to and on the beach that encourage the use of non-automotive transportation. 5. EFFECTIVE DATE. This Agreement shall take effect on the first date above written and shall terminate on April 29, 2018. 6. REPRESENTATIONS AND WARRANTIES. The Parties represent and warrant that they are authorized to enter into this Agreement without the consent or joinder of any other person or entity and that the individuals executing this Agreement have full power and authority to bind their respective parties hereto. Nothing contained herein shall be construed to limit or waive any of PSTA’s rights under the Jolley Trolley Agreement. IN WITNESS WHERE OF, the Parties have caused this Agreement to be executed as of the date first above written. PINELLAS SUNCOAST TRANSIT AUTHORITY By: _ Witness Brad Miller, Chief Executive Officer Witness Approved as to Form: Alan S. Zimmet, Esq. General Counsel Page 3 of 3 [A04-01420 /215124/1] CITY OF CLEARWATER, FLORIDA Countersigned: By: _ George N. Cretekos, Mayor William B. Horne II, City Manager Attest: Approved as to Form: Rosemarie Call, MPA, CM Assistant City Attorney City Clerk ! ! ! ! Clearwater Beach Marina Clearwater Beach Transit Center! Downtown Clearwater to Clearwater Beach ±0 0.5Miles Harborview CenterParking City HallParking Lot 2018 Spring Break Trolley Park & Ride kkk kLegend !Clearwater Ferry Stops Park and Ride Jolley Trolley North Beach Route Jolley Trolley South Beach Route Jolley Trolley Coastal Route Suncoast Beach Trolley Clearwater Ferry Route Travels One Way Parking DRAFT FOR REVIEW1/8/2018 ! ! ! ! Clearwater Beach Marina Clearwater Beach Transit Center ! Jolley Trolley North Beach Route ±0 0.5Miles Harborview CenterParking 2018 Spring Break Trolley Park & Ride Legend !Clearwater Ferry Stops Park and Ride Jolley Trolley North Beach Route Parking DRAFT FOR REVIEW1/19/2018 Text Clearwater Beach Marina Clearwater Beach Transit Center! Jolley Trolley South Beach Route ±0 0.5Miles Harborview CenterParking City HallParking Lot 2018 Spring Break Trolley Park & Ride Legend Park and Ride Jolley Trolley South Beach Route Parking DRAFT FOR REVIEW1/8/2018 Clearwater Beach Marina Clearwater Beach Transit Center! Jolley Trolley Coastal Route ±0 0.5Miles Harborview CenterParking City HallParking Lot 2018 Spring Break Trolley Park & Ride kkk kLegend Park and Ride Jolley Trolley Coastal Route Travels One Way Parking DRAFT FOR REVIEW1/8/2018 Clearwater Beach Marina Clearwater Beach Transit Center! Suncoast Beach Trolley ±0 0.5Miles Harborview CenterParking City HallParking Lot 2018 Spring Break Trolley Park & Ride k kLegend Park and Ride Suncoast Beach Trolley Travels One Way Parking DRAFT FOR REVIEW1/8/2018 Yard Sign - wayfinding City A-Frame - wayfinding City A-Frame - lot marker Spring Break 2018 Sign Deployment DRAFT 1/18/18 2018 Spring Break Trolley and Park & Ride Service (Clearwater) Marketing Plan DRAFT Background  The City of Clearwater and Clearwater Beach face a massive influx in traffic during the annual Spring Break season.  In the attempt to offset some of the congestion, PSTA , Jolley Trolley, the City of Clearwater, the Clearwater Regional Chamber, and the Clearwater Beach Chamber are partnering to provide and promote public transit services in and around the downtown Clearwater area  PSTA’s Clearwater Beach Transit Center is scheduled to be open in time to use it for this service Key Messaging  Park free, Ride free  Clearwater Ferry an option Service Details  Extending North Coastal to serve CBTC effective 2/18/18 = one seat ride to beach  Two park and ride locations: Clearwater City Hall and Harborview Center Lot o City also owns lot next to city hall, Joelle to see if it can be used as overflow  5 trolleys per hour will serve the park and ride — will advertise service as every 15 minutes o Service runs 9 a.m. to 10 p.m. Sunday through Thursday, and until midnight on Friday and Saturday  Marina stop for return service (temporary for spring break only for now) Promotion Details  Park free, ride the trolley free  All riders boarding at one of the two lots get a free day pass for all day travel  February 19 through April 29, 2018 Promotional Elements  Press Release – joint PSTA with city, Chambers  Park & Ride yard signs  Rack card for distribution throughout downtown and off beach hotels o Include alternate return modes o Include Clearwater Ferry  City of Clearwater utility bill insert (city) – maybe Dunedin too?  Park & Ride lot signage including maps, times, frequency, park at your own risk, alternative ways back to the lot, photos of the vehicles  Park & Ride sandwich boards (city owned) were saved and can be redeployed  Specialty stop signage indicating where to board on return trip  CBTC specialty signage: include walk times to return stop, arrows @ Marina and CBTC  Variable message signs (city)  Sidewalk decals/stencil usage  Kickoff event to open the beach for Spring Break, Feb 20th at 11:00 a.m.  PSTA webpage DRAFT 1/18/18  Social media  City will have event promoters list bus and trolley service in materials — provide palm card copies too Items PSTA needs city support/assistance with: 1. Permission to install ground level way-finding signs (yard signs) — approved in concept, pending approval of a sign deployment plan, approval pending at 1/29 work session 2. Creative ideas for how to install similar signage at Cleveland & Ft. Harrison (no grassy areas at intersection corners) — A-frame signs 3. Suspension of parking meters at city hall — city staff seeking approval at 1/29 work session 4. Variable message signs on the approaches to downtown 5. Any city press release regarding Spring Break to include Park N Ride language Other relevant notes  Signalized crosswalk at E Shore Dr being installed  NO Digital ads = initial partner discussion concurred that on-site promotion is more effective than any digital expenditure DRAFT 1/18/18 Sign Deployment Plan – DRAFT 1. Spring Break service runs 2/19 through 4/29/18 2. Wayfinding and lot marker signs to be deployed as follows: a. Yard signs (wayfinders) installed in locations indicated on deployment map i. 2/19/18 by PSTA public engagement staff (Juan and Nicole) b. Signage provided to city of Clearwater for attachment on A-Frame signs by 2/1/18 i. A-frame signs (wayfinding and lot markers) installed on 2/19/18 by city of Clearwater staff 3. Sign locations checked twice weekly to ensure they are in good repair and in correct locations a. PSTA transportation supervisors to check every Monday morning and Thursday afternoon and replace as needed 4. All signs picked up by PSTA (yard signs) and city of Clearwater (a-frames) early in the morning on 4/30/18 Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: ID#18-4244 Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: Action ItemIn Control: Public Utilities Agenda Number: 8.1 SUBJECT/RECOMMENDATION: Approve an Interlocal Agreement between the City of Clearwater and Pinellas County for Flow Monitoring Equipment and authorize the appropriate officials to execute same. (consent) SUMMARY: The City has installed sewer system flow monitors in strategic locations to assist the City in identifying portions of the sewer system where infiltration /inflow (I/I) flows are such that additional I/I abatement work is required. These flow meters also serve to demonstrate the effectiveness of completed I/I work. The City of Clearwater is a member of the Pinellas County Wastewater/Stormwater Task Force (TF). The installation of these flow meters is one of the initiatives identified by the TF that assists in I/I abatement efforts, and the TF has recommended that their members install sewer system flow meters. As such, the County has agreed to provide members of the TF with partial reimbursement for the cost of installing these flow meters. This Interlocal Agreement provides for this funding. APPROPRIATION CODE AND AMOUNT: 0315-96665-337900-000-000-0000 $36,585.00 (Grant Revenue) To provide partial matching of City funding from the Capital Improvement Projects 315-96665, Sanitary Sewer R&R project. USE OF RESERVE FUNDS: N/A Page 1 City of Clearwater Printed on 1/25/2018 1 INTERLOCAL AGREEMENT BETWEEN THE CITY OF CLEARWATER AND PINELLAS COUNTYFOR FLOW MONITORING EQUIPMENT THIS FUNDING AGREEMENT is entered into this ____ day of ________________, 2018, by Pinellas County, a political subdivision of the State of Florida herein referred to as the “County”, and the City of Clearwater, a municipal corporation of the State of Florida herein referred to as the “City”, jointly referred to herein as “Parties”. W I T N E S S E T H: WHEREAS, this Agreement is made and entered between the parties pursuant to Section 163.01, Florida Statutes, the "Florida Interlocal Cooperation Act of 1969"; and WHEREAS, County received funds through a settlement with Parties responsible for the Deepwater Horizon accident which affected the Gulf of Mexico and communities in the region including Pinellas County; and WHEREAS, the County has identified and approved projects intended to benefit the public or that serve a public benefit that the Pinellas County Board of County Commissioners intends to be enhanced with funding from the aforementioned settlement; and WHEREAS, on December 13, 2016, the Pinellas County Board of County Commissioners approved Resolution 16-90 delegating to the County Administrator the authority to enter into agreements with the Parties necessary to effectuate the approved projects within the amounts approved by the Pinellas County Board of County Commissioners for each project; and WHEREAS, the City is one of the Parties necessary to effectuate a Flow Monitoring Project recommended by the Wastewater/Stormwater Task Force, which proposes to install twelve (12) Flow Monitors at designated locations within the City to measure inflow and infiltration of stormwater and groundwater into the City’s sanitary sewer system (“Project”); and WHEREAS, the City has coordinated installation of a majority of such Flow Monitors and is seeking from the County a one-tme reimbursement for such cost. NOW THEREFORE, in consideration of the mutual terms, covenants, representations, and conditions herein contained, the Parties agree as follows: 1.Performance of Services: The City shall complete the Project by September 30, 2018.For purposes of this Agreement, the Project shall be considered complete once the installation of all twelve (12) Flow 2 Monitors have been completed and invoiced to the County in accordance with Section Two (2) of this Agreement below. The City shall comply with all terms and conditions for the Performance of Services and Project Funding. The City shall be responsible for the professional quality, technical accuracy, timely completion, and coordination of all designs, drawings, specifications, reports, and other services furnished by the City under this Agreement. The City shall orally consult with the County and the Wastewater/Stormwater Task Force regarding the Project at any time upon County’s request. 2.Funding: County agrees to provide up to thirty-six thousand five hundred eighty-five and 00/100 dollars ($36,585.00) for the Project on a matching reimbursement basis in accordance with the following: After the Project is complete and no later than September 30, 2018, the City shall deliver an itemized project invoice to the County that details the total project costs. Together with the invoice, the City shall submit a certification that (1) the invoice is accurate, and (2) the City has expended all invoiced funds in furtherance of the Project. Also together with the invoice, the City shall submit a project completion report, summarizing how the cumulative amount of invoiced and non-invoiced funds have been expended for Project completion along with comprehensive evidence thereof (“Project Completion Report”). Within forty-five (45) days of receiving the invoice, County shall either: (1) provide full payment to the City for the invoice; or (2) if County finds the invoice, Certification, or Project Completion Report unacceptable for any reason, provide written notice to the City of any defects. If County provides a written notice of defects, the City shall have thirty (30) days from receipt of said notice to cure said defects and provide written evidence of same to County; if theCity fails to cure the defects within the requisite timeframe, or if County finds the evidence of such corrections to be defective for any reason, this Agreement is subject to termination with cause in accordance with Section Four (4) below. 3.Agreement Term: This Agreement shall become effective upon execution by both Parties and expire on December 31, 2018, unless terminated earlier as provided in Section Four (4) below. 4.Termination: This Agreement may be terminated in writing by either Party: (1) without cause upon fifteen (15) days of receipt of notice of termination by the other Party; or (2) with cause immediately upon receipt of a notice of termination by the other Party. If the County terminates the Agreement with cause, the City shall, within seven (7) days of receipt of such notice, refund to County, all funding awarded to the City by the County under this Agreement. 3 In accordance with Section Five (5) below, any termination notice shall be sent by e-mail or USPS Certified Mail and deemed delivered or received on the date reflected by the e-mail read receipt or certified mail delivery receipt. This Agreement may also be terminated at any time by mutual written agreement of the Parties. 5.Project Managers and Notice: In order to assure proper coordination and review throughout the term of this Agreement, the City and County each designate a “Project Manager” as follows: CityDavid Porter Public Utilities Director City of Clearwater 1650 N. Arcturas Ave., Building C Clearwater, FL 33765-1945Office: 727-562-4960 E-mail: david.porter@myclearwater.com County Megan Ross, P.E., ENV SP Interim Utilities Director Pinellas County Utilities 6730 142nd Avenue N. Largo, FL 33771-4721 Office: (727) 582-2304 E-mail: mross@pinellascounty.org The Project Managers shall be responsible for transmitting and receiving all communications concerning this Agreement to the other Party. All notices, invoices, approvals, and other correspondence required by law and this Agreement shall be in writing and delivered via e-mail or USPS Certified Mail to the respective Project Manager. Notice shall be considered delivered or received as reflected by an e-mail read receipt or a certified mail delivery receipt. 6.Payment Limitations and Fiscal Non-Funding: The County shall not be responsible for the operation, maintenance, or capital refreshment of any assets resulting in any way from the Project. This Agreement is not a general obligation of County. It is understood that neither this Agreement nor any representation by any County employee or officer creates any obligation to appropriate or make monies available for the purpose of this Agreement beyond the fiscal year in which this Agreement is executed. No liability shall be incurred by County, or any department, 4 beyond the monies budgeted and available for this purpose. If funds are not appropriated by County for any or all of this Agreement, County shall not be obligated to pay any sums provided pursuant to this Agreement beyond the portion for which funds are appropriated. County agrees to promptly notify the City in writing of such failure of appropriation, and upon receipt of such notice, this Agreement, and all rights and obligations contained herein, shall terminate without liability or penalty to County. 7.Records and Audit: The City agrees: a)To retain all data, financial records, statistical records, and any other records (including electronic storage media) pertinent to this Agreement (“Records”) for a period of three (3) years after termination or expiration of this Agreement or, if an audit has been initiated in accordance with subsection c) of this Section Seven (7) below and audit findings have not been resolved at the end of three (3) years, the records shall be retained until resolution of the audit findings. b) To maintain all Records in accordance with generally accepted accounting procedures and practices that sufficiently and properly reflect all revenues and expenditures of funds provided by County under this Agreement. c) To assure that all Records are subject at all reasonable times for inspection, review, audit, copy, or removal from premises by County personnel and other personnel duly authorized by County. d) To fully comply with the provisions of Chapter 119, Florida Statutes, as applicable. e) To include all requirements in this Section Seven (7) in all approved contracts and subcontracts under this Agreement. 8.Indemnification and Non-Agency Relationship: To the greatest extent under applicable law, the City agrees to indemnify and defend County, its officers, and employees, against all claims of any nature arising out of the Project. Nothing contained herein shall constitute a waiver by either Party of its sovereign immunity or the provisions of Section 768.28, F.S. Further, nothing herein shall be construed as consent by either Party to be sued by third parties in any manner arising out this Agreement or contracts related thereto. The City acknowledges that it is an independent Party and not an agent of County. 9.Modification of Agreement: This Agreement represents the entire agreement of the Parties. Any alterations, 5 variations, changes, modifications, or waivers of provisions of this Agreement shall only be valid when they have been reduced to writing, duly signed by each of the Parties hereto, and attached to the original of this Agreement. 10.Assignment: This Agreement may not be assigned by either Party without the prior written consent of the other Party. The Parties each bind itself, its successors, assigns, and legal representatives to the other Party hereto and to the successors, assigns, and legal representatives of such other Partyin respect to all covenants and obligations contained herein. 11.Agreement to be filed with the Clerk of the Circuit Court: Prior to its effectiveness, this Agreement and subsequent amendments thereto must be filed with the Clerk of the Circuit Court of Pinellas County. 12.Compliance with Applicable Laws: The City shall ensure that at all times and in all aspects of the Project, its employees, agents, and contactors are in compliance with all applicable Federal, state, and local laws. 13.Governing Laws: This Agreement and the rights and obligations of the Parties hereto shall be governed and construed according to the laws of the State of Florida. [REMAINDER OF PAGE INTENTIONALLY LEFT BLANK] 6 IN WITNESS WHEREOF, the Parties have caused these present to be duly executed, as of the day and year first above-mentioned. PINELLAS COUNTY, FLORIDA BY: ___________________________________ Mark S. Woodard, County Administrator Approved as to Form: BY: __________________________________ Assistant County Attorney CITY OF CLEARWATER, FLORIDA, A municipal corporation and political subdivision of the State of Florida ________________________ George N. CretekosMayor ________________________ William B. Horne, IICity Manager Approved as to form: ________________________ Camilo A. SotoAssistant City Attorney Attest: ________________________ Rosemarie CallCity Clerk Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: ID#18-4237 Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: Action ItemIn Control: Solid Waste/General Services Agenda Number: 9.1 SUBJECT/RECOMMENDATION: Approve a purchase order to Coastal Alternative Fuel Systems in Odessa, FL, in the amount of $130,000.00 for Ford vehicle up-fitting services (CNG Conversion); in accordance with City Code Section 2.564(b) Exceptions to Bid; and authorize the appropriate officials to execute same. (consent) SUMMARY: The purchase order will provide for the up-fit/conversion services required for eleven Ford vehicles in the current fiscal year 17/18. The purchases will be made through the City’s Master Lease Purchase Agreement or internal financing via an interfund loan from the Capital Improvement Fund, whichever is deemed to be in the City’s best interests. Gas G4582 Ford F150 Crew Cab CNG Gas G4583 Ford F150 Crew Cab CNG Gas G4584 Ford F150 Ext Cab 2WD CNG Gas G4585 Ford F150 Ext Cab 2WD CNG Gas G4586 Ford F150 Ext Cab 2WD CNG Gas G4587 Ford F250 Ext Cab 4WD CNG Gas G4588 Ford F250 Ext Cab 4WD CNG Gas G4589 Ford F250 Ext Cab CNG Solid Waste G4594 Ford F250 Crew Cab 2WD CNG Solid Waste G4595 Ford F250 Reg Cab 2WD CNG Solid Waste G4597 Ford F150 Crew Cab 2WD CNG At this time Coastal Alternative Fuel Systems is the only Ford Qualified/Certified Vehicle Modifier in the State of Florida. Pursuant to City Code Section 2.564(b) Exceptions to Bid and Quotation Procedure, Coastal Alternative Fuel Systems is a sole source and therefore these services are exempt from bidding. APPROPRIATION CODE AND AMOUNT: 316-94241-564100-519 $130,000.00 Page 1 City of Clearwater Printed on 1/25/2018 www.CoastalAFS.com 2438 Merchant Ave Suite 101 Odessa, FL 33556 Office; (727) 372-7000 Fax; (727) 372-7009 RE; Sole Source Letter January 8th 2018 To; City of Clearwater Coastal Alternative Fuel Systems is the Sole Source provider of Altech-Eco and Landi Renzo Ford QVM CNG Systems throughout the Florida Market. We provide exclusively in this Market Sales, Service, Parts and Installations of Ford QVM CNG Systems. Sincerely, Robert J Sessa President Coastal Alternative Fuel Systems Inc. Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: ID#18-4248 Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: Action ItemIn Control: Solid Waste/General Services Agenda Number: 9.2 SUBJECT/RECOMMENDATION: Approve the award of Invitation to Bid Number 27-17, Vehicle Upfitting Services to Enforcement One, Inc., of Oldsmar, Florida, in the amount of $250,000 for upfitting services; and authorize the appropriate officials to execute same. (consent) SUMMARY: In August 2017, Invitation to Bid (ITB) No. 27-17 for Vehicle Upfitting Services was issued. Upfit services consist of the fabrication and/or installation of various equipment and accessories in city vehicles. These items include, but are not limited to: lighting, consoles, controllers, brackets, outlets, tool holders, pipe racks, pipe tie-down systems, water cooler holders, and vise grips. The vendor must be able to perform the required work in a professional, efficient, and consistent manner. Enforcement One was the only bidder to respond to ITB No. 27-17. The primary use of this contract is for new vehicle upfits, with the occasional existing fleet vehicle requiring modifications. This contract will be utilized citywide on an as-needed basis by all departments, with the exception of Police, who have a separate upfitting contract (also with Enforcement One), awarded as a result of ITB No. 05-17. This bid award is valid for two renewal terms. The anticipated expenditures for future upfit services will be brought forward with each fiscal year’s respective new vehicle purchase authorization request. Departments with new vehicles purchased this fiscal year include Building and Maintenance, Gas System, Engineering, and Public Utilities. APPROPRIATION CODE AND AMOUNT: Departments with authorized vehicle purchases have 17/18 funds budgeted for the upfitting services Page 1 City of Clearwater Printed on 1/25/2018 Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: 9092-18 2nd rdg Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: OrdinanceIn Control: Legal Department Agenda Number: 10.1 SUBJECT/RECOMMENDATION: Adopt Ordinance 9092-18 on second reading, amending the future land use plan element of the Comprehensive Plan of the city to change the land use designation for certain real property whose post office address is 1005 Old Coachman Road, Clearwater, Florida 33765, from Recreation/Open Space (R/OS) to Transportation/Utility (T/U). SUMMARY: APPROPRIATION CODE AND AMOUNT: USE OF RESERVE FUNDS: Page 1 City of Clearwater Printed on 1/25/2018 Ordinance No. 9092-18 ORDINANCE NO. 9092-18 AN ORDINANCE OF THE CITY OF CLEARWATER, FLORIDA, AMENDING THE FUTURE LAND USE ELEMENT OF THE COMPREHENSIVE PLAN OF THE CITY, TO CHANGE THE LAND USE DESIGNATION FOR A 7.548- ACRE PORTION OF CERTAIN REAL PROPERTY LOCATED ON THE EAST SIDE OF OLD COACHMAN ROAD APPROXIMATELY 2,370 FEET NORTH OF DREW STREET, WHOSE POST OFFICE ADDRESS IS 1005 OLD COACHMAN ROAD, CLEARWATER, FLORIDA 33765, FROM RECREATION/OPEN SPACE (R/OS) TO TRANSPORTATION/UTILITY (T/U); PROVIDING AN EFFECTIVE DATE. WHEREAS, the amendment to the Future Land Use Element of the Comprehensive Plan of the City as set forth in this ordinance is found to be reasonable, proper and appropriate, and is consistent with the City's Comprehensive Plan; now, therefore, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF CLEARWATER, FLORIDA: Section 1. The Future Land Use Element of the Comprehensive Plan of the City of Clearwater is amended by designating the land use categories for the hereinafter described property, as follows: Property Land Use Category See attached Exhibit A for Legal Description From: Recreation/ Open Space (R/OS) To: Transportation/ Utility (T/U) (LUP2017-09007) The map attached as Exhibit B is hereby incorporated by reference. Section 2. The City Council does hereby certify that this ordinance is consistent with the City’s Comprehensive Plan. Section 3. This ordinance shall take effect contingent upon approval of the land use designation by the Pinellas County Board of Commissioners, where applicable, and thirty-one (31) days post-adoption. If this ordinance is appealed within thirty (30) days after adoption, then this ordinance will take effect only after approval of the land use designation by the Pinellas County Board of Commissioners and upon issuance of a final order determining this amendment to be in compliance either by the Department of Economic Opportunity (DEO) or the Administration Commission, where applicable, pursuant to section 163.3187, Florida Statutes. The Community Development Coordinator is authorized to transmit to Forward Pinellas, in its role as the Pinellas Planning Council, an application to amend the Countywide Plan in order to achieve consistency with the Ordinance No. 9092-18 Future Land Use Plan Element of the City’s Comprehensive Plan as amended by this ordinance. PASSED ON FIRST READING PASSED ON SECOND AND FINAL READING AND ADOPTED George N. Cretekos Mayor Approved as to form: Camilo A. Soto Assistant City Attorney Attest: Rosemarie Call City Clerk Exhibit A Legal Description: Northern Portion Legal Description: Southern Portion Exhibit B LAKE LAKE 57.8 110 120 120 RAILROAD 100289.94 13/03 4.84 2.5 14/03 14/04 9.2 16.79 14/011 9.3 100 130 130 120 66 66 73 66 66 66 66 73 100 106.28 104.95 41/01 41/02 42/1542/1442/1342/1242/11 42/10 42/09 42/01 38.7112.69 12.27 4.8 1.84 LAKE110 120 120 100ALLIGATORCREEK120 130 130 100 50 50100 133.32 132(S) 5 050501 2 32/0233/022 32/021 33/024 AC(C) AC AC AC(C) AC(C) AC(C) AC(C) AC(C)AC(C) AC(C) 1 1US-19 NN OLD COACHMAN RDSHARKEY RD R/OS P I RM IL T/U T/UP RM T/U P WATER T/U R/OS P WATER R/OSR/OS US 19-RC R/OS WATER US 19-RC US 19-RC US 19-NC US 19-RC P R/OS P US 19-RC WATER US 19-NC 657 655 653 601 223 222 219 220 226 221 225 224 950 730 651 650 940 247624841001 650½245424922470221812217722173 22093220832208721 91 3 21 90 7 2 21 1522111221072210322067 22211 21 90 3 22600 22209 1003 10051101 2217922175 22171 22169 22167 2209122085220812208922021 9 21 915 21 90 9 21 90 5 22 1122117221132210922105 21799 22 10 12209521901 22165 -Not to Scale--Not a Survey-Rev. 10/25/2017 T/U FUTURE LAND USE MAP Owner(s): City of Clearwater Case: LUP2017-09007 REZ2017-09007 Site: 1005 Old Coachman Road Property Size(Acres): 7.548 Land Use Zoning PIN: 07-29-16-00000-140-0400 07-29-16-00000-410-0100 From: Recreation/Open Space (R/OS) Open Space/Recreation (OS/R) To: Transportation/ Utility (T/U) Institutional (I) Atlas Page: 272B PLANNING & DEVELOPMENT DEPARTMENT COMMUNITY DEVELOPMENT BOARD STAFF REPORT MEETING DATE: November 21, 2017 AGENDA ITEM: G.1. CASE: LUP2017-09007 REQUEST: To amend the Future Land Use Map designation from Recreation/Open Space (R/OS) to Transportation/Utility (T/U) GENERAL DATA: Applicant ......................... City of Clearwater Owner ............................. City of Clearwater Location .......................... 1005 Old Coachman Road, located on the east side of Old Coachman Road approximately 2,370 feet north of Drew Street Property Size ................... 7.548-acre portion of a 9.209-acre property Background: This case involves 7.548 acres of a 9.209-acre property comprised of one parcel and a portion of a second parcel. This city-owned property is located on the east side of Old Coachman Road approximately 2,370 feet north of Drew Street, just north of the Carpenter Complex (baseball fields). The City’s existing Solid Waste Transfer Station (Transfer Station) occupies the center of the northern parcel and is accessed by a drive that crosses the northwest corner of the southern parcel. The amendment area is comprised of the remainder of the northern parcel and the driveway portion of the southern parcel. Maps 1 and 2 show the general location of the property and an aerial view of the amendment area, which excludes the portion of the property on which the current Transfer Station is located. The existing Transfer Station was constructed in the late 1960s and uses hydraulic push-pit technology which was state of the art at the time. The facility was designed to handle a volume of 400 tons of solid waste per week, but is now averaging 330 tons per day. Due to the age and condition of the facility, and the desire to provide more efficient operations, the City is replacing the facility. The City’s Engineering and Solid Waste Departments have coordinated with King Engineering to develop a design that meets the current and projected future waste collection requirements of the City while minimizing impacts to the site’s surrounding physical environment. The project includes the complete replacement of the Transfer Station including a new scale house, administration building and top loading transfer station building, which requires more land area to accommodate the upgraded facility. The existing Transfer Station is currently designated as Transportation/Utility (T/U) on the City’s Future Land Use Map, and although the remainder of the parcel is designated as Recreation/Open Space (R/OS), it is fenced and not readily accessible to the general public. Community Development Board –November 21, 2017 Revised for City Council Meeting January 18, 2018 LUP2017-09007 - Page 2 of 10 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION The request is to change the Future Land Use Map designation for the remainder of the northern parcel (7.096 acres) and the portion of the southern parcel that will be used for access to the Transfer Station and the scale house (0.452 acres) from Recreation/Open Space (R/OS) to Transportation/Utility (T/U). A request to rezone the proposed subject site from the Open Space/Recreation (O/SR) District to the Institutional (I) District is being processed concurrently with this case (see REZ2017-09007). Additionally, the City has submitted a Flexible Development application for the proposed Transfer Station (concurrent case FLD2017-09017). Map 1 Map 2 Vicinity Characteristics: Map 3 shows the existing surrounding uses. The property is somewhat isolated from other uses, abutting the CSX railroad on its northern boundary, US Highway 19 on the majority of its eastern boundary, and Duke Energy’s power line corridor on its western boundary. The perimeter of the property is largely forested creating a substantial buffer. Along the southern property line is Alligator Creek, which the Ream Wilson Trail traverses east/west. The City-owned parcel to the south houses Carpenter Complex, and in the greater vicinity there are larger preservation areas owned by the City (north of the CSX railroad) and Pinellas County (west of the site, across Old Coachman Road). Community Development Board –November 21, 2017 Revised for City Council Meeting January 18, 2018 LUP2017-09007 - Page 3 of 10 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Map 3 As shown on Map 4, in addition to the area already designated Transportation/Utility (T/U) where the existing Transfer Station is located, the abutting future land use designations are Transportation/Utility (T/U) to the west and Recreation/Open Space (R/OS) to the south. To the north, across the CSX railroad, is Preservation (P) and US 19 Neighborhood Center (US 19-NC). The surrounding vicinity has additional areas designated Preservation (P), as well as Residential Medium (RM) and Industrial Limited (IL) (Pinellas County). A comparison between the uses, densities and intensities allowed by the present and proposed Future Land Use Map designations appears in Table 1, along with the consistent zoning districts. Map 4 Map 5 Community Development Board –November 21, 2017 Revised for City Council Meeting January 18, 2018 LUP2017-09007 - Page 4 of 10 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Table 1. Uses, Densities and Intensities Allowed by Present and Proposed Future Land Use Designations Present FLUM Designation Recreation/Open Space (R/OS)Requested FLUM Designation Transportation/Utility (T/U) Primary Uses: Public/Private Open Space; Recreation Facilities; Beach/Water Access Airports; Marina; Utility Facilities Maximum Density: N/A 7.5 Dwelling Units Per Acre Maximum Intensity: FAR 0.25; ISR 0.60 FAR 0.70; ISR 0.90 Consistent Zoning Districts: Open Space/Recreation (OS/R) Institutional (I) REVIEW CRITERIA: Consistency with the Clearwater Comprehensive Plan [Sections 4-603.F.1 and 4-603.F.2] Recommended Findings of Fact: Applicable goals, objectives and policies of the Clearwater Comprehensive Plan which support the proposed amendment include: Goal A.2 A sufficient variety and amount of future land use categories shall be provided to accommodate public demand and promote infill development. Objective A.4.1 The City’s Concurrency Management System will ensure that compatibility of all proposed development with the capacities of the existing and planned support facilities for which a level of service has been adopted. Policy A.4.1.2 The City’s Concurrency Management System shall include, at minimum, level of service standards for parkland, potable water, sanitary sewer, solid waste, and stormwater. Objective A.6.4 Due to the built-out character of the City of Clearwater, compact urban development within the urban service area shall be promoted through application of the Clearwater Community Development Code. Goal D.2 To provide the most reliable, cost effective and energy efficient method of collecting, recycling, and disposing solid wastes throughout the City of Clearwater in an environmentally sound manner which will protect the public health and safety. Objective D.2.1 Continue to maintain adequate levels of service for existing and future populations through the year 2020. Policy D.2.1.1 The following levels of service standards have been established for the City of Clearwater and shall be used in determining the availability of facility capacity and the demand created by new development: Service Level of Service Standards Solid Waste Facility Average Solid Waste Generator Rate 7.12 pounds per capita per day Community Development Board –November 21, 2017 Revised for City Council Meeting January 18, 2018 LUP2017-09007 - Page 5 of 10 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Objective D.2.2 On an ongoing basis, continue to develop collection and transport strategies which minimize costs and use optimally located waste transfer facilities. Policy D.2.2.3 Provide collection service to every residential and commercial location within the Clearwater City limits. The Transfer Station is already located on the northern parcel, but the future land use amendment is required to allow the facility to be expanded at the time it is replaced. Continuing to use this site for the same use is consistent with the City’s Comprehensive Plan. The proposed Transportation/Utility (T/U) future land use designation is compatible with the surrounding utility and recreation uses in the area. The City’s concurrency management system establishes level of service standards for solid waste facilities, and the replacement of this facility is necessary to continue providing reliable, cost effective collection and disposal of solid waste, as set forth in Goal D.2. The new Transfer Station is designed to handle a projected ±780 tons of solid waste per day. This will allow the City to meet its level of service standards for anticipated population growth through 2035 (beyond the year 2020 set forth in Objective D.2.1) and will minimize costs by expanding the capacity of the facility. In addition, the proposal does not degrade the level of service for any other public facilities below the adopted standards (a detailed public facilities analysis follows in this report). Recommended Conclusions of Law: The request does not conflict with the goals, objectives and policies of the Clearwater Comprehensive Plan and furthers said plan as indicated in the goals, objectives and policies listed above. Consistency with the Countywide Rules Recommended Findings of Fact: The underlying Countywide Plan Map category on the proposed amendment area is Recreation/Open Space (R/OS), while the existing Transfer Station property is designated Public/Semi-Public (P/SP). Property to the south is designated Recreation/Open Space (R/OS), with Public/Semi-Public (P/SP) to the west, and the CSX railroad (undesignated) to the north. The proposed City of Clearwater future land use designation of Transportation/Utility (T/U) will necessitate an amendment from the Recreation/Open Space (R/OS) category to the Public/Semi-Public (P/SP) category in order to maintain consistency between the City’s Future Land Use Map and the Countywide Plan Map. Section 2.3.3.10 of the Countywide Rules states that the Public/Semi-Public (P/SP) category is intended to recognize institutional and transportation/utility uses that serve the community or region, especially larger facilities having acreage exceeding the thresholds established in other plan categories, and which are consistent with the need, character, and scale of such uses relative to the surrounding uses, transportation facilities, and natural resource features. The City’s Solid Waste Transfer Station is an appropriate use which should continue to operate in an expanded capacity on City-owned property. Recommended Conclusions of Law: The proposed Future Land Use Map amendment is consistent with the purpose of the proposed category in the Countywide Rules. Community Development Board –November 21, 2017 Revised for City Council Meeting January 18, 2018 LUP2017-09007 - Page 6 of 10 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Compatibility with Surrounding Properties/Character of the City & Neighborhood [Section 4-603.F.3 and Section 4-603.F.6] Recommended Findings of Fact: Existing surrounding uses consist primarily of recreational facilities (south) and utilities (west), in addition to preservation areas (north and west, not adjacent) and industrial (west, not adjacent). The continued use of the subject property as a Transfer Station, even with expanded capacity to handle ±780 tons of solid waste per day, is compatible with the surrounding properties and neighborhood. No new impacts to adjacent properties are proposed, and the hours of operation are proposed to remain the same (see below). Hours of Operation: Monday, Tuesday, Thursday, and Friday 6:30 a.m. to 5:00 p.m. Wednesday 6:30 a.m. to 3:00 p.m. Saturday and Sunday Closed The proposed Transportation/Utility (T/U) future land use category primarily permits nonresidential development at an intensity of 0.70 FAR. The future land use designations of surrounding properties include Transportation/Utility (T/U), Recreation/Open Space (R/OS) and Preservation (P). The proposed Transportation/Utility (T/U) future land use category is consistent with the surrounding future land use designations that exist in the vicinity of the subject property. The proposed amendment will allow the replacement of an existing city facility so no real change will occur, and the use will remain consistent and in character with the surrounding properties and neighborhood. Recommended Conclusions of Law: The proposed Transportation/Utility (T/U) future land use category is in character with the Future Land Use Map designations in the area. Further, the proposal is compatible with surrounding uses and consistent with the character of the surrounding properties and neighborhood. Sufficiency of Public Facilities [Section 4-603.F.4] Recommended Findings of Fact: Typically, to assess the sufficiency of public facilities needed to support potential development on the property the maximum development potential of the property under the present and requested City Future Land Use Map designations is analyzed. However, the 7.548-acre proposed amendment area is larger than the land area needed to accommodate the new Transfer Station, so the maximum development potential for the area is significantly larger than the actual size of the proposed Transfer Station (230,153 SF/0.70 FAR allowed, compared to 25,117 SF/0.06 FAR proposed through FLD2017-09017). The remainder of the City- owned property will remain vacant. The proposed Transfer Station will accommodate the City’s projected population needs through 2035. As shown in Table 2, the proposed Transfer Station is almost five times the size of the current Transfer Station; however, because of the function each building will serve, the impacts to public facilities are not “typical”. The majority of the total building area is not truly occupied space because the top loading transfer station building, in which the solid waste trucks will enter/exit, is the primary building on site (approximately 22,870 SF). The administrative building (approximately 1,583 SF) and scale house (approximately 664 SF) are small components of the overall facility (2,247 SF combined). Community Development Board –November 21, 2017 Revised for City Council Meeting January 18, 2018 LUP2017-09007 - Page 7 of 10 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION The proposed top loading transfer station building is designed to use reclaimed water to wash down the tipping floor as a method for the litter control, as required by the Florida Administrative Code, thereby limiting the potential use of potable water in the operation of the facility, whereas the current facility uses potable water for this purpose. Additionally, the building is designed so that any wastewater produced by washing down the tipping floor will drain into a collection tank which is later vacuum-emptied by the City’s third-party contractor when scheduled, thereby limiting the amount of wastewater produced. The new administrative building and scale house are both supplied with potable water and tied into the City’s sanitary sewer system. The following analysis compares the impacts to public facilities, taking these design solutions into account, where applicable. Table 2. Development Potential for Existing FLUM Designation & Proposed Development Current Transfer Station Proposed Transfer Station (FLD2017-09017) Net Change Building Area 5,208 SF 25,117 SF 19,909 SF Floor Area Ratio (FAR) 0.01 FAR 0.06 FAR 0.05 FAR Abbreviation: SF – Square feet Potable Water The proposed amendment will result in a decrease in potable water use of approximately 278 gallons per day. This is determined by calculating the potential potable water utilization of the administrative building and scale house for the new Transfer Station, excluding the top loading transfer station because it will use reclaimed water (225 gallons per day), and comparing it to the utilization of a the current Transfer Station (both the scale house and top loading transfer station building, since both currently use potable water) (503 gallons per day). Wastewater The proposed amendment will result in a decrease in wastewater production of approximately 222 gallons per day. This is determined by calculating the potential wastewater generation of the administrative building and scale house for the new Transfer Station, excluding the top loading transfer station because the new design limits the production of wastewater (180 gallons), and comparing it to the potential wastewater generation of the current Transfer Station (both the scale house and top loading transfer station building) (402 gallons). Solid Waste The proposed amendment could result in an increase of 4.37 tons per year of solid waste generated when comparing the amount of waste generated by an office use the size of the current scale house (628 SF, existing top loading transfer station building excluded) to that of an office use the size of the proposed administrative building and scale house (2,247 SF combined). However, the limited ancillary buildings of the proposed Transfer Station are not anticipated to generate significant solid waste, and any solid waste generated will be collected by City staff and taken to the tipping floor to be included with solid waste collected citywide, which is what is done currently at the site. Community Development Board –November 21, 2017 Revised for City Council Meeting January 18, 2018 LUP2017-09007 - Page 8 of 10 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION The Solid Waste Transfer Station is a facility that accepts garbage from route collection vehicles and compacts it into tractor/trailer rigs for long haul to the Pinellas County Waste-to-Energy Plant. All solid waste disposal is handled by Pinellas County at the Pinellas County Waste-to-Energy Plant and the Bridgeway Acres Sanitary Landfill which has significant capacity. Additionally, the City provides a full- service citywide recycling program which diverts waste from the landfill, helping to extend the lifespan of Bridgeway Acres. There is already excess solid waste capacity to serve the amendment area. Parkland Although the proposed amendment will result in a reduction in City-property designated as Recreation/Open Space (R/OS) on the City’s Future Land Use Map, this property was not intended for use as a park facility. Removal of this land would not impact the City’s adopted LOS for parkland acreage, which is 4 acres per 1,000 population. Under both the existing and proposed land use, the LOS citywide will remain at 15.46 acres per 1,000 population. Stormwater Site plan approval will be required before the property can be redeveloped. At that time, the stormwater management system for the site will be required to meet all City and SWFWMD stormwater management criteria. Streets The subject property is located on the east side of Old Coachman Road, approximately 2,370 feet north of Drew Street. To evaluate potential impacts to streets, the typical traffic impacts figure (trips per day per acre) in the Countywide Rules for the corresponding Countywide Plan Map categories (current and proposed) are compared. The current number of trips per day (23 trips) is calculated based on the traffic generation numbers for the Recreation/Open Space (R/OS) category (3 trips per day per acre). The site is already developed with a Transfer Station, which based on the traffic generation numbers for the corresponding Countywide Plan Map category of Public/Semi-Public (P/SP) (16 trips per day per acre), would generate 121 trips. This is an increase of 98 trips per day compared to the number of trips under the current designations. Currently, the Transfer Station’s average daily in-bound loads (route collection vehicles) are 86 (or 172 round trips) and average daily out-bound loads (tractor/trailer rigs) to the County Waste-to-Energy Plant are 18 (or 36 round trips). Recommended Conclusions of Law: Based upon the findings of fact, it is determined that the proposed change will not result in the degradation of the existing levels of service for potable water, sanitary sewer, solid waste, parkland, stormwater management and streets. Impact on Natural Resources [Section 4-603.F.5] Recommended Findings of Fact: A number of wetland impacts are proposed in association with the replacement of the City’s Solid Waste Transfer Station with a larger facility. The City obtained permits from the Florida Department of Environmental Protection and the U.S. Army Corps of Engineers, allowing both permanent and temporary Community Development Board –November 21, 2017 Revised for City Council Meeting January 18, 2018 LUP2017-09007 - Page 9 of 10 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION wetland impacts, while requiring onsite and offsite wetland impact compensation/restoration. After construction is complete and mitigation projects are finalized, the City will process applications to designate those wetlands Preservation (P). Regardless of the wetlands’ map designation, vegetative buffers are required. The Community Development Code requires that a vegetative buffer shall be provided on all lands within 25 feet of any property designated on the Zoning Atlas as Preservation (P), or any property determined to be wetlands under the jurisdiction of the State of Florida ("jurisdictional wetlands"); and all lands within 15 feet of the top of the bank of any creeks, channels, or related waterways which contain jurisdictional wetlands. The City’s codes require that development is compliant with the City’s tree preservation, landscaping and stormwater management requirements. Recommended Conclusions of Law: Based upon the findings of fact, it is determined that although the proposal allows for the replacement of the existing Transfer Station with a larger facility, thereby resulting in limited impacts to wetland habitat surrounding the Transfer Station, the proposed mitigation has been approved by the Florida Department of Environmental Protection and the U.S. Army Corps of Engineers. SUMMARY AND RECOMMENDATION: No amendment to the Comprehensive Plan or Future Land Use Map shall be recommended for approval or receive a final action of approval unless it complies with the standards contained in Section 4-603.F, Community Development Code. Table 3 below depicts the consistency of the proposed amendment with the standards pursuant to Section 4-603.F: Table 3. Consistency with Community Development Code Standards for Review CDC Section 4-603 Standard Consistent Inconsistent F.1 The amendment will further implementation of the Comprehensive Plan consistent with the goals, policies and objectives contained in the Plan. X F.2 The amendment is not inconsistent with other provisions of the Comprehensive Plan.X F.3 The available uses, if applicable, to which the properties may be put are appropriate to the properties in question and compatible with existing and planned uses in the area. X F.4 Sufficient public facilities are available to serve the properties. X F.5 The amendment will not adversely affect the natural environment. X F.6 The amendment will not adversely impact the use of properties in the immediate area.X Community Development Board –November 21, 2017 Revised for City Council Meeting January 18, 2018 LUP2017-09007 - Page 10 of 10 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Based on the foregoing, the Planning and Development Department recommends the following action: Recommend APPROVAL of the Future Land Use Map Amendment designation from Recreation/Open Space (R/OS) to Transportation/Utility (T/U). Prepared by Planning and Development Department Staff: Lauren Matzke, AICP Long Range Planning Manager ATTACHMENTS: Ordinance No. 9092-18 Resume Photographs of Site and Vicinity LUP2017-09007 / REZ2017-09007 City of Clearwater Solid Waste Transfer Station 1005 Old Coachman Road View looking north at the subject property (Scale House) 1005 Old Coachman Road Southeasterly of the subject property Duke Energy power lines, located west of the subject property Road View looking easterly along the driveway to the subject property 1005 Old Coachman Road View looking northerly along Old Coachman Road View looking southerly along Old Coachman Road Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: 9093-18 2nd rdg Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: OrdinanceIn Control: Legal Department Agenda Number: 10.2 SUBJECT/RECOMMENDATION: Adopt Ordinance 9093-18 on second reading, amending the Zoning Atlas of the city by rezoning certain real property whose post office address is 1005 Old Coachman Road, Clearwater, Florida 33765, from Open Space/Recreation (OS/R) to Institutional (I). SUMMARY: APPROPRIATION CODE AND AMOUNT: USE OF RESERVE FUNDS: Page 1 City of Clearwater Printed on 1/25/2018 Ordinance No. 9093-18 ORDINANCE NO. 9093-18 AN ORDINANCE OF THE CITY OF CLEARWATER, FLORIDA, AMENDING THE ZONING ATLAS OF THE CITY BY REZONING A 7.548-ACRE PORTION OF CERTAIN REAL PROPERTY LOCATED ON THE EAST SIDE OF OLD COACHMAN ROAD APPROXIMATELY 2,370 FEET NORTH OF DREW STREET, WHOSE POST OFFICE ADDRESS IS 1005 OLD COACHMAN ROAD, CLEARWATER, FLORIDA 33765, FROM OPEN SPACE/RECREATION (OS/R) TO INSTITUTIONAL (I); PROVIDING AN EFFECTIVE DATE. WHEREAS, the amendment to the Zoning Atlas of the City as set forth in this ordinance is found to be reasonable, proper and appropriate, and is consistent with the City's Comprehensive Plan; now, therefore, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF CLEARWATER, FLORIDA: Section 1. The following described property in Clearwater, Florida, is hereby rezoned, and the Zoning Atlas of the City is amended as follows: Property Zoning District See attached Exhibit A for Legal Description From: Open Space/Recreation (OS/R) (REZ2017-09007) To: Institutional (I) The map attached as Exhibit B is hereby incorporated by reference. Section 2. The City Engineer is directed to revise the Zoning Atlas of the City in accordance with the foregoing amendment. Section 3. This ordinance shall take effect immediately upon adoption, subject to the approval of the land use designation set forth in Ordinance 9092-18 by the Pinellas County Board of County Commissioners. Ordinance No. 9093-18 PASSED ON FIRST READING PASSED ON SECOND AND FINAL READING AND ADOPTED George N. Cretekos Mayor Approved as to form: Camilo A. Soto Assistant City Attorney Attest: Rosemarie Call City Clerk Exhibit A Legal Description: Northern Portion Legal Description: Southern Portion Exhibit B LAKE LAKE 57.8 110 120 120 RAILROAD 100289.94 13/03 4.84 2.5 14/03 14/04 9.2 16.79 14/011 9.3 100 130 130 120 66 66 73 66 66 66 66 73 100 106.28 104.95 41/01 41/02 42/1542/1442/1342/1242/11 42/10 42/09 42/01 38.7112.69 12.27 4.8 1.84 LAKE110 120 120 100ALLIGATORCREEK120 130 130 100 50 50100 133.32 132(S) 5 050501 2 32/0233/022 32/021 33/024 AC(C) AC AC AC(C) AC(C) AC(C) AC(C) AC(C)AC(C) AC(C) 1 1US-19 NN OLD COACHMAN RDSHARKEY RD I OS/R P P IRT I US 19 MDR MDR P OS/R MDR US 19 US 19 P 657 653 601 223 222 219 220 226 221 225 224 950 730 651 650 940 24841001 650½24541003 249211012217722173 22167 22093220832208721 91 3 21 90 7 2 21 1522111221072210322067 22211 21799 21 90 3 22600 22165 OS/R 655 24761005 2470221812217922175 22171 22169 2209122085220812208922021 9 21 915 21 90 9 21 90 5 22 112211722113221092210522101 2209522209 21901 -Not to Scale--Not a Survey-Rev. 10/25/2017 I ZONING MAP Owner(s): City of Clearwater Case: LUP2017-09007 REZ2017-09007 Site: 1005 Old Coachman Road Property Size(Acres): 7.548 Land Use Zoning PIN: 07-29-16-00000-140-0400 07-29-16-00000-410-0100 From: Recreation/Open Space (R/OS) Open Space/Recreation (OS/R) To: Transportation/ Utility (T/U) Institutional (I) Atlas Page: 272B PLANNING & DEVELOPMENT DEPARTMENT COMMUNITY DEVELOPMENT BOARD STAFF REPORT MEETING DATE: November 21, 2017 AGENDA ITEM: G.2. CASE: REZ2017-09007 REQUEST: To amend the Zoning Atlas designation from Open Space/Recreation (OS/R) District to Institutional (I) District GENERAL DATA: Applicant ......................... City of Clearwater Owner ............................. City of Clearwater Location .......................... 1005 Old Coachman Road, located on the east side of Old Coachman Road approximately 2,370 feet north of Drew Street Property Size ................... 7.548-acre portion of a 9.661-acre property Background: This case involves 7.548 acres of a 9.661-acre property comprised of one parcel and a portion of a second parcel. This city-owned property is located on the east side of Old Coachman Road approximately 2,370 feet north of Drew Street, just north of the Carpenter Complex (baseball fields). The City’s existing Solid Waste Transfer Station (Transfer Station) occupies the center of the northern parcel and is accessed by a drive that crosses the northwest corner of the southern parcel. The amendment area is comprised of the remainder of the northern parcel and the driveway portion of the southern parcel. Maps 1 and 2 show the general location of the property and an aerial view of the amendment area, which excludes the portion of the property on which the current Transfer Station is located. The existing Transfer Station was constructed in the late 1960s and uses hydraulic push-pit technology which was state of the art at the time. The facility was designed to handle a volume of 400 tons of solid waste per week, but is now averaging 330 tons per day. Due to the age and condition of the facility, and the desire to provide more efficient operations, the City is replacing the facility. The City’s Engineering and Solid Waste Departments have coordinated with King Engineering to develop a design that meets the current and projected future waste collection requirements of the City while minimizing impacts to the site’s surrounding physical environment. The project includes the complete replacement of the Transfer Station including a new scale house, administration building and top loading transfer station building, which requires more land area to accommodate the upgraded facility. The existing Transfer Station is currently designated as Institutional (I) on the City’s Zoning Atlas, and although the remainder of the parcel is zoned Open Space/Recreation (OS/R), it is fenced and not readily accessible to the general public. Community Development Board – November 21, 2017 REZ2017-09007- Page 2 of 9 Level III Zoning Atlas Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION The request is to change the Zoning Atlas designation for the remainder of the northern parcel (7.096 acres) and the portion of the southern parcel that will be used for access to the Transfer Station and the scale house (0.452 acres) from Open Space/Recreation (OS/R) District to Institutional (I) District. A request to amend the proposed subject site from the Recreation/Open Space (R/OS) Future Land Use Map designation to Transportation/Utility (T/U) Future Land Use Map designation is being processed concurrently with this case (see LUP2017-09007). Additionally, the City has submitted a Flexible Development application for the proposed Transfer Station (concurrent case FLD2017-09017). Map 1 Map 2 Vicinity Characteristics: Map 3 shows the existing surrounding uses. The property is somewhat isolated from other uses, abutting the CSX railroad on its northern boundary, US Highway 19 on the majority of its eastern boundary, and Duke Energy’s power line corridor on its western boundary. The perimeter of the property is largely forested creating a substantial buffer. Along the southern property line is Alligator Creek, which the Ream Wilson Trail traverses east/west. The City-owned parcel to the south houses Carpenter Complex, and in the greater vicinity there are larger preservation areas owned by the City (north of the CSX railroad) and Pinellas County (west of the site, across Old Coachman Road). Community Development Board – November 21, 2017 REZ2017-09007- Page 3 of 9 Level III Zoning Atlas Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Map 3 As shown on Map 5, in addition to the area already designated Institutional (I) District where the existing Transfer Station is located, the abutting zoning districts are Institutional (I) to the west and Open Space/Recreation (OS/R) to the south. To the north, across the CSX railroad, are Preservation (P) and US 19 Districts. The surrounding vicinity has additional areas designated Preservation (P), as well as Medium Density Residential (MDR) and M-2 Heavy Manufacturing & Industry District (Pinellas County). Map 4 Map 5 Community Development Board – November 21, 2017 REZ2017-09007- Page 4 of 9 Level III Zoning Atlas Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION REVIEW CRITERIA: Consistency with the Clearwater Comprehensive Plan and Community Development Code and Regulations [Sections 4-602.F.1] Recommended Findings of Fact: Applicable goals, objectives and policies of the Clearwater Comprehensive Plan which support the proposed amendment include: Goal A.2 A sufficient variety and amount of future land use categories shall be provided to accommodate public demand and promote infill development. Objective A.4.1 The City’s Concurrency Management System will ensure that compatibility of all proposed development with the capacities of the existing and planned support facilities for which a level of service has been adopted. Policy A.4.1.2 The City’s Concurrency Management System shall include, at minimum, level of service standards for parkland, potable water, sanitary sewer, solid waste, and stormwater. Objective A.6.4 Due to the built-out character of the City of Clearwater, compact urban development within the urban service area shall be promoted through application of the Clearwater Community Development Code. Goal D.2 To provide the most reliable, cost effective and energy efficient method of collecting, recycling, and disposing solid wastes throughout the City of Clearwater in an environmentally sound manner which will protect the public health and safety. Objective D.2.1 Continue to maintain adequate levels of service for existing and future populations through the year 2020. Policy D.2.1.1 The following levels of service standards have been established for the City of Clearwater and shall be used in determining the availability of facility capacity and the demand created by new development: Service Level of Service Standards Solid Waste Facility Average Solid Waste Generator Rate 7.12 pounds per capita per day Objective D.2.2 On an ongoing basis, continue to develop collection and transport strategies which minimize costs and use optimally located waste transfer facilities. Policy D.2.2.3 Provide collection service to every residential and commercial location within the Clearwater City limits. Applicable section of the Community Development Code which supports the proposed amendment: Division 12. Institutional District, Section 2-1201. Intent and Purpose. The intent and purpose of the Institutional "I" District is to establish areas where public and private organizations can establish and operate institutions with a public interest in support of the quality of life of the citizens of the City of Clearwater Community Development Board – November 21, 2017 REZ2017-09007- Page 5 of 9 Level III Zoning Atlas Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION without adversely impacting the integrity of adjacent residential neighborhoods, diminishing the scenic quality of the City of Clearwater or negatively impacting the safe and efficient movement of people and things within the City of Clearwater. The Transfer Station is already located on the northern parcel, but the Zoning Atlas amendment is required to allow the facility to be expanded at the time it is replaced. Continuing to use this site for the same use is consistent with the City’s Comprehensive Plan. The proposed Institutional (I) District is compatible with the surrounding utility and recreation uses in the area. The City’s concurrency management system establishes level of service standards for solid waste facilities, and the replacement of this facility is necessary to continue providing reliable, cost effective collection and disposal of solid waste, as set forth in Goal D.2. The new Transfer Station is designed to handle a projected ±780 tons of solid waste per day. This will allow the City to meet its level of service standards for anticipated population growth through 2035 (beyond the year 2020 set forth in Objective D.2.1.) and will minimize costs by expanding the capacity of the facility. In addition, the proposal does not degrade the level of service for any other public facilities below the adopted standards (a detailed public facilities analysis follows in this report). Recommended Conclusions of Law: The request does not conflict with the goals, objectives and policies of the Clearwater Comprehensive Plan and furthers said plan and the Community Development Code as indicated above. Compatibility with Surrounding Property/Character of the City & Neighborhood [Section 4-602.F.2, 4-602.F.3 and Section 4-602.F.4] Recommended Findings of Fact: Existing surrounding uses consist primarily of recreational facilities (south) and utilities (west), in addition to preservation areas (north and west, not adjacent) and industrial (west, not adjacent). The continued use of the subject property as a Transfer Station, even with expanded capacity to handle ±780 tons of solid waste per day, is compatible with the surrounding properties and neighborhood. No new impacts to adjacent properties are proposed, and the hours of operation are proposed to remain the same (see below). Hours of Operation: Monday, Tuesday, Thursday, and Friday 6:30 a.m. to 5:00 p.m. Wednesday 6:30 a.m. to 3:00 p.m. Saturday and Sunday Closed The proposed Institutional (I) zoning district is consistent with the surrounding zoning districts that exist in the vicinity of the subject property. The proposed amendment will allow the replacement of an existing city facility so no real change will occur, and the use will remain consistent and in character with the surrounding properties and neighborhood. Recommended Conclusions of Law: The proposed Institutional (I) zoning district is in character with the zoning districts in the area. Further, the proposal is compatible with surrounding uses and consistent with the character of the surrounding properties and neighborhood. Community Development Board – November 21, 2017 REZ2017-09007- Page 6 of 9 Level III Zoning Atlas Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Sufficiency of Public Facilities [Section 4-602.F.5] Recommended Findings of Fact: Typically, to assess the sufficiency of public facilities needed to support potential development on the property the maximum development potential of the property under the present and requested City Future Land Use Map designations is analyzed. However, the 7.548-acre proposed amendment area is larger than the land area needed to accommodate the new Transfer Station, so the maximum development potential for the area is significantly larger than the actual size of the proposed Transfer Station (230,153 SF/0.70 FAR allowed, compared to 25,117 SF/0.06 FAR proposed through FLD2017-09017). The remainder of the City- owned property will remain vacant. The proposed Transfer Station will accommodate the City’s projected population needs through 2035. As shown in Table 1, the proposed Transfer Station is almost five times the size of the current Transfer Station; however, because of the function each building will serve, the impacts to public facilities are not “typical”. The majority of the total building area is not truly occupied space because the top loading transfer station building, in which the solid waste trucks will enter/exit, is the primary building on site (approximately 22,870 SF). The administrative building (approximately 1,583 SF) and scale house (approximately 664 SF) are small components of the overall facility (2,247 SF combined). The proposed top loading transfer station building is designed to use reclaimed water to wash down the tipping floor as a method for the litter control, as required by the Florida Administrative Code, thereby limiting the potential use of potable water in the operation of the facility, whereas the current facility uses potable water for this purpose. Additionally, the building is designed so that any wastewater produced by washing down the tipping floor will drain into a collection tank which is later vacuum-emptied by the City’s third-party contractor when scheduled, thereby limiting the amount of wastewater produced. The new administrative building and scale house are both supplied with potable water and tied into the City’s sanitary sewer system. The following analysis compares the impacts to public facilities, taking these design solutions into account, where applicable. Table 1. Development Potential for Existing FLUM Designation & Proposed Development Current Transfer Station Proposed Transfer Station (FLD2017-09017) Net Change Building Area 5,208 SF 25,117 SF 19,909 SF Floor Area Ratio (FAR) 0.01 FAR 0.06 FAR 0.05 FAR Abbreviation: SF – Square feet Potable Water The proposed amendment will result in a decrease in potable water use of approximately 278 gallons per day. This is determined by calculating the potential potable water utilization of the administrative building and scale house for the new Transfer Station, excluding the top loading transfer station because it will use reclaimed water (225 gallons per day), and comparing it to the utilization of a the current Transfer Station (both the scale house and top loading transfer station building, since both currently use potable water) (503 gallons per day). Community Development Board – November 21, 2017 REZ2017-09007- Page 7 of 9 Level III Zoning Atlas Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Wastewater The proposed amendment will result in a decrease in wastewater production of approximately 222 gallons per day. This is determined by calculating the potential wastewater generation of the administrative building and scale house for the new Transfer Station, excluding the top loading transfer station because the new design limits the production of wastewater (180 gallons), and comparing it to the potential wastewater generation of the current Transfer Station (both the scale house and top loading transfer station building) (402 gallons). Solid Waste The proposed amendment could result in an increase of 4.37 tons per year of solid waste generated when comparing the amount of waste generated by an office use the size of the current scale house (628 SF, existing top loading transfer station building excluded) to that of an office use the size of the proposed administrative building and scale house (2,247 SF combined). However, the limited ancillary buildings of the proposed Transfer Station are not anticipated to generate significant solid waste, and any solid waste generated will be collected by City staff and taken to the tipping floor to be included with solid waste collected citywide, which is what is done currently at the site. The Solid Waste Transfer Station is a facility that accepts garbage from route collection vehicles and compacts it into tractor/trailer rigs for long haul to the Pinellas County Waste-to-Energy Plant. All solid waste disposal is handled by Pinellas County at the Pinellas County Waste-to-Energy Plant and the Bridgeway Acres Sanitary Landfill which has significant capacity. Additionally, the City provides a full- service citywide recycling program which diverts waste from the landfill, helping to extend the lifespan of Bridgeway Acres. There is already excess solid waste capacity to serve the amendment area. Parkland Although the proposed amendment will result in a reduction in City-property designated as Recreation/Open Space (R/OS) on the City’s Future Land Use Map, this property was not intended for use as a park facility. Removal of this land would not impact the City’s adopted LOS for parkland acreage, which is 4 acres per 1,000 population. Under both the existing and proposed land use, the LOS citywide will remain at 15.46 acres per 1,000 population. Stormwater Site plan approval will be required before the property can be redeveloped. At that time, the stormwater management system for the site will be required to meet all City and SWFWMD stormwater management criteria. Streets The subject property is located on the east side of Old Coachman Road, approximately 2,370 feet north of Drew Street. To evaluate potential impacts to streets, the typical traffic impacts figure (trips per day per acre) in the Countywide Rules for the corresponding Countywide Plan Map categories (current and proposed) are compared. The current number of trips per day (23 trips) is calculated based on the traffic generation numbers for the Recreation/Open Space (R/OS) category (3 trips per day per acre). The site is already developed with a Transfer Station, which based on the traffic generation numbers for the corresponding Community Development Board – November 21, 2017 REZ2017-09007- Page 8 of 9 Level III Zoning Atlas Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Countywide Plan Map category of Public/Semi-Public (P/SP) (16 trips per day per acre), would generate 121 trips. This is an increase of 98 trips per day compared to the number of trips under the current designations. Currently, the Transfer Station’s average daily in-bound loads (route collection vehicles) are 86 (or 172 round trips) and average daily out-bound loads (tractor/trailer rigs) to the County Waste-to-Energy Plant are 18 (or 36 round trips). Recommended Conclusions of Law: Based upon the findings of fact, it is determined that the proposed change will not result in the degradation of the existing levels of service for potable water, sanitary sewer, solid waste, parkland, stormwater management and streets. Location of District Boundaries [Section 4-602.F.6] Recommended Findings of Fact: The location of the proposed Institutional (I) District is logical and consistent with the boundaries of the northern parcel, excluding that portion that is already designated Institutional (I) District, and the area on which the access drive and scale house will be located, thereby consolidating this property into the appropriate zoning district. Recommended Conclusions of Law: The District boundaries are appropriately drawn in regard to location and classifications of streets, ownership lines, existing improvements and the natural environment. LUP2017-09007 / REZ2017-09007 City of Clearwater Solid Waste Transfer Station 1005 Old Coachman Road View looking north at the subject property (Scale House) 1005 Old Coachman Road Southeasterly of the subject property Duke Energy power lines, located west of the subject property Road View looking easterly along the driveway to the subject property 1005 Old Coachman Road View looking northerly along Old Coachman Road View looking southerly along Old Coachman Road Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: 9094-18 2nd rdg Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: OrdinanceIn Control: Legal Department Agenda Number: 10.3 SUBJECT/RECOMMENDATION: Adopt Ordinance 9094-18 on second reading, amending the future land use plan element of the Comprehensive Plan of the city to change the land use designation for certain real property whose post office address is 1528 Lakeview Road, Clearwater, Florida 33756, from Residential Low (RL) and Residential High (RH) to Residential/Office General (R/OG). SUMMARY: APPROPRIATION CODE AND AMOUNT: USE OF RESERVE FUNDS: Page 1 City of Clearwater Printed on 1/25/2018 Ordinance No. 9094-18 ORDINANCE NO. 9094-18 AN ORDINANCE OF THE CITY OF CLEARWATER, FLORIDA, AMENDING THE FUTURE LAND USE ELEMENT OF THE COMPREHENSIVE PLAN OF THE CITY, TO CHANGE THE LAND USE DESIGNATION FOR 1.332 ACRES OF REAL PROPERTY LOCATED ON THE NORTH SIDE OF LAKEVIEW ROAD APPROXIMATELY 500 FEET EAST OF SOUTH HIGHLAND AVENUE, WHOSE POST OFFICE ADDRESS IS 1528 LAKEVIEW ROAD, CLEARWATER, FLORIDA 33756, FROM RESIDENTIAL LOW (RL) AND RESIDENTIAL HIGH (RH) TO RESIDENTIAL/OFFICE GENERAL (R/OG); PROVIDING AN EFFECTIVE DATE. WHEREAS, the amendment to the Future Land Use Element of the Comprehensive Plan of the City as set forth in this ordinance is found to be reasonable, proper and appropriate, and is consistent with the City's Comprehensive Plan; now, therefore, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF CLEARWATER, FLORIDA: Section 1. The Future Land Use Element of the Comprehensive Plan of the City of Clearwater is amended by designating the land use categories for the hereinafter described property, as follows: Property Land Use Category See attached Exhibit A for Legal Description From: Residential Low (RL) and Residential High (RH) To: Residential/Office General (R/OG) (LUP2017-09008) The map attached as Exhibit B is hereby incorporated by reference. Section 2. The City Council does hereby certify that this ordinance is consistent with the City’s Comprehensive Plan. Section 3. This ordinance shall take effect contingent upon approval of the land use designation by the Pinellas County Board of Commissioners, where applicable, and thirty-one (31) days post-adoption. If this ordinance is appealed within thirty (30) days after adoption, then this ordinance will take effect only after approval of the land use designation by the Pinellas County Board of Commissioners and upon issuance of a final order determining this amendment to be in compliance either by the Department of Economic Opportunity (DEO) or the Administration Commission, where applicable, pursuant to section 163.3187, Florida Statutes. The Community Development Coordinator is authorized to transmit to Forward Pinellas, in its role as the Pinellas Planning Council, Ordinance No. 9094-18 an application to amend the Countywide Plan in order to achieve consistency with the Future Land Use Plan Element of the City’s Comprehensive Plan as amended by this ordinance. PASSED ON FIRST READING PASSED ON SECOND AND FINAL READING AND ADOPTED George N. Cretekos Mayor Approved as to form: Camilo A. Soto Assistant City Attorney Attest: Rosemarie Call City Clerk Exhibit A PARCEL I Lot Eighteen (18), GATES KNOLL, according to the map or plat thereof as recorded in Plat Book 33, page 56, public records of Pinellas County, Florida. PARCEL II A parcel in the Northeast 114 of the Northwest 114 of Section 23, Township 29 South, Range 15 East, further described as follows: Begin from the Southeast comer of the Northeast 1/4 of the Northwest 1/4 of said Section 23-29-15, also the intersection of centerlines of rights-of-way for Lake Avenue and Lakeview Road; run thence along the centerline of the said Lakeview Road right-of-way North 88° 59'34" West, 670.52 feet; thence North 00° 12' 40" West, 50.00 feet for a Point of Beginning; thence run along the Northerly right-of-way line of the said Lakeview Road, North 88° 59' 34" West, 173.16 feet; thence North 00° 10' 16" West, 258.30 feet; thence North 89° 57' 57" East, 35.62 feet; thence South 76° 30' 26" East, 141.29 feet; thence South 00° 12' 40" East, 228.62 feet to the Point of Beginning. SURVEY of an Ingress/Egress easement in the Northeast 1/4 of the Northwest 1/4 of Section 23, Township 29 South, Range 15 East Further described as follows: Begin from the SE corner of the Northeast 1/4 of the Northwestll4 of the said Section 23-29-15, also the intersection of right-of-way centerlines for Lake Avenue and Lakeview Road, and run thence along the right-of-way centerline of the said Lakeview Road, N 88° 59' 34" West, 670.52 feet; thence N 00° 12' 40" West, 50.00 feet to a point along the Northerly right-of-way line of the said Lakeview Road; thence along the centerline of SK YVIEW A VENUE, Per Gates Knoll S/D, Plat Book 33, Page 56 as recorded in the Public Records of Pinellas County, Florida, North 00° 12' 40" West, 218.62 feet for a Point of Beginning; thence run North 80° 22' 27" West, 110.59 feet; thence along the arc of a curve to the right, R=50.00', D=50° 18' 40.6", A= 43.90 feet, C=42.51 feet, CB=North 55° 13' 06.7" West; thence North 89° 57' 57" East, 6.47 feet; thence South 76° 35' 57.83" East, 141.29 feet; thence South 00° 12' 40" East, 10.00 feet to the Point of Beginning. PARCEL III A portion of Lot 1. FORREST HILL ESTATES UNIT 5, according to the plat recorded in Plat Book 58, page 34, public records of Pinellas County, Florida being more particularly described as follows: Commence at the center of Section 23, Township 29 South, Range IS East and run along the North-South centerline of said Section 23, North 0° 21' 39" West a distance of 1331.53 feet to the 40 Acre Line; thence along said 40 Acre Line, run North 88° 59' 34" West a distance of 670.52 feet; thence run North 0° 12' 40" West a distance of 50.00 feet to the North right-of-way line of Lakeview Road; thence along said right-of-way line, run North 88° 59' 34" West a distance of 173.08 feet to the Point of Beginning; thence run North 0° 10’ 16" West a distance of 67.00 feet; thence run North 88° 59'34" West a distance of 54.84 feet; thence run South 0° 02' 03" East a distance of 44.00 feet; thence run North 88° 59' 34" West a distance of 54.00 feet; thence run South 0° 02' 03" East a distance of 23.00 feet; thence run South 88" 59' 34" East a distance of 109 feet to the Point of Beginning. ALSO KNOWN AS: Lot 1, Block 1, KNIGHT & HARRIS, according to the map or plat thereof as recorded in Plat Book 95, page 38 of the Public Records of Pinellas County, FLorida. Exhibit B HIGHLAND LAKE 60 6010080 73 606060666666666060838366666080 7829016 13707 29034 45063 45065 45067 4507129034 29034 30366 30348 38826 45068 4506946950 1 82 114 155 6 69 68 67 66 65 64 63 62 84 113 54 55 56 57 58 59 60 61 86 88 90 92 94 96 98 112 111 110 109 108 107 106 105 156 157 158 159 160 161 104 103 102101 53 52 51 50 49 48 47 46 37 38 39 40 41 42 43 44 45 36 35 34 33 32 31 29 28 20 21 22 23 24 25 26 27 18 17 16 15 14 13 12 11 10 1 2 3 4 5 6789 22 23 24 25 26 27 28 29 30 31 32 33 34 35 49 48 47 46 45 44 43 42 41 40 39 38 37 36 6362616059585756555453525150 75 74 73 72 71 70 69 68 67 66 65 64 21 20 19 18 17 16 5 4 4 3 1 30 (114) 2 1 21/04 22/02 23/01 1.31 AC(C) AC 3 2 1 1 2 RH RL RL I CG RM RL RL CG RUCG RL RU I R/OGR/OG RU RU WATER LAKEVIEW RD BARRY RD S HIGHLAND AVE VALENCIA ST TANGERINE ST OTTAWA RD OAKVIEW AVE ILLINOIS RD TUSCOLA RD 1248 14991260 1546155715651539151915041519150815121256 1244 1518154815591524154915361532153715401230 15511267 1235 14651235 15701250 15321256 153915561323 15511555150114651457154315451319 15201537158115641565158115121536154615581300 154115741246 154315511540153515591232 145415471549152715521511155515281220 15481225 15521523155615711509155015501269 1228 15381545153615521269 1266 153115541500155515751274 145915101469153815511539152715281280 154415481542151615481261 15711236 15521235 15471546152415011277 154215351270 15501285 15361252 154015401542151515471254 1516146015001466154215311235 15511547150315511262 1235 1256 1265 1224 15081537154014851226 15501238 1258A 1240A 1234A 1268A 1238A 15231251 1231 1511152415751255 1224 153015051227 15411240 155515151235 13201580122815481240 1305 1236 15551268 1536 1235 152815391244 1239 1243 14811232 1248 1247 1235 1242A 1260A 1254A -Not to Scale--Not a Survey-Rev. 9/18/2017 FUTURE LAND USE MAP Owner(s): Spare Investors Realty, LLC Case: LUP2017-09008 REZ2017-09008 Site: 1528 Lakeview Road Property Size(Acres): 1.332 Land Use Zoning PIN: 23-29-15-00000-210-0400 From: RL, RH LMDR, HDR To: R/OG O Atlas Page: 307A PLANNING & DEVELOPMENT DEPARTMENT COMMUNITY DEVELOPMENT BOARD STAFF REPORT MEETING DATE: November 21, 2017 AGENDA ITEM: G.3. CASE: LUP2017-09008 REQUEST: To amend the Future Land Use Map designation from Residential Low (RL) and Residential High (RH) to Residential/Office General (R/OG) GENERAL DATA: Applicant ......................... Craig A. Taraszki, Esq., Johnson Pope Owner ............................. Spare Investors Realty, LLC Location .......................... 1528 Lakeview Road, approximately 500 feet east of South Highland Avenue Property Size ................... 1.332 acres Background: This case involves a 1.332-acre property located on the north side of Lakeview Road approximately 500 feet east of South Highland Avenue. The parcel, owned by Spare Investors Realty, LLC, is occupied by a vacant 10,196 square foot office building. Currently, the property has two future land use map designations: the office building and main parking lot occupy the portion designated Residential High (RH) which is applied to the majority of the site, and additional parking and landscaping occupy the remainder of the site, which is designated Residential Low (RL). Maps 1 and 2 show the general location of the property and an aerial view of the amendment area. The site was originally developed in 1985 as a one-story medical clinic and was used as an orthopedic surgery center for many years. The building is currently listed for sale as a general office. It is important to note that neither medical clinics nor offices are listed permitted uses within the current residential zoning districts, consistent with the underlying future land use categories. This disconnect between the design purposes of the building and the property’s current designations has hampered efforts by the property owner to attract new tenants. The request is to change the Future Land Use Map designations of the property from Residential Low (RL) and Residential High (RH) to Residential/Office General (R/OG). A request to rezone the property from the Low Medium Density Residential (LMDR) and High Density Residential (HDR) Districts to the Office (O) District is being processed concurrently with this case (see REZ2017-09008). The requested amendments would allow the property to continue to be used as an office or medical clinic, consistent with its historic use. The City is committed to preserving land and buildings that are needed to View looking north at the subject property 1528 Lakeview Road East of the subject property West of the subject property Across the street, to the south of the subject property LUP2017-09008 / REZ2017-09008 Spare Investors Realty LLC 1528 Lakeview Road View looking easterly along Lakeview Road View looking westerly along Lakeview Road Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: 9095-18 2nd rdg Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: OrdinanceIn Control: Legal Department Agenda Number: 10.4 SUBJECT/RECOMMENDATION: Adopt Ordinance 9095-18 on second reading, amending the Zoning Atlas of the city by rezoning certain real property whose post office address is 1528 Lakeview Road, Clearwater, Florida 33756, from Low Medium Density Residential (LMDR) and High Density Residential (HDR) to Office (O). SUMMARY: APPROPRIATION CODE AND AMOUNT: USE OF RESERVE FUNDS: Page 1 City of Clearwater Printed on 1/25/2018 Ordinance No. 9095-18 ORDINANCE NO. 9095-18 AN ORDINANCE OF THE CITY OF CLEARWATER, FLORIDA, AMENDING THE ZONING ATLAS OF THE CITY BY REZONING 1.332 ACRES OF CERTAIN REAL PROPERTY LOCATED ON THE NORTH SIDE OF LAKEVIEW ROAD APPROXIMATELY 500 FEET EAST OF SOUTH HIGHLAND AVENUE, WHOSE POST OFFICE ADDRESS IS 1528 LAKEVIEW ROAD, CLEARWATER, FLORIDA 33756, FROM LOW MEDIUM DENSITY RESIDENTIAL (LMDR) AND HIGH DENSITY RESIDENTIAL (HDR) TO OFFICE (O); PROVIDING AN EFFECTIVE DATE. WHEREAS, the amendment to the Zoning Atlas of the City as set forth in this ordinance is found to be reasonable, proper and appropriate, and is consistent with the City's Comprehensive Plan; now, therefore, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF CLEARWATER, FLORIDA: Section 1. The following described properties in Clearwater, Florida, are hereby rezoned, and the Zoning Atlas of the City is amended as follows: The map attached as Exhibit B is hereby incorporated by reference. Section 2. The City Engineer is directed to revise the Zoning Atlas of the City in accordance with the foregoing amendment. Section 3. This ordinance shall take effect immediately upon adoption, subject to the approval of the land use designation set forth in Ordinance 9094-18 by the Pinellas County Board of County Commissioners. Property Zoning District See attached Exhibit A for Legal Description; From: Low Medium Density Residential (LMDR) and High Density Residential (HDR) To: Office (O) (REZ2017-09008) Ordinance No. 9095-18 PASSED ON FIRST READING PASSED ON SECOND AND FINAL READING AND ADOPTED George N. Cretekos Mayor Approved as to form: Camilo A. Soto Assistant City Attorney Attest: Rosemarie Call City Clerk Exhibit A PARCEL I Lot Eighteen (18), GATES KNOLL, according to the map or plat thereof as recorded in Plat Book 33, page 56, public records of Pinellas County, Florida. PARCEL II A parcel in the Northeast 114 of the Northwest 114 of Section 23, Township 29 South, Range 15 East, further described as follows: Begin from the Southeast comer of the Northeast 1/4 of the Northwest 1/4 of said Section 23-29-15, also the intersection of centerlines of rights-of-way for Lake Avenue and Lakeview Road; run thence along the centerline of the said Lakeview Road right-of-way North 88° 59'34" West, 670.52 feet; thence North 00° 12' 40" West, 50.00 feet for a Point of Beginning; thence run along the Northerly right-of-way line of the said Lakeview Road, North 88° 59' 34" West, 173.16 feet; thence North 00° 10' 16" West, 258.30 feet; thence North 89° 57' 57" East, 35.62 feet; thence South 76° 30' 26" East, 141.29 feet; thence South 00° 12' 40" East, 228.62 feet to the Point of Beginning. SURVEY of an Ingress/Egress easement in the Northeast 1/4 of the Northwest 1/4 of Section 23, Township 29 South, Range 15 East Further described as follows: Begin from the SE corner of the Northeast 1/4 of the Northwestll4 of the said Section 23-29-15, also the intersection of right-of-way centerlines for Lake Avenue and Lakeview Road, and run thence along the right-of-way centerline of the said Lakeview Road, N 88° 59' 34" West, 670.52 feet; thence N 00° 12' 40" West, 50.00 feet to a point along the Northerly right-of-way line of the said Lakeview Road; thence along the centerline of SK YVIEW A VENUE, Per Gates Knoll S/D, Plat Book 33, Page 56 as recorded in the Public Records of Pinellas County, Florida, North 00° 12' 40" West, 218.62 feet for a Point of Beginning; thence run North 80° 22' 27" West, 110.59 feet; thence along the arc of a curve to the right, R=50.00', D=50° 18' 40.6", A= 43.90 feet, C=42.51 feet, CB=North 55° 13' 06.7" West; thence North 89° 57' 57" East, 6.47 feet; thence South 76° 35' 57.83" East, 141.29 feet; thence South 00° 12' 40" East, 10.00 feet to the Point of Beginning. PARCEL III A portion of Lot 1. FORREST HILL ESTATES UNIT 5, according to the plat recorded in Plat Book 58, page 34, public records of Pinellas County, Florida being more particularly described as follows: Commence at the center of Section 23, Township 29 South, Range IS East and run along the North-South centerline of said Section 23, North 0° 21' 39" West a distance of 1331.53 feet to the 40 Acre Line; thence along said 40 Acre Line, run North 88° 59' 34" West a distance of 670.52 feet; thence run North 0° 12' 40" West a distance of 50.00 feet to the North right-of-way line of Lakeview Road; thence along said right-of-way line, run North 88° 59' 34" West a distance of 173.08 feet to the Point of Beginning; thence run North 0° 10’ 16" West a distance of 67.00 feet; thence run North 88° 59'34" West a distance of 54.84 feet; thence run South 0° 02' 03" East a distance of 44.00 feet; thence run North 88° 59' 34" West a distance of 54.00 feet; thence run South 0° 02' 03" East a distance of 23.00 feet; thence run South 88" 59' 34" East a distance of 109 feet to the Point of Beginning. ALSO KNOWN AS: Lot 1, Block 1, KNIGHT & HARRIS, according to the map or plat thereof as recorded in Plat Book 95, page 38 of the Public Records of Pinellas County, FLorida. Exhibit B HIGHLAND10080 73 606060606666505066666060838366666080 78 832901629034 45063 45065 45067 4507129034 29034 30366 30348 5 38826 45068 4506946950 1 114 155 6 69 68 67 66 65 64 63 62 13113 54 55 56 57 58 59 60 61 22112 111 110 109 108 107 106 105 156 157 158 159 160 161 104 53 52 51 50 49 48 47 46 23 2 37 38 39 40 41 42 43 44 45 16 17 36 35 34 33 32 31 29 28 15 20 21 22 23 24 25 26 27 8 9 18 17 16 15 14 13 12 11 10 7 1 2 3 4 5 6789 12 22 23 24 25 26 27 28 29 30 31 32 33 34 35 49 48 47 46 45 44 43 42 41 40 39 38 37 36 6362616059585756555453525150 75 74 73 72 71 70 69 68 67 66 65 64 21 20 19 18 17 16 5 4 4 1 8 7 3 1 30 (114) 2 1 21/04 13/06 13/07 22/02 23/01 1.31 AC(C) 3 2 1 1 2 I HDR LMDR C O HDR LMDR O MDR S LAKE AVE BARRY RD LAKEVIEW RD VALENCIA ST S HIGHLAND AVE OTTAWA RD ILLINOIS RD TUSCOLA RD 1248 14991260 15461557156515391519150415191508151216011256 1244 15181548155915241549153615111532153715401230 15511267 1235 14651235 157015751250 15321256 153915561323 155115551501154315451319 150515201537158115641565158115121536154615581300 154115741246 154315511540153515591232 160015471549152715521511155515281220 132015481225 160015521523155615711509155015501269 16001228 1538154515361548155216041266 1531155415001271 1555157515551274 1510146915381241 15511539152715281280 154415481542151615481261 15711236 15521235 15471546152415011277 154215351270 15501285 153615401211 154016011542151515471254 1516150014661542153116001235 15511547150315511262 1235 1224 1508153715401226 15501238 1258A 1240A 1234A 1254A 1268A 1238A 15231251 16011231 16001515241255 1530151227 1515411555151515123514 1515801240 1305 1268 1536 1235 15152813111539141239 1243 1481151141247 1261 1235 1242A 1260A -Not to Scale--Not a Survey-Rev. 10/27/2017 ZONING MAP Owner(s): Spare Investors Realty, LLC Case: LUP2017-09008 REZ2017-09008 Site: 1528 Lakeview Road Property Size(Acres): 1.332 Land Use Zoning PIN: 23-29-15-00000-210-0400 From: RL, RH LMDR, HDR To: R/OG O Atlas Page: 307A R-3 R-3 R-3 R-3 P-1 PLANNING & DEVELOPMENT DEPARTMENT COMMUNITY DEVELOPMENT BOARD STAFF REPORT MEETING DATE: November 21, 2017 AGENDA ITEM: G.4. CASE: REZ2017-09008 REQUEST: To amend the Zoning Atlas designation from Low Medium Density Residential (LMDR) and High Density Residential (HDR) to Office (O) GENERAL DATA: Applicant ......................... Craig A. Taraszki, Esq., Johnson Pope Owner ............................. Spare Investors Realty, LLC Location .......................... 1528 Lakeview Road, approximately 500 feet east of South Highland Avenue Property Size ................... 1.332 acres Background: This case involves a 1.332-acre property located on the north side of Lakeview Road approximately 500 feet east of South Highland Avenue. The parcel, owned by Spare Investors Realty, LLC, is currently occupied by a vacant 10,196 square foot office building. Currently, the property has two Zoning Atlas designations: the office building and main parking lot occupy the portion designated as High Density Residential (HDR) which is applied to the majority of the site, and additional parking and landscaping occupy the remainder of the site, which is designated as Low Medium Density Residential (LMDR). Maps 1 and 2 show the general location of the property and an aerial view of the amendment area. The site was originally developed in 1985 as a one-story medical clinic and was used as an orthopedic surgery center for many years. The building is currently listed for sale as a general office. It is important to note that neither medical clinics nor offices are listed permitted uses within the current residential zoning districts. This disconnect between the design purposes of the building and the property’s current zoning designations has hampered efforts by the property owner to attract new tenants. The request is to change the property’s Zoning Atlas designations of Low Medium Density Residential (LMDR) and High Density Residential (HDR) Districts to the Office (O) District. A request to amend the property from the Residential Low (RL) and Residential High (RH) Future Land Use Map designations to the Residential/Office General (R/OG) Future Land Use Map designation is being processed concurrently with this case (see LUP2017- 09008). The requested amendments would allow the property to continue to be used as an office or medical clinic, consistent with its historic use. The City is committed to preserving land and buildings that are needed Community Development Board – November 21, 2017 REZ2017-09008- Page 5 of 8 Level III Zoning Atlas Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Applicable section of the Community Development Code which supports the proposed amendment: Division 10. Office District, Section 2-1001. Intent and Purpose. The intent and purpose of the Office “O” District is to provide the citizens of the City of Clearwater with convenient access to professional services and high quality jobs throughout the city without adversely impacting the integrity of residential neighborhoods, diminishing the scenic quality of the City of Clearwater or negatively impacting the safe and efficient movement of people and things within the City of Clearwater. The proposed Office (O) District is compatible with the surrounding single family and multi-family residential uses, the commercial uses and the office uses. The applicant is intending to utilize the property as a medical clinic / office, which has been the historic use of the property. In addition, the proposal does not degrade the level of service for public facilities below the adopted standards (a detailed public facilities analysis follows in this report). Recommended Conclusions of Law: The request does not conflict with the goals, objectives and policies of the Clearwater Comprehensive Plan and furthers said plan and the Community Development Code as indicated above. Compatibility with Surrounding Property/Character of the City & Neighborhood [Section 4-602.F.2, 4-602.F.3 and Section 4-602.F.4] Recommended Findings of Fact: Existing surrounding uses consist of single family homes (east and south), offices (southwest), multi-family residential (north and west) and commercial (west). The proposed use of the subject property as office (currently developed as such) is compatible with the surrounding properties and neighborhood. The proposed Office (O) zoning district is consistent with the surrounding zoning districts that exist in the vicinity of the subject property. The proposed Office (O) zoning district will allow for the property to become a conforming use as a medical clinic / office use. As such, the proposed amendment will allow development that is in character with and beneficial to the surrounding properties and neighborhood. Recommended Conclusions of Law: The proposed Office (O) zoning district is in character with the zoning districts in the area. Further, the proposal is compatible with surrounding uses and consistent with the character of the surrounding properties and neighborhood. Sufficiency of Public Facilities [Section 4-602.F.5] Recommended Findings of Fact: To assess the sufficiency of public facilities needed to support potential development on the proposed amendment area, the maximum development potential of the property under the present and requested City Future Land Use Map designations were analyzed (see Table 1). Even though this is a Zoning Atlas amendment application, maximum development potential is based on the underlying future land use, so for purposes of this analysis sufficiency of public facilities is based on the future land use map designation. View looking north at the subject property 1528 Lakeview Road East of the subject property West of the subject property Across the street, to the south of the subject property LUP2017-09008 / REZ2017-09008 Spare Investors Realty LLC 1528 Lakeview Road View looking easterly along Lakeview Road View looking westerly along Lakeview Road Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: 9097-18 2nd rdg Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: OrdinanceIn Control: Legal Department Agenda Number: 10.5 SUBJECT/RECOMMENDATION: Adopt Ordinance 9097-18 on second reading, amending the future land use plan element of the Comprehensive Plan of the city to change the land use designation for certain real property whose post office address is 720 Tuskawilla Street, Clearwater, Florida 33756, from Residential/Office General (R/OG) to Institutional (I). SUMMARY: APPROPRIATION CODE AND AMOUNT: USE OF RESERVE FUNDS: Page 1 City of Clearwater Printed on 1/25/2018 Ordinance No. 9097-18 ORDINANCE NO. 9097-18 AN ORDINANCE OF THE CITY OF CLEARWATER, FLORIDA, AMENDING THE FUTURE LAND USE ELEMENT OF THE COMPREHENSIVE PLAN OF THE CITY, TO CHANGE THE LAND USE DESIGNATION FOR A 0.145- ACRE PORTION OF CERTAIN REAL PROPERTY LOCATED ON THE NORTH SIDE OF TUSKAWILLA STREET APPROXIMATELY 90 FEET WEST OF SOUTH MYRTLE AVENUE, WHOSE POST OFFICE ADDRESS IS 720 TUSKAWILLA STREET, CLEARWATER, FLORIDA 33756, FROM RESIDENTIAL/OFFICE GENERAL (R/OG) TO INSTITUTIONAL (I); PROVIDING AN EFFECTIVE DATE. WHEREAS, the amendment to the Future Land Use Element of the Comprehensive Plan of the City as set forth in this ordinance is found to be reasonable, proper and appropriate, and is consistent with the City's Comprehensive Plan; now, therefore, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF CLEARWATER, FLORIDA: Section 1. The Future Land Use Element of the Comprehensive Plan of the City of Clearwater is amended by designating the land use categories for the hereinafter described property, as follows: Property Land Use Category Lot 13, Block 16, MILTON PARK, according to the map or plat thereof, as recorded in Plat Book 1, Page 69 of the Public Records of Pinellas County, Florida; From: Residential/Office General (R/OG) To: Institutional (I) (LUP2017-10010) The map attached as Exhibit A is hereby incorporated by reference. Section 2. The City Council does hereby certify that this ordinance is consistent with the City’s Comprehensive Plan. Section 3. This ordinance shall take effect contingent upon approval of the land use designation by the Pinellas County Board of Commissioners, where applicable, and thirty-one (31) days post-adoption. If this ordinance is appealed within thirty (30) days after adoption, then this ordinance will take effect only after approval of the land use designation by the Pinellas County Board of Commissioners and upon issuance of a final order determining this amendment to be in compliance either by the Department of Economic Opportunity (DEO) or the Administration Commission, where applicable, pursuant to section 163.3187, Florida Statutes. The Community Development Coordinator is authorized to transmit to Forward Pinellas, in its role as the Pinellas Planning Council, an application to amend the Countywide Plan in order to achieve consistency with the Ordinance No. 9097-18 Future Land Use Plan Element of the City’s Comprehensive Plan as amended by this ordinance. PASSED ON FIRST READING PASSED ON SECOND AND FINAL READING AND ADOPTED George N. Cretekos Mayor Approved as to form: Camilo A. Soto Assistant City Attorney Attest: Rosemarie Call City Clerk Exhibit A 606033 33 301630CSX RAILROAD45 60 63.9 50 91134 58068 9 17 16 12 2 21 7 654 3 2 13 14 8 9 10 11 12 13 14 3 2 1 7 6 5 4 3 2 1 14131211109814 13 2 A 1 8 7 6 5 4 3 2 1 12111094 3B 1 11/05 30 30 33 60601603042 10 15 3456789 10 11 12 13 14 15 16 3456789 1 2 3 5 6 789 14 15 164 22/04 3.8 AC(C) 1 I I IL IL IL IL R/OG R/OG I RU RU RU RU IL R/OG R/OG R/OG R/OG PINELLAS ST S MYRTLE AVE TUSKAWILLA ST TUSKAWILLA ST 7126258238218127118147008317027107007048098248058231245 1237 1229 1225 711A1251 1230 627820803808715817714517217107188168177207168028247241231 1241 1265 1239 1243 1235 1227 1259 12471249 1233711I -Not to Scale--Not a Survey-Rev. 10/9/2017 FUTURE LAND USE MAP Owner(s): Esward and James White VFW Post 10304 Case: LUP2017-10010 REZ2017-10011 Site: 720 Tuskawilla Street Property Size(Acres): 0.145 Land Use Zoning PIN: 21-29-15-58068-016-0130 From: Residential/Office General (R/OG) Office (O) To: Institutional (I) Institutional (I) Atlas Page: 305B View looking north at the subject property 720 Tuskawilla Street East of the subject property West of the subject property Across the street, to the south of the subject property LUP2017-10010 / REZ2017-10011 Edward and James White VFW Post 10304 720 Tuskawilla Street View looking easterly along Lakeview Road View looking westerly along Lakeview Road Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: 9098-18 Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: OrdinanceIn Control: Legal Department Agenda Number: 10.6 SUBJECT/RECOMMENDATION: Adopt Ordinance 9098-18 on second reading, amending the Zoning Atlas of the city by rezoning certain real property whose post office address is 720 Tuskawilla Street, Clearwater, Florida 33756, from Office (O) to Institutional (I). SUMMARY: APPROPRIATION CODE AND AMOUNT: USE OF RESERVE FUNDS: Page 1 City of Clearwater Printed on 1/25/2018 Ordinance No. 9098-18 ORDINANCE NO. 9098-18 AN ORDINANCE OF THE CITY OF CLEARWATER, FLORIDA, AMENDING THE ZONING ATLAS OF THE CITY BY REZONING A 0.145-ACRE PORTION OF CERTAIN REAL PROPERTY LOCATED ON THE NORTH SIDE OF TUSKAWILLA STREET APPROXIMATELY 90 FEET WEST OF SOUTH MYRTLE AVENUE, WHOSE POST OFFICE ADDRESS IS 720 TUSKAWILLA STREET, CLEARWATER, FLORIDA 33756, FROM OFFICE (O) TO INSTITUTIONAL (I); PROVIDING AN EFFECTIVE DATE. WHEREAS, the amendment to the Zoning Atlas of the City as set forth in this ordinance is found to be reasonable, proper and appropriate, and is consistent with the City's Comprehensive Plan; now, therefore, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF CLEARWATER, FLORIDA: Section 1. The following described properties in Clearwater, Florida, are hereby rezoned, and the Zoning Atlas of the City is amended as follows: The map attached as Exhibit A is hereby incorporated by reference. Section 2. The City Engineer is directed to revise the Zoning Atlas of the City in accordance with the foregoing amendment. Section 3. This ordinance shall take effect immediately upon adoption, subject to the approval of the land use designation set forth in Ordinance 9097-18 by the Pinellas County Board of County Commissioners, and subject to a determination by the State of Florida, as appropriate, of compliance with the applicable requirements of the Local Government Comprehensive Planning and Land Development Regulation Act, pursuant to §163.3189, Florida Statutes. Property Zoning District Lot 13, Block 16, MILTON PARK, according to the map or plat thereof, as recorded in Plat Book 1, Page 69 of the Public Records of Pinellas County, Florida; From: Office (O) To: Institutional (I) (REZ2017-10011) Ordinance No. 9098-18 PASSED ON FIRST READING PASSED ON SECOND AND FINAL READING AND ADOPTED George N. Cretekos Mayor Approved as to form: Camilo A. Soto Assistant City Attorney Attest: Rosemarie Call City Clerk Exhibit A 606033 33 301630CSX RAILROAD45 60 63.9 50 91134 58068 9 17 16 12 2 21 7 654 3 2 13 14 8 9 10 11 12 13 14 3 2 1 7 6 5 4 3 2 1 14131211109814 13 2 A 1 8 7 6 5 4 3 2 1 12111094 3B 1 11/05 30 30 33 60601603042 10 15 3456789 10 11 12 13 14 15 16 3456789 1 2 3 5 6 789 14 15 164 22/04 3.8 AC(C) 1 PINELLAS ST S MYRTLE AVE TUSKAWILLA ST TUSKAWILLA ST I O IRT LMDR C7128208238038087158128177117148147217008317027107007188167048248058237241245 1237 1229 1225 711A1259 1251 1230 627625821517108177208097168028241231 1241 1265 1239 1243 1235 1227 12471249 1233711I -Not to Scale--Not a Survey-Rev. 10/9/2017 ZONING MAP Owner(s): Esward and James White VFW Post 10304 Case: LUP2017-10010 REZ2017-10011 Site: 720 Tuskawilla Street Property Size(Acres): 0.145 Land Use Zoning PIN: 21-29-15-58068-016-0130 From: Residential/Office General (R/OG) Office (O) To: Institutional (I) Institutional (I) Atlas Page: 305B View looking north at the subject property 720 Tuskawilla Street East of the subject property West of the subject property Across the street, to the south of the subject property LUP2017-10010 / REZ2017-10011 Edward and James White VFW Post 10304 720 Tuskawilla Street View looking easterly along Lakeview Road View looking westerly along Lakeview Road Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: 9099-18 2nd rdg Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: OrdinanceIn Control: Legal Department Agenda Number: 10.7 SUBJECT/RECOMMENDATION: Adopt Ordinance 9099-18 on second reading, amending the future land use plan element of the Comprehensive Plan of the city to change the land use designation for certain real property whose post office address is 1524 South Highland Avenue, Clearwater, Florida 33756, from Residential Low (RL) to Residential/Office General (R/OG). SUMMARY: APPROPRIATION CODE AND AMOUNT: USE OF RESERVE FUNDS: Page 1 City of Clearwater Printed on 1/25/2018 Ordinance No. 9099-18 ORDINANCE NO. 9099-18 AN ORDINANCE OF THE CITY OF CLEARWATER, FLORIDA, AMENDING THE FUTURE LAND USE ELEMENT OF THE COMPREHENSIVE PLAN OF THE CITY, TO CHANGE THE LAND USE DESIGNATION FOR CERTAIN REAL PROPERTY LOCATED ON THE WEST SIDE OF SOUTH HIGHLAND AVENUE APPROXIMATELY 500 FEET SOUTH OF NURSERY ROAD, WHOSE POST OFFICE ADDRESS IS 1524 SOUTH HIGHLAND AVENUE, CLEARWATER, FLORIDA 33756, FROM RESIDENTIAL LOW (RL), TO RESIDENTIAL/OFFICE GENERAL (R/OG); PROVIDING AN EFFECTIVE DATE. WHEREAS, the amendment to the Future Land Use Element of the Comprehensive Plan of the City as set forth in this ordinance is found to be reasonable, proper and appropriate, and is consistent with the City's Comprehensive Plan; now, therefore, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF CLEARWATER, FLORIDA: Section 1. The Future Land Use Element of the Comprehensive Plan of the City of Clearwater is amended by designating the land use category for the hereinafter described property as follows: Property Land Use Category Lots 12, 13 and the South 20 feet of Lot 14, Block B, Scotia Heights, according to the map or plat thereof, as recorded in Plat Book 10, Page 10, of the Public Records of Pinellas County, Florida. From: Residential Low (RL) To: Residential/ Office General (R/OG) (LUP2017-09006) The map attached as Exhibit A is hereby incorporated by reference. Section 2. The City Council does hereby certify that this ordinance is consistent with the City’s Comprehensive Plan. Section 3. This ordinance shall take effect contingent upon and subject to the approval of the land use change by the Pinellas County Board of Commissioners, where applicable, and thirty-one (31) days post-adoption. If this ordinance is appealed within thirty (30) days after adoption, then this ordinance will take effect only after approval of the land use designation by the Pinellas County Board of Commissioners and upon issuance of a final order determining this amendment to be in compliance either by the Department of Economic Opportunity (DEO) or the Administration Commission, where applicable, pursuant to section 163.3187, Florida Statutes. The Community Development Coordinator is authorized to transmit to Forward Pinellas, in its role as the Pinellas Planning Council, an application to amend the Countywide Plan in order to achieve consistency with the Ordinance No. 9099-18 Future Land Use Plan Element of the City’s Comprehensive Plan as amended by this ordinance. PASSED ON FIRST READING PASSED ON SECOND AND FINAL READING AND ADOPTED George N. Cretekos Mayor Approved as to form: Camilo A. Soto Assistant City Attorney Attest: Rosemarie Call City Clerk Exhibit A FUTURE LAND USE MAP Owner(s): Odin Enterprises, Inc. Case: LUP2017-09006 Site: 1524 S. Highland Avenue Property Size(Acres): ROW (Acres): 0.22 Land Use Zoning PIN: 23-29-15-79254-002-0120 From : Residential Low (RL) Low Medium Density Residential (LMDR) Atlas Page: 315A To: Residential/Office General (R/OG) Medium Density Residential (MDR) I CG RL R/OG R/OG RL RL RLRL RU NURSERY RD S HIGHLAND AVE BRAUND ST ROSE ST REGAL RD JORDAN HILLS CT 148414901511 1501152014481536 1555 1529 1523 154714531541 1545 1527 1520 15291440 89152514461521 1516150815241461 1550 1478 1515 14411535 1532 153315121509146814461460 14471500 144914511543 1513 1537 1525 15161464 483144814491539 1533 1504 15311448 154914521504152114561505 1508 1519 1500 -Not to Scale--Not a Survey-Rev. 11/17/17 PLANNING & DEVELOPMENT DEPARTMENT COMMUNITY DEVELOPMENT BOARD STAFF REPORT MEETING DATE: December 19, 2017 AGENDA ITEM: F.3. CASE: LUP2017-09006 REQUEST: To amend the Future Land Use Map designation from Residential Low (RL) to Residential/Office General (R/OG) GENERAL DATA: Applicant ......................... Housh Ghovaee, CEO, Northside Engineering, Inc. Owner ............................. Sam Karamountzos, President, Odin Enterprises, Inc. Location .......................... 1524 South Highland Avenue, approximately 500 feet south of Nursery Road Property Size ................... 0.22 acres Background: This case involves a 0.22-acre property located on the west side of South Highland Avenue approximately 500 feet south of Nursery Road. The parcel, owned by Odin Enterprises, Inc., is vacant, the previous dwelling having been demolished in 2006. Maps 1 and 2 show the general location of the property and an aerial view of the amendment area. The request is to change the Future Land Use Map designation of the property from Residential Low (RL) to Residential/Office General (R/OG). A request to rezone the property from the Low Medium Density Residential (LMDR) District in conjunction with two adjacent parcels under common ownership from the Office (O) District to the Medium Density Residential (MDR) District is being processed concurrently with this case (see REZ2017-10010). The requested amendments would establish a uniform zoning across all three parcels and would allow the property to be redeveloped as attached dwellings, which the applicant has indicated is the intended use; however, no site plan has been submitted at this time. Community Development Board – December 19, 2017 LUP2017-09006 - Page 2 of 8 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Map 1 Map 2 Vicinity Characteristics: Map 3 shows the existing surrounding uses. To the north and to the west, in unincorporated Pinellas County, are single family neighborhoods. To the south and east are vacant lots. Further south is an office building, and to the southeast are commercial uses (LaBelle plaza). Map 3 Community Development Board – December 19, 2017 LUP2017-09006 - Page 3 of 8 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION As shown on Map 4, the abutting future land use designations are Residential Low (RL) to the north and west, and Residential/Office General (R/OG) to the south and east. Further to the southeast is Commercial General (CG). A comparison between the uses, densities and intensities allowed by the present and proposed Future Land Use Map designations appears in Table 1, along with the consistent zoning districts. Map 4 Map 5 Table 1. Uses, Densities and Intensities Allowed by Present and Proposed Future Land Use Designations Present FLUM Designation Residential Low (RL) Requested FLUM Designation Residential/Office General (R/OG) Primary Uses: Low Density Residential Medium Density Residential; Residential Equivalent; Office Maximum Density: 5 Dwelling Units Per Acre 15 Dwelling Units Per Acre Maximum Intensity: FAR 0.40; ISR 0.65 FAR 0.50; ISR 0.75 Consistent Zoning Districts: Low Density Residential (LDR); Low Medium Density Residential (LMDR) Medium Density Residential (MDR); Office (O) Community Development Board – December 19, 2017 LUP2017-09006 - Page 4 of 8 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION REVIEW CRITERIA: Consistency with the Clearwater Comprehensive Plan [Sections 4-603.F.1 and 4-603.F.2] Recommended Findings of Fact: Applicable goals, objective and policies of the Clearwater Comprehensive Plan which support the proposed amendment include: Goal A.2 A sufficient variety and amount of future land use categories shall be provided to accommodate public demand and promote infill development. Goal A.4. The City shall work toward a land use pattern that can be supported by the available community and public facilities that would be required to serve the development. Policy A.5.5.1 Development shall be designed to maintain and support the existing or envisioned character of the neighborhood. Objective A.6.4 Due to the built-out character of the city of Clearwater, compact urban development within the urban service area shall be promoted through the application of the Clearwater Community Development Code. Policy C.1.1.1 Maintain sufficient residentially zoned acreage, of varying densities and locations, to accommodate the existing and future housing needs of the City of Clearwater. The proposed Residential/Office General (R/OG) future land use designation is compatible with the surrounding single family residential, office and commercial uses, including the LaBelle plaza across South Highland Avenue, which is identified as a Neighborhood Shopping Center in the City’s Citywide Design Structure. The applicant has indicated the intention to develop the property in conjunction with two parcels to the south with attached dwellings (townhomes), which would be possible through the proposed future land use change. Although the Residential/Office General (R/OG) designation allows for more intense development than the Residential Low (RL) designation along the eastern portion of the site, the allowable density is appropriate along Highland Avenue, a collector road. In addition, the proposal does not degrade the level of service for public facilities below the adopted standards (a detailed public facilities analysis follows in this report). Recommended Conclusions of Law: The request does not conflict with the goals, objectives and policies of the Clearwater Comprehensive Plan and furthers said plan as indicated in the goals, objective and policy listed above. Consistency with the Countywide Rules Recommended Findings of Fact: The underlying Countywide Plan Map category on the proposed amendment area is Residential Low Medium (RLM). Residential properties to the north and west are designated Residential Low Medium (RLM), with Office (O) designated to the south and east. There are properties designated Retail & Services (R&S) to the south and southeast. The proposed City of Clearwater future land use designation of Residential/Office General (R/OG) will necessitate an amendment from the Residential Low Medium (RLM) Community Development Board – December 19, 2017 LUP2017-09006 - Page 5 of 8 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION category to the Office (O) category in order to maintain consistency between the City’s Future Land Use Map and the Countywide Plan Map. Section 2.3.3.5 of the Countywide Rules states that the Office (O) category is intended to accommodate areas developed, or appropriate to be developed, with office uses, low-impact employment uses, and residential uses (subject to an acreage threshold), in areas characterized by a transition between residential and commercial uses and in areas well-suited for community-scale residential/office mixed-use development. The current and proposed use, as indicated by the applicant, is a residential use, which is an appropriate use within the area and consistent with the proposed and surrounding Countywide Plan Map categories. Recommended Conclusions of Law: The proposed Future Land Use Map amendment is consistent with the purpose of the proposed category in the Countywide Rules. Compatibility with Surrounding Properties/Character of the City & Neighborhood [Section 4-603.F.3 and Section 4-603.F.6] Recommended Findings of Fact: Existing surrounding uses consist of single family homes (north and west), vacant property (south and northeast), offices (further south), and commercial (southeast). The proposed use of the subject property as attached dwellings is compatible with the surrounding properties and neighborhood. The proposed Residential/Office General (R/OG) future land use category primarily permits residential development at a density of 15 dwelling units per acre and nonresidential development at a Floor Area Ratio (FAR) of 0.50. The future land use designations of surrounding properties include Residential Low (RL), Residential/Office General (R/OG). The proposed Residential/Office General (R/OG) future land use category, which primarily allows for moderate density residential, residential equivalent uses and office uses, is consistent with the surrounding future land use designations that exist in the vicinity of the subject property, which primarily allow low density residential uses as well as office uses. The proposed amendment will allow development that supports the neighborhood shopping center across South Highland Avenue, and will serve as a transition from the office uses south of the subject property to the single family residential uses to the north and west of the property. Recommended Conclusions of Law: The proposed Residential/Office General (R/OG) future land use category is in character with the Future Land Use Map designations in the area. Further, the proposal is compatible with surrounding uses and consistent with the character of the surrounding properties and neighborhood. Sufficiency of Public Facilities [Section 4-603.F.4] Recommended Findings of Fact: To assess the sufficiency of public facilities needed to support potential development on the proposed amendment area, the maximum development potential of the property under the present and requested City Future Land Use Map designations were analyzed. Community Development Board – December 19, 2017 LUP2017-09006 - Page 6 of 8 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Table 2. Development Potential for Existing & Proposed FLUM Designations Present FLUM Designation “RL” Requested FLUM Designation “R/OG” Net Change Site Area 0.22 AC (9,583 SF) 0.22 AC (9,583SF) Maximum Development Potential 1 DU 0 SF1 0.40 FAR 3 DUs 4,791 SF 0.50 FAR 2 DUs 4,791 SF 0.10 FAR Notes: 1. Nonresidential uses not permitted through consistent Low Medium Density Residential (LMDR) District Abbreviations: FLUM – Future Land Use Map DUs – Dwelling Units FAR – Floor Area Ratio AC – Acres SF – Square feet As shown in the table, there is an increase in development potential across the amendment area which would increase demand on public facilities as detailed further below. The following analysis compares the maximum potential development of the proposed Residential/Office General (R/OG) future land use developed with a residential use (3 dwelling units) to the maximum development potential of the existing Residential Low (RL) future land use category developed with a residential use (1 dwelling unit). Potable Water The increase in development potential from this amendment would result in an increase in potable water use of 521 gallons per day. This is determined by comparing the potential potable water utilization of a residential development built to the maximum density allowed by the proposed land use (781 gallons per day) to the potential utilization of a residential development built to the maximum number of dwelling units allowed by the current land use designation (260 gallons per day). Wastewater The increase in development potential from this amendment would also result in an increase in wastewater production of 469 gallons per day. This is determined by comparing the potential wastewater generation of the proposed land use developed with a residential use (703 gallons) to the potential wastewater generation of the current land use designation developed with a residential use (234 gallons). Solid Waste The proposed amendment could result in an increase of 10.4 tons per year of solid waste generated when comparing the amount of waste generated by three dwelling units to that of one dwelling unit. All solid waste disposal is handled by Pinellas County at the Pinellas County Waste-to-Energy Plant and the Bridgeway Acres Sanitary Landfill which has significant capacity. Additionally, the City provides a full-service citywide recycling program which diverts waste from the landfill, helping to extend the lifespan of Bridgeway Acres. There is excess solid waste capacity to serve the amendment area. Community Development Board – December 19, 2017 LUP2017-09006 - Page 7 of 8 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Parkland The City’s adopted LOS for parkland acreage, which is 4 acres per 1,000 population, will not be impacted by this proposed amendment. Under both the existing and proposed land use, the LOS citywide will remain at 15.46 acres per 1,000 population. Stormwater Site plan approval will be required before the property can be redeveloped. At that time, the stormwater management system for the site will be required to meet all City and SWFWMD stormwater management criteria. Streets The subject property is located on the west side of South Highland Avenue, approximately 500 feet south of Nursery Road. To evaluate potential impacts to streets, the typical traffic impacts figure (trips per day per acre) in the Countywide Rules for the corresponding Countywide Plan Map categories (current and proposed) are compared. The current number of trips per day (14 trips) is calculated based on the traffic generation numbers for the Residential Low Medium (RLM) category (67 trips per day per acre). However, the traffic generation numbers for the corresponding Countywide Plan Map category of Office (O) is (89 trips per day per acre), would generate 19 trips. This is an increase of 5 trips per day compared to the number of trips under the current designations. Recommended Conclusions of Law: Based upon the findings of fact, it is determined that the proposed change will result in an increase demand for public facilities, however the increase is nominal and will not degrade of the existing levels of service for potable water, sanitary sewer, solid waste, parkland, stormwater management and streets. Impact on Natural Resources [Section 4-603.F.5] Recommended Findings of Fact: No wetlands appear to be located on the subject property. The City’s codes require that development is compliant with the City’s tree preservation, landscaping and stormwater management requirements. Recommended Conclusions of Law: Based upon the findings of fact, it is determined that the proposed Future Land Use Map amendment will not negatively impact natural resources on the subject property. SUMMARY AND RECOMMENDATION: No amendment to the Comprehensive Plan or Future Land Use Map shall be recommended for approval or receive a final action of approval unless it complies with the standards contained in Section 4-603.F, Community Development Code. Table 3 below depicts the consistency of the proposed amendment with the standards pursuant to Section 4-603.F: Community Development Board – December 19, 2017 LUP2017-09006 - Page 8 of 8 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Table 3. Consistency with Community Development Code Standards for Review CDC Section 4-603 Standard Consistent Inconsistent F.1 The amendment will further implementation of the Comprehensive Plan consistent with the goals, policies and objectives contained in the Plan. X F.2 The amendment is not inconsistent with other provisions of the Comprehensive Plan. X F.3 The available uses, if applicable, to which the properties may be put are appropriate to the properties in question and compatible with existing and planned uses in the area. X F.4 Sufficient public facilities are available to serve the properties. X F.5 The amendment will not adversely affect the natural environment. X F.6 The amendment will not adversely impact the use of properties in the immediate area. X Based on the foregoing, the Planning and Development Department recommends the following action: Recommend APPROVAL of the Future Land Use Map Amendment from Residential Low (RL) to Residential/Office General (R/OG). Prepared by Planning and Development Department Staff: Ellen Crandall Senior Planner ATTACHMENTS: Ordinance No. 9099-18 Resume Photographs of Site and Vicinity View looking west at the subject property, 1524 South Highland Avenue Across the street, to the east of the subject property North of the subject property South of the subject property LUP2017-09006 Sam Karamountzos, President, Odin Enterprises, Inc. 1524 South Highland Road View looking northerly along South Highland Avenue View looking southerly along South Highland Avenue Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: 9100-18 2nd rdg Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: OrdinanceIn Control: Legal Department Agenda Number: 10.8 SUBJECT/RECOMMENDATION: Adopt Ordinance 9100-18 on second reading, amending the Zoning Atlas of the city by rezoning certain real property whose post office address is 1524 South Highland Avenue, Clearwater, Florida 33756, from Low Medium Density Residential (LMDR) and Office (O) to Medium Density Residential (MDR). SUMMARY: APPROPRIATION CODE AND AMOUNT: USE OF RESERVE FUNDS: Page 1 City of Clearwater Printed on 1/25/2018 Ordinance No. 9100-18 ORDINANCE NO. 9100-18 AN ORDINANCE OF THE CITY OF CLEARWATER, FLORIDA, AMENDING THE ZONING ATLAS OF THE CITY BY REZONING CERTAIN REAL PROPERTIES LOCATED ON THE WEST SIDE OF SOUTH HIGHLAND AVENUE APPROXIMATELY 500 FEET SOUTH OF NURSERY ROAD, WHOSE POST OFFICE ADDRESSES ARE 1536, 1532 AND 1524 SOUTH HIGHLAND AVENUE, FROM LOW MEDIUM DENSITY RESIDENTIAL (LMDR) AND OFFICE (O) TO MEDIUM DENSITY RESIDENTIAL (MDR); PROVIDING AN EFFECTIVE DATE. WHEREAS, the amendment to the Zoning Atlas of the City as set forth in this ordinance is found to be reasonable, proper and appropriate, and is consistent with the City's Comprehensive Plan; now, therefore, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF CLEARWATER, FLORIDA: Section 1. The following described properties in Clearwater, Florida, are hereby rezoned, and the Zoning Atlas of the City is amended as follows: Property Zoning District See attached Exhibit A for Legal Description From: Low Medium Density Residential (LMDR) and Office (O) (REZ2017-10010) To: Medium Density Residential (MDR) The map attached as Exhibit B is hereby incorporated by reference. Section 2. The City Engineer is directed to revise the Zoning Atlas of the City in accordance with the foregoing amendment. Section 3. This ordinance shall take effect immediately upon adoption, subject to the approval of the land use designation set forth in Ordinance 9099-18 by the Pinellas County Board of County Commissioners, where applicable. Ordinance No. 9100-18 PASSED ON FIRST READING PASSED ON SECOND AND FINAL READING AND ADOPTED George N. Cretekos Mayor Approved as to form: Camilo A. Soto Assistant City Attorney Attest: Rosemarie Call City Clerk Exhibit “A” Legal Description Address Parcel Number Legal Description 1536 South Highland Avenue 23‐29‐15‐79254‐002‐ 0010 Lots 1,2,3,4,5,6,7,53,54,55 and 56, Block B, Scotia Heights, according to the map or plat thereof, as recorded in Plat Book 10, Page 10, of the Public Records of Pinellas County, Florida, LESS and EXCEPT the East 7 feet of Lots 1 through 7, inclusive. TOGETHER WITH that portion of the East 1/2 of Braund Street abutting the above described property on the West, vacated by Resolution No. 4445‐87 recorded in Official Records Book 6575, Page 1576, of the Public Records of Pinellas County, Florida. ALSO TOGETHER WITH the North 1/2 of vacated Howard Street (formerly Scott Street), abutting the above described property on the South, vacated by Resolution No. 1899 recorded in Official Records Book 4852, Page 41, of the Public Records of Pinellas County, Florida. 1532 South Highland Avenue 23‐29‐15‐79254‐002‐ 0080 Lots 8, 9, 10 and 11, Block B, Scotia Heights, according to the map or plat thereof, as recorded in Plat Book 10, Page 10, of the Public Records of Pinellas County, Florida. 1524 South Highland Avenue 23‐29‐15‐79254‐002‐ 0120 Lots 12, 13 and the South 20 feet of Lot 14, Block B, Scotia Heights, according to the map or plat thereof, as recorded in Plat Book 10, Page 10, of the Public Records of Pinellas County, Florida. Exhibit B I C MDR O O LMDR LMD LMDR LMDR LMDR LMDR LMDR LMDR 14841490149915111501 1567 1557 15201437149214481569 15361415 1600 1555 1529 15971523 15471453 15231541 154514291414 1608 1527 1520 15291440 1560 15591489152514461424 14671521 1516151515081438141515241433 15651442 1601 146114291550 1478 1577 1515 14961421143314301436149816001425 1519143014561424143214214411500142014861535 1532 1533 15911589142815121509 157314681575 1472 1471 1605 1433152214461460158715711447 14811500 1593145415611449145115631429154314115131417 14451537 14371601 1525 1419141615161464 148314481442144915391425 153115331436 1504 15991416144315311448 1549 1527142145214901504142815791443 149414371521 151114561505142 1508 14251519 1500 1595141914531434-Not to Scale--Not a Survey-Rev. 11/17/17 ZONING MAP Owner(s): Odin Enterprises, Inc. Case: REZ2017-10010 Site: 1524 S. Highland Avenue 1532 S. Highland Avenue 1536 S. Highland Avenue Property Size(Acres): ROW (Acres): 1.69 Land Use Zoning PIN: 23-29-15-79254-002-0120 23-29-15-79254-002-0080 23-29-15-79254-002-0010 From : Residential Low (RL) and Residential Office General (R/OG) Low Medium Density Residential (LMDR) and Office (O) Atlas Page: 315A To: Residential/Office General (R/OG) Medium Density Residential (MDR) PLANNING & DEVELOPMENT DEPARTMENT COMMUNITY DEVELOPMENT BOARD STAFF REPORT MEETING DATE: December 19, 2017 AGENDA ITEM: F.4. CASE: REZ2017-10010 REQUEST: To amend the Zoning Atlas designation from Low Medium Density Residential (LMDR) and Office (O) Districts to Medium Density Residential (MDR) District GENERAL DATA: Applicant ......................... Housh Ghovaee, CEO, Northside Engineering, Inc. Owner ............................. Sam Karamountzos, President, Odin Enterprises, Inc. Location .......................... 1524, 1532 and 1536 South Highland Avenue, approximately 500 feet south of Nursery Road. Property Size ................... 1.69 acres Background: This case involves a 1.69-acre property comprised of three parcels located on the west side of South Highland Avenue, approximately 500 feet south of Nursery Road. The parcels, owned by Odin Enterprises, Inc., are currently vacant. Currently, the property has two Zoning Atlas designations: the northernmost parcel (1524 South Highland Avenue) is designated as Low Medium Density Residential (LMDR) District, and the southern two parcels (1532 and 1536 South Highland Avenue) are designated as Office (O) District. Maps 1 and 2 show the general location of the property and an aerial view of the amendment area. The northernmost parcel, 1524 South Highland, was originally developed with a detached dwelling under the Pinellas County jurisdiction and was demolished in 2006, the same year it annexed into the City of Clearwater. The middle parcel, 1532 S. Highland, was originally developed with a single family residence which was demolished in 1993. The southernmost parcel, 1536 S. Highland, was previously developed as a nursery and landscaping business which was deemed unsafe in 2004 and demolished. The request is to change the properties’ Zoning Atlas designations of Low Medium Density Residential (LMDR) and Office (O) Districts to the Medium Density Residential (MDR) District. A request to amend the northernmost property (1524 S. Highland Avenue) from the Residential Low (RL) Future Land Use Map designation to the Residential/Office General (R/OG) Future Land Use Map designation is being processed concurrently with this case (see LUP2017-09006). The requested amendments would establish a consistent zoning across all three parcels and would allow the property to be redeveloped with attached dwellings. Community Development Board – December 19, 2017 REZ2017-10010- Page 2 of 8 Level III Zoning Atlas Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Map 1 Map 2 Vicinity Characteristics: Map 3 shows the existing surrounding uses. To the north and to the west, in unincorporated Pinellas County, are single family neighborhoods. Also to the west is a place of worship. To the south are offices and further south are commercial uses. To the east is vacant land, commercial uses(LaBelle Plaza). Map 3 Community Development Board – December 19, 2017 REZ2017-10010- Page 3 of 8 Level III Zoning Atlas Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION As shown on Map 5, the abutting zoning districts are Low Medium Density Residential (LMDR) to the north and west, as well as R-3 Single Family Residential (Pinellas County) and Institutional (I) also to the west and Office (O) to the south. To the east, across South Highland Avenue, are the Medium Density Residential (MDR) and Commercial (C) Districts. Map 4 Map 5 REVIEW CRITERIA: Consistency with the Clearwater Comprehensive Plan and Community Development Code and Regulations [Sections 4-602.F.1] Recommended Findings of Fact: Applicable goals, objectives and policies of the Clearwater Comprehensive Plan which support the proposed amendment include: Goal A.2 A sufficient variety and amount of future land use categories shall be provided to accommodate public demand and promote infill development. Goal A.4. The City shall work toward a land use pattern that can be supported by the available community and public facilities that would be required to serve the development. Policy A.5.5.1 Development shall be designed to maintain and support the existing or envisioned character of the neighborhood. Objective A.6.4 Due to the built-out character of the city of Clearwater, compact urban development within the urban service area shall be promoted through the application of the Clearwater Community Development Code. Community Development Board – December 19, 2017 REZ2017-10010- Page 4 of 8 Level III Zoning Atlas Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Policy C.1.1.1 Maintain sufficient residentially zoned acreage, of varying densities and locations, to accommodate the existing and future housing needs of the City of Clearwater. Applicable section of the Community Development Code which supports the proposed amendment: Division 3. Medium Density Residential District, Section 2-301. Intent and Purpose. The intent and purpose of the Medium Density Residential District ("MDR") is to protect and preserve the integrity and value of existing, stable residential neighborhoods of medium density while at the same time, allowing a careful and deliberate redevelopment and revitalization of existing neighborhoods in need of revitalization or neighborhoods with unique amenities which create unique opportunities to increase property values and the overall attractiveness of the City. The proposed Medium Density Residential (MDR) District is compatible with the surrounding single family residential, commercial and office uses. The applicant is intending to redevelop the property with attached dwellings, which would be possible through the proposed rezoning. In addition, the proposal does not degrade the level of service for public facilities below the adopted standards (a detailed public facilities analysis follows in this report). Recommended Conclusions of Law: The request does not conflict with the goals, objectives and policies of the Clearwater Comprehensive Plan and furthers said plan and the Community Development Code as indicated above. Compatibility with Surrounding Property/Character of the City & Neighborhood [Section 4-602.F.2, 4-602.F.3 and Section 4-602.F.4] Recommended Findings of Fact: Existing surrounding uses consist of single family homes (north and west), place of worship (southwest), offices (south), and commercial and vacant land (east). The proposed use of the subject property as attached dwellings is compatible with the surrounding properties and neighborhood. The proposed Medium Density Residential (MDR) zoning district requested is consistent with the zoning districts that exist in the vicinity of the subject property. The proposed Medium Density Residential (MDR) District will allow for the property to redevelop as attached dwellings, which is consistent and in character with the surrounding properties and neighborhood. Recommended Conclusions of Law: The proposed Medium Density Residential (MDR) zoning district is in character with the zoning districts in the area. Further, the proposal is compatible with surrounding uses and consistent with the character of the surrounding properties and neighborhood. Community Development Board – December 19, 2017 REZ2017-10010- Page 5 of 8 Level III Zoning Atlas Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Sufficiency of Public Facilities [Section 4-602.F.5] Recommended Findings of Fact: To assess the sufficiency of public facilities needed to support potential development on the proposed amendment area, the maximum development potential of the property under the present and requested City Future Land Use Map designations were analyzed (see Table 1). Even though this is a Zoning Atlas amendment application, maximum development potential is based on the underlying future land use, so for purposes of this analysis sufficiency of public facilities is based on the future land use map designation. The increase in development potential is limited as the majority of the subject property is currently designated Residential/Office General and the future land use designation of only a 0.22-acre portion of the 1.69-acre total is being amended. Table 1. Development Potential for Existing & Proposed FLUM Designations Present FLUM Designations Requested FLUM Designation “R/OG” “RL” “R/OG” Net Change Site Area 0.22 AC (9,583 SF) 1.47 AC (64,033 SF) 1.69 AC (73,616 SF) Maximum Development Potential 1 DU 0 SF1 0.40 FAR 22 DUs 30,187SF 0.50 FAR 25 DUs 36,808 SF 0.50 FAR 2 DUs 6,621 SF 0.10 FAR Notes: 1. Nonresidential uses not permitted through consistent Low Medium Density Residential (LMDR) District Abbreviations: FLUM – Future Land Use Map DUs – Dwelling Units AC – Acres FAR – Floor Area Ratio SF – Square feet As shown in the table, there is an increase in development potential across the amendment area which would increase demand on public facilities as detailed further below. The following analysis compares the maximum potential development of the proposed Residential/Office General (R/OG) future land use developed with a residential use (25 dwelling units) to the maximum development potential of the existing Residential Low (RL) and Residential/Office General (R/OG) future land use categories developed with a residential use (23 dwelling units). Potable Water The increase in development potential from the companion Future Land Use amendment would result in an increase in potable water use of 521 gallons per day. This is determined by comparing the potential potable water utilization of residential development built to the maximum number of dwelling units (25 dwelling units) allowed by the proposed land use (6,510 gallons per day) to the potential utilization of a residential development built to the maximum number of dwelling units (23 dwelling units) allowed by the current land use designation (5,989 gallons per day). Wastewater The increase in development potential from the companion Future Land Use amendment would also result in an increase in wastewater production of 469 gallons per day. This is determined by comparing the potential Community Development Board – December 19, 2017 REZ2017-10010- Page 6 of 8 Level III Zoning Atlas Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION wastewater generation of the proposed land use developed with a residential development built to the maximum number of dwelling units (25 dwelling units) allowed by the proposed land use (5,859 gallons per day) to the potential utilization of a residential development built to the maximum number of dwelling units (23 dwelling units) allowed by the current land use designation (5,390 gallons per day). Solid Waste The proposed companion amendment could result in an increase of 10 tons per year of solid waste generated when comparing the amount of waste generated by a 23 dwelling unit residential use to that of 25 dwelling unit development. All solid waste disposal is handled by Pinellas County at the Pinellas County Waste-to- Energy Plant and the Bridgeway Acres Sanitary Landfill which has significant capacity. Additionally, the City provides a full-service citywide recycling program which diverts waste from the landfill, helping to extend the lifespan of Bridgeway Acres. There is excess solid waste capacity to serve the amendment area. Parkland The City’s adopted LOS for parkland acreage, which is 4 acres per 1,000 population, will not be impacted by this proposed amendment. Under both the existing and proposed land use, the LOS citywide will remain at 15.46 acres per 1,000 population. Stormwater Site plan approval will be required before the property can be redeveloped. At that time, the stormwater management system for the site will be required to meet all City and SWFWMD stormwater management criteria. Streets The subject property is located on the west side of South Highland Avenue approximately 500 feet south of Nursery Road. To evaluate potential impacts to streets, the typical traffic impacts figure (trips per day per acre) in the Countywide Rules for the corresponding Countywide Plan Map categories (current and proposed) are compared. The current number of trips per day (144 trips) is calculated based on the traffic generation numbers for the Residential Low Medium (RLM) category (67 trips per day per acre) and the Office (O) category (89 trips per day per acre). However, the companion Land Use Plan amendment would require a Countywide Plan Map amendment to the category of Office (O) (89 trips per day per acre), which would generate 150 trips. This is an increase of 5 trips per day compared to the number of trips under the current designations. Recommended Conclusions of Law: Based upon the findings of fact, it is determined that the proposed change will result in a nominal increase which will not degrade the existing levels of service for potable water, sanitary sewer, solid waste, parkland, stormwater management and streets. Community Development Board – December 19, 2017 REZ2017-10010- Page 7 of 8 Level III Zoning Atlas Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Location of District Boundaries [Section 4-602.F.6] Recommended Findings of Fact: The location of the proposed Medium Density Residential (MDR) District is logical and consistent with the boundaries of the subject property. Recommended Conclusions of Law: The District boundaries are appropriately drawn in regard to location and classifications of streets, ownership lines, existing improvements and the natural environment. SUMMARY AND RECOMMENDATION: No amendment to the Zoning Atlas shall be recommended for approval or receive a final action of approval unless it complies with the standards contained in Section 4-602.F, Community Development Code. Table 2 below depicts the consistency of the proposed amendment with the standards pursuant to Section 4-602.F: Table 2. Consistency with Community Development Code Standards CDC Section 4-602 Standard Consistent Inconsistent F.1 The proposed amendment is consistent with and features the goals, policies and objectives of the Comprehensive Plan and furthers the purposes of this Development Code and other city ordinances and actions designed to implement the plan. X F.2 The available uses to which the property may be put are appropriate to the property which is subject to the proposed amendment and compatible with existing and planned uses in the area. X F.3 The amendment does not conflict with the needs and character of the neighborhood and the city. X F.4 The amendment will not adversely or unreasonably affect the use of other property in the area. X F.5 The amendment will not adversely burden public facilities, including the traffic-carrying capacities of streets, in an unreasonably or disproportionate manner. X F.6 The district boundaries are appropriately drawn with due regard to locations and classifications of streets, ownership lines, existing improvements and the natural environment. X Community Development Board – December 19, 2017 REZ2017-10010- Page 8 of 8 Level III Zoning Atlas Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Based on the foregoing, the Planning and Development Department recommends the following action: Recommend APPROVAL of the Zoning Atlas amendment from Low Medium Density Residential (LMDR) and Office (O) Districts to Medium Density Residential (MDR) District. Prepared by Planning and Development Department Staff: Ellen Crandall Senior Planner ATTACHMENTS: Ordinance No. 9100-18 Resume Photographs of Site and Vicinity View looking west at the subject property, 1524 South Highland Avenue View looking west at the subject property, 1532 South Highland Avenue View looking west at the subject property, 1536 South Highland Avenue North of the subject property REZ2017-10010 Sam Karamountzos, President, Odin Enterprises, Inc. 1524, 1532 and 1536 South Highland Road South of the subject property Across the street, east of the subject property Across the street, to the east of the subject property View looking southerly along South Highland Avenue View looking northerly along South Highland Avenue REZ2017-10010 Sam Karamountzos, President, Odin Enterprises, Inc. 1524, 1532 and 1536 South Highland Road Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: 9101-18 2nd rdg contd Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: OrdinanceIn Control: Legal Department Agenda Number: 10.9 SUBJECT/RECOMMENDATION: Continue second reading of Ordinance 9101-18 to April 19, 2018, relating to a Future Land Use Map Amendment from the Residential/Office General (R/OG) category to the Commercial General (CG) category for 300 South Duncan Avenue. SUMMARY: APPROPRIATION CODE AND AMOUNT: USE OF RESERVE FUNDS: Page 1 City of Clearwater Printed on 1/25/2018 Ordinance No. 9101-18 ORDINANCE NO. 9101-18 AN ORDINANCE OF THE CITY OF CLEARWATER, FLORIDA, AMENDING THE FUTURE LAND USE ELEMENT OF THE COMPREHENSIVE PLAN OF THE CITY, TO CHANGE THE LAND USE DESIGNATION FOR CERTAIN REAL PROPERTY LOCATED ON THE WEST SIDE OF SOUTH DUNCAN AVENUE APPROXIMATELY 280 FEET NORTH OF GULF TO BAY BOULEVARD, WHOSE POST OFFICE ADDRESS IS 300 SOUTH DUNCAN AVENUE, CLEARWATER, FLORIDA 33755, FROM RESIDENTIAL/OFFICE GENERAL (R/OG) TO COMMERCIAL GENERAL (CG); PROVIDING AN EFFECTIVE DATE. WHEREAS, the amendment to the Future Land Use Element of the Comprehensive Plan of the City as set forth in this ordinance is found to be reasonable, proper and appropriate, and is consistent with the City’s Comprehensive Plan; now, therefore, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF CLEARWATER, FLORIDA: Section 1. The Future Land Use Element of the Comprehensive Plan of the City of Clearwater is amended by designating the land use category for the hereinafter described property as follows: Property See attached Exhibit A for Legal Description (LUP2017-10011) Land Use Category From: Residential/Office General (R/OG) To: Commercial General (CG) The map attached as Exhibit B is hereby incorporated by reference. Section 2. The City Council does hereby certify that this ordinance is consistent with the City’s Comprehensive Plan. Section 3. This ordinance shall take effect contingent upon and subject to the approval of the land use change by the Pinellas County Board of Commissioners, where applicable, and thirty- one (31) days post-adoption. If this ordinance is appealed within thirty (30) days after adoption, then this ordinance will take effect only after approval of the land use designation by the Pinellas County Board of Commissioners and upon issuance of a final order determining this amendment to be in compliance either by the Department of Economic Opportunity (DEO) or the Administration Commission, where applicable, pursuant to section 163.3187, Florida Statutes. The Community Development Coordinator is authorized to transmit to Forward Pinellas, in its role as the Pinellas Planning Council, an application to amend the Countywide Plan in order to achieve consistency with the Future Land Use Plan Element of the City’s Comprehensive Plan as amended by this ordinance. Ordinance No. 9101-18 PASSED ON FIRST READING PASSED ON SECOND AND FINAL READING AND ADOPTED George N. Cretekos Mayor Approved as to form: Camilo A. Soto Assistant City Attorney Attest: Rosemarie Call City Clerk Exhibit “A” Legal Description Exhibit B CG RU CG CG RU RU RU R/OG RU CG RU R/OG CG CGCG RU CG RU RU RAINBOW DR S DUNCAN AVE S JUPITER AVE GULF-TO-BAY BLVD S KEYSTONE DR DARTMOUTH ST YELVINGTON AVE S KEYSTONE AVE 501 509 301 401 212 108 112 314 302 110 105 309 219 507 200 201 407 407 405 305 300 310 308 515 403 109 208 305 210 401 405 216 204 400 404 311 511 404 106 211 400 215206 406 116 510 200 400 212 207 115 111 111 116 519 309 401 306 307 205 201 205 115112 215 402 209 301 211 311 514 204 216 403 115 1712166416281616166417151672168016611660162716231624161217241631164016571660163016321668161317011673166016751650164916301709162616171635164717001632169816701700166316131656166916511637167416411623162116221632160816221620162516161644166516201624162916501654161416441658165516381636300 104100105 161216101713162817171618163416141625A1623A1621A1627A-Not to Scale--Not a Survey-Rev. 11/16/17 CG FUTURE LAND USE MAP Owner(s): Rental Houses, LLC Case: LUP2017-10011 REZ2017-10012 Site: 300 South Duncan Avenue Property Size(Acres): 2.807 acres Land Use Zoning PIN: 14-29-15-00000-130-0200 From: Residential/Office General (R/OG) Office (O) To: Commercial General (CG) Commercial (C) Atlas Page: 288B PLANNING & DEVELOPMENT DEPARTMENT COMMUNITY DEVELOPMENT BOARD STAFF REPORT MEETING DATE: December 19, 2017 AGENDA ITEM: H.5. CASE: LUP2017-10011 REQUEST: To amend the Future Land Use Map designation from Residential/Office General (R/OG) to Commercial General (CG) GENERAL DATA: Applicant ......................... Brian J. Aungst, Jr., Esq. Owner ............................. Rental Houses, LLC Location .......................... 300 South Duncan Avenue, located on the west side of South Duncan Avenue approximately 280 feet north of Gulf to Bay Boulevard Property Size ................... 2.807-acre portion of a 3.196-acre property Background: This case involves 2.807 acres of a 3.196-acre parcel located on the west side of South Duncan Avenue, approximately 280 feet north of Gulf to Bay Boulevard (SR 60). The property is owned by Rental Houses, LLC and is occupied by a three-story, 69,000 square foot office building with ancillary off-street parking. The overall parcel is a flag lot, where the proposed amendment area has frontage on South Duncan Avenue (310 feet) and Rainbow Drive (396 feet). A narrow portion of the parcel extends to Gulf to Bay Boulevard (60 feet of frontage), approximately 345 feet west of South Duncan Avenue, providing access to the office (excluded from the proposed amendment). Maps 1 and 2 show the general location of the property and an aerial view of the amendment area. The existing office was constructed in 1976, and is over 88% leased. The building currently houses many targeted industries (i.e., Financial and Professional Services) including medical offices, attorneys, mortgage firms, real estate office, accounting offices and other professional businesses. Currently, there is 8,000 square feet of office space available, and the asking rent is $10 per square foot. A development proposal to demolish the existing office and replace it with a 76,490 square foot self-storage facility consisting of 700 units spread across four buildings on the proposed amendment area and an 875 square foot sales office located on the remainder of the parcel has been submitted for review (continued case FLD2017-09018). The proposed self- storage use is not allowed within the property’s current zoning district. The request is to change the Future Land Use Map designation of the proposed amendment area from Residential/Office General (R/OG) to Commercial General (CG), thereby establishing a uniform future land use designation across the parcel. A Community Development Board –December 19, 2017 Revised for City Council Meeting – January 18, 2018 LUP2017-10011 - Page 2 of 11 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION request to rezone the proposed amendment area from the Office (O) District to the Commercial (C) District is being processed concurrently with this case (see REZ2017-10012). Map 1 Map 2 Vicinity Characteristics: Map 3 shows the existing surrounding uses. The immediate area to the north across Rainbow Drive is developed with single-family houses. Abutting to the south is an office (Synovus Bank) and an automobile service station (Thorntons). The area to the east consists of offices, as well as attached dwellings and a single-family detached dwelling. The area to the west is a mixture of office and medical clinic uses. Community Development Board –December 19, 2017 Revised for City Council Meeting – January 18, 2018 LUP2017-10011 - Page 3 of 11 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Map 3 As shown on Map 4, the abutting future land use designations are Residential/Office General (R/OG) to the west and Commercial General (CG) to the south. To the north, across Rainbow Drive, is Residential Urban (RU) and to the east, across South Duncan Avenue, is Commercial General (CG). The surrounding vicinity has additional areas designated Residential Urban (RU) along the north and south sides of Rainbow Drive, and a mix of Residential/Office General (R/OG) and Commercial General (CG) along the south side of Rainbow Drive. A comparison between the uses, densities and intensities allowed by the present and proposed Future Land Use Map designations appears in Table 1, along with the consistent zoning districts. Map 4 Map 5 Community Development Board –December 19, 2017 Revised for City Council Meeting – January 18, 2018 LUP2017-10011 - Page 4 of 11 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Table 1. Uses, Densities and Intensities Allowed by Present and Proposed Future Land Use Designations Present FLUM Designation Residential/Office General (R/OG)Requested FLUM Designation Commercial General (CG) Primary Uses: Medium Density Residential; Residential Equivalent; Office Office; Retail Sales and Service; Overnight Accommodations Maximum Density: 15 Dwelling Units Per Acre 24 Dwelling Units Per Acre; 40 Overnight Accommodation Units Per Acre Maximum Intensity: FAR 0.50; ISR 0.75 FAR 0.55; ISR 0.90 Consistent Zoning Districts: Medium Density Residential (MDR) Office (O) Commercial (C) REVIEW CRITERIA: Consistency with the Clearwater Comprehensive Plan [Sections 4-603.F.1 and 4-603.F.2] Recommended Findings of Fact: The following goal, objectives and policies of the Clearwater Comprehensive Plan are not supportive of the proposed amendment: Goal A.2 A sufficient variety and amount of future land use categories shall be provided to accommodate public demand and promote infill development. Objective A.2.2 Future Land Use in the City of Clearwater shall be guided by the City’s Future Land Use Map, which shall be consistent with the Countywide Plan for Pinellas County (The Countywide Plan) including the Countywide Plan Map, and shall be implemented through the City’s Community Development Code. Policy A.5.5.1 Development should be designed to maintain and support the existing or envisioned character of the neighborhood. Objective A.6.1 The redevelopment of blighted, substandard, inefficient and/or obsolete areas shall be a high priority and promoted through the implementation of redevelopment and special area plans, the construction of catalytic private projects, city investment, and continued emphasis on property maintenance standards. Policy A.6.1.6 Land use decisions in Clearwater shall support the expansion of economic opportunity, the creation of jobs and training opportunities as well as the maintenance of existing industries through establishment of enterprise zones, activity centers and redevelopment areas and by coordination with the Chamber of Commerce, Tourist Development Council and other economic development organizations and agencies. Policy A.6.2.2 Encourage land use conversions on economically underutilized parcels and corridors, and promote redevelopment activities in these areas. As stated in the introduction to the City’s Comprehensive Plan Future Land Use Element, the Goals, Objectives and Policies provide for sustainable redevelopment and infill development, as well as Community Development Board –December 19, 2017 Revised for City Council Meeting – January 18, 2018 LUP2017-10011 - Page 5 of 11 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION neighborhood preservation, and are “… designed to preserve and enhance community character and quality of life, while ensuring continued economic vitality of the community.” The Future Land Use Map depicts spatially where certain types of development are envisioned to occur. While the Community Development Code provides a path for individual property owners to request amendments to the Future Land Use Map, review of such requests must consider the achievement of the City’s Goals on balance. In 2011, the City's Economic Development and Housing Department engaged TIP Strategies, Inc. to develop an Economic Development Strategic Plan to position Clearwater for future sustainable growth and economic prosperity. The Strategic Plan seeks to ensure long-term economic vitality through the guiding principles of tax base diversification, higher paying jobs, and business vitality. The City is committed to preserving land for targeted industries, and encourages the development of sites and buildings needed to accommodate higher intensity employment opportunities, consistent with the goals of the Economic Development Strategic Plan. Attracting target industries and higher wage jobs guide future economic development programs and activities in Clearwater. To attract target industries and accommodate higher-wage jobs, the City should more fully leverage existing sites for redevelopment. This site is considered a strategic location for office uses, given its proximity to the Downtown and SR 60. The subject property is designated Residential/Office General (R/OG), consistent with its current use as a multi-tenant office, and consistent with the properties to the west of the property on the south side of Rainbow Drive. The existing office is currently 88% leased, and many of the existing tenants are within targeted industries. According to the City’s Economic Development and Housing Department, the site is well-suited for continued office use, consistent with the City’s Economic Development Strategic Plan. Much of redevelopment is facilitated by removal of economically underutilized properties; however, the subject property is not economically underutilized, and the proposed use for the site as a self-storage use is the opposite of an office use. The existing office is a viable use, is not blighted or obsolete. Amending the future land use designation on the proposed amendment area would be inconsistent with Policy A.6.1.6 as it would permit redevelopment that does not expand economic opportunities or create jobs. Self-storage facilities of this size often have fewer than five employees, including part time employees. Such an amendment is also inconsistent with Policy A.6.2.2 as the site is not economically underutilized. Additionally, the current mix of future land use categories is sufficient in this area to support the envisioned character of the properties along Rainbow Drive and South Duncan Avenue, the primary frontages on which the subject site is located. The Residential/Office General (R/OG) future land use category that is found on the south side of Rainbow Drive, west of South Duncan Avenue, is consistent with both Office (O) District and Medium Density Residential (MDR) District, both of which permit uses that are in character with the single family residential neighborhood to the north of the property. Staff recognizes that that over time, uses may change, but the uses allowed through either of the consistent zoning districts are appropriate and in character with the surrounding residential development. Maintaining the subject property as Residential/Office General (R/OG) is consistent with Goal A.2, in that there is already a sufficient variety and amount of future land use categories within this general area promote infill development and there is not a need to add commercially designated property within this area. South Duncan Avenue forms the line of demarcation between the area envisioned to remain office to the west, and the area already designated as Commercial General (CG) to the east. Within the Commercial General (CG) area, there are many underutilized properties, including vacant parcels and closed businesses in one-story Community Development Board –December 19, 2017 Revised for City Council Meeting – January 18, 2018 LUP2017-10011 - Page 6 of 11 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION buildings, that are envisioned to transition over time, consistent with the future land use designation in place. Commercial General (CG) is generally designated the length of Gulf to Bay Boulevard, and in most areas, is only applied to parcels with frontage on Gulf to Bay Boulevard and those abutting, or generally within the first 280 feet from the right-of-way. There are limited other areas, including the three blocks east of the proposed amendment area, where the entire block north to Rainbow Drive is all Commercial General (CG). However, these areas are more typically limited to the intersections of two arterials where there are larger parcels and the Commercial General (CG) future land use designation extends further north and south of Gulf to Bay. Recommended Conclusions of Law: The request is inconsistent with the goals, objectives and policies of the Clearwater Comprehensive Plan and conflicts said plan as indicated in the goals, objectives and policies listed above. The proposed change does not support the City’s stated economic development goals and objectives. Consistency with the Countywide Rules Recommended Findings of Fact: The underlying Countywide Plan Map category on the proposed amendment area is Office (O), which is on the edge of two districts found on the south side of Rainbow Drive, with South Duncan Avenue currently serving as the dividing line between the two areas. Section 2.3.3.5 of the Countywide Rules states that the current Office (O) category is intended to accommodate areas developed, or appropriate to be developed, with office uses, low-impact employment uses, and residential uses (subject to a five-acre maximum threshold), in areas characterized by a transition between residential and commercial uses and in areas well-suited for community-scale residential/office mixed-use development. The proposed City of Clearwater future land use designation of Commercial General (CG) will necessitate an amendment from the Office (O) category to the Retail & Services (R&S) category to maintain consistency between the City’s Future Land Use Map and the Countywide Plan Map. Section 2.3.3.7 of the Countywide Rules states that the Retail & Services (R&S) category is intended to depict areas developed with, or appropriate to be developed with, a mix of businesses that provide for the shopping and personal service needs of the community or region, provide for employment opportunities and accommodate target employment uses, and may include residential uses as part of the mix of uses. The proposed amendment area, which constitutes the majority of the parcel on which the proposed self-storage use would be located, is located across the Rainbow Drive right-of-way from single family homes to the north, and to other office and medical clinic uses to the west. Office (O) category is designated on the surrounding properties adjacent and to the west, and Retail & Services (R&S) is designated on properties to the south along Gulf to Bay Boulevard, and east across South Duncan Avenue. Property along the north side of Rainbow Drive is designated Residential Low Medium (RLM). Although the proposed Retail & Services (R&S) category is intended for a mix of employment, including targeted industries, it is also intended for other commercial uses, and is more typically developed with retail commercial (e.g., grocery, pharmacy, apparel, jewelry, electronics, sporting goods, specialty shops, building supplies, convenience goods, restaurant, indoor recreation/entertainment uses). While this category is partially consistent with the City’s vision for this area, in that the City wants to maintain the property for office/targeted industries, the proposed self-storage use is not a target employment use. Additionally, the other uses that are consistent with this category are not appropriate in this area. Community Development Board –December 19, 2017 Revised for City Council Meeting – January 18, 2018 LUP2017-10011 - Page 7 of 11 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION The existing office building is an appropriate use in the area and is consistent with the current underlying Countywide Plan Map category and the designations on the surrounding properties. It is also consistent with the City’s Comprehensive Plan, as outlined above. The Countywide Plan Map currently uses South Duncan Avenue as the dividing line between the two categories, which is appropriate in this area, and the area currently designated with the Office (O) category appropriately serves as a transition between the commercial uses along Gulf to Bay to the south and east and the residential uses to the north and west. Recommended Conclusions of Law: While the proposed Future Land Use Map amendment is consistent with the purpose of the proposed category in the Countywide Rules it is inconsistent with the designations on the surrounding properties. The existing category in the Countywide Rules is appropriately designated and is consistent with the current use and surrounding designations on the Countywide Plan Map. Compatibility with Surrounding Properties/Character of the City & Neighborhood [Section 4-603.F.3 and Section 4-603.F.6] Recommended Findings of Fact: Existing surrounding uses consist primarily of single family residential (detached dwellings) (north) and offices and medical clinics (west and south). There is an assortment of offices and residential (attached dwellings) to the east, across South Duncan Avenue, and a gas station (south). The proposed use of the subject property is self-storage. The proposed Commercial General (CG) future land use category primarily permits nonresidential development at an intensity of 0.55 FAR. Residential development is permitted at a density of 24 dwelling units per acre (allowed through mixed-use), and overnight accommodations are permitted at 40 overnight accommodation units per acre. The future land use designations of surrounding properties include Residential Urban (RU), Residential Office/General (R/OG) and Commercial General (CG). The proposed Commercial General (CG) future land use category is consistent with the Commercial (C) zoning district, which permits a variety of commercial uses as minimum standard uses, including retail plazas, restaurants, offices, overnight accommodations, and vehicle sales/display. The proposed category and district do not appear to be appropriately located. While certain permitted uses may be compatible with the single-family uses in the area, these same uses are also already permitted through the existing Office (O) District. The request is not compatible with the surrounding area and may unreasonably affect the use of the properties in the area. Recommended Conclusions of Law: The proposed Commercial General (CG) future land use category is not in character with the Future Land Use Map designations in the area. Further, the proposal is incompatible with surrounding uses and inconsistent with the character of the surrounding properties and neighborhood. Community Development Board –December 19, 2017 Revised for City Council Meeting – January 18, 2018 LUP2017-10011 - Page 8 of 11 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Sufficiency of Public Facilities [Section 4-603.F.4] Recommended Findings of Fact: To assess the sufficiency of public facilities needed to support potential development on the proposed amendment area, the maximum development potential of the property under the present and requested City Future Land Use Map designations were analyzed. Table 2. Development Potential for Existing & Proposed FLUM Designations Present FLUM Designation “R/OG” Requested FLUM Designation “CG” Net Change Site Area 2.807 AC (122,272 SF) 2.807 AC (122,272 SF) Maximum Development Potential 42 DUs1 61,136 SF 0.50 FAR 67 DUs2 67,249 SF 0.55 FAR 25 DUs 6,113 SF 0.15 FAR Notes: 1. Residential uses permitted through consistent Office (O) District as part of mixed-use project. 2. Residential uses permitted through consistent Commercial (C) District as part of mixed-use project, or potentially through a Comprehensive Infill Redevelopment Project. Abbreviations: FLUM – Future Land Use Map DUs –Dwelling Units AC – Acres FAR –Floor Area Ratio SF – Square feet As shown in the table, there is an increase in development potential across the amendment area which would increase demand on most public facilities, but would not degrade them below acceptable levels as detailed below. The following analysis compares the maximum potential development of the proposed Commercial General (CG) future land use developed with a self-storage use (67,249 square feet) to the maximum development potential of the existing Residential/Office General (R/OG) future land use category developed with an office use (61,136 square feet). Potable Water The increase in development potential from this amendment would result in an increase in potable water use of 612 gallons per day. This is determined by comparing the potential potable water utilization of the maximum square footage allowed by the proposed land use developed with a nonresidential use (6,725 gallons per day) to the potential utilization of a nonresidential use built out to the maximum square footage allowed by the current land use designation (6,113 gallons per day). Wastewater The increase in development potential from this amendment would also result in an increase in wastewater production of 489 gallons per day. This is determined by comparing the potential wastewater generation of the proposed land use developed with a nonresidential use (5,379 gallons) to the potential wastewater generation of the current land use designation developed with a nonresidential use (4,890 gallons). Community Development Board –December 19, 2017 Revised for City Council Meeting – January 18, 2018 LUP2017-10011 - Page 9 of 11 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Solid Waste The proposed amendment could result in an increase of 70.3 tons per year of solid waste generated when comparing the amount of waste generated by a warehouse use to that of an office use. All solid waste disposal is handled by Pinellas County at the Pinellas County Waste-to-Energy Plant and the Bridgeway Acres Sanitary Landfill which has significant capacity. Additionally, the City provides a full-service citywide recycling program which diverts waste from the landfill, helping to extend the lifespan of Bridgeway Acres. There is excess solid waste capacity to serve the amendment area. Parkland The City’s adopted LOS for parkland acreage, which is 4 acres per 1,000 population, will not be impacted by this proposed amendment. Under both the existing and proposed land use, the LOS citywide will remain at 15.46 acres per 1,000 population. Stormwater Site plan approval will be required before the property can be redeveloped. At that time, the stormwater management system for the site will be required to meet all City and SWFWMD stormwater management criteria. Streets The subject property is located at the southwest side corner of South Duncan Avenue and Rainbow Avenue, approximately 280 feet north of Gulf to Bay Boulevard. To evaluate potential impacts to streets, the typical traffic impacts figure (trips per day per acre) in the Countywide Rules for the corresponding Countywide Plan Map categories (current and proposed) are compared. The current number of trips per day (250 trips) is calculated based on the typical traffic generation numbers for the Office (O) category (89 trips per day per acre). The proposed Countywide Plan Map category of Retail & Service (R&S) (433 trips per day per acre) would increase the number of trips per day to 1,215 trips per day. This is an increase of 965 trips per day compared to the number of trips under the current designation. The proposed self-storage use, if constructed, would generate fewer trips overall; however, evaluations of potential impacts are based on the maximum impacts possible through the proposed future land use changes. Recommended Conclusions of Law: Based upon the findings of fact, it is determined that although the proposed change will result in increased demand on many public facilities, it will not result in the degradation of the existing levels of service for potable water, sanitary sewer, solid waste, parkland, stormwater management and streets. Impact on Natural Resources [Section 4-603.F.5] Recommended Findings of Fact: No wetlands appear to be located on the subject property. The City’s codes require that development is compliant with the City’s tree preservation, landscaping and stormwater management requirements. Community Development Board –December 19, 2017 Revised for City Council Meeting – January 18, 2018 LUP2017-10011 - Page 10 of 11 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION The City’s codes require that development is compliant with the City’s tree preservation, landscaping and stormwater management requirements. Recommended Conclusions of Law: Based upon the findings of fact, it is determined that the proposed Future Land Use Map amendment will not negatively impact natural resources on the subject property. SUMMARY AND RECOMMENDATION: No amendment to the Comprehensive Plan or Future Land Use Map shall be recommended for approval or receive a final action of approval unless it complies with the standards contained in Section 4-603.F, Community Development Code. Table 3 below depicts the consistency of the proposed amendment with the standards pursuant to Section 4-603.F: Table 3. Consistency with Community Development Code Standards for Review CDC Section 4-603 Standard Consistent Inconsistent F.1 The amendment will further implementation of the Comprehensive Plan consistent with the goals, policies and objectives contained in the Plan. X F.2 The amendment is not inconsistent with other provisions of the Comprehensive Plan. X F.3 The available uses, if applicable, to which the properties may be put are appropriate to the properties in question and compatible with existing and planned uses in the area. X F.4 Sufficient public facilities are available to serve the properties. X F.5 The amendment will not adversely affect the natural environment. X F.6 The amendment will not adversely impact the use of properties in the immediate area. X The proposed use is inconsistent with certain goals and objectives of the Comprehensive Plan. The proposed use is inconsistent with the City’s strategic economic development plan. The property is not economically underutilized. The existing use of the property constitutes a higher level of viable economic use. The transition of properties along the Gulf to Bay Boulevard corridor to storage and warehousing does not constitute a preferred or desirable characteristic of this corridor. Large parcels with limited to no impacts as the result of constrained or limited employment and little or no traffic or trip generation resulting from lack of economic activity are not inherently advantageous or compatible with adjoining communities. To the contrary, such uses and activities lend themselves more appropriately to areas more suitable for limited commercial, employment, and transportation constraints. Community Development Board –December 19, 2017 Revised for City Council Meeting – January 18, 2018 LUP2017-10011 - Page 11 of 11 Level III Comprehensive Plan Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Based on the foregoing, the Planning and Development Department recommends the following action: Recommend DENIAL of the Future Land Use Map Amendment designation from Residential/Office General (R/OG) to Commercial General (CG). Prepared by Planning and Development Department Staff: Lauren Matzke, AICP Long Range Planning Manager ATTACHMENTS: Ordinance No. 9101-18 Resume Photographs of Site and Vicinity LUP2017-10011 / REZ2017-10012 Rental Houses, LLC 300 South Duncan Avenue Page 1 of 2 View looking west at the subject property, 300 South Duncan Avenue, from South Duncan Avenue East of the subject property, across South Duncan Avenue View looking southwesterly at the subject property, 300 South Duncan Avenue, from Rainbow Drive North of the subject property, across Rainbow Drive View looking easterly along Rainbow Drive View looking westerly along Rainbow Drive LUP2017-10011 / REZ2017-10012 Rental Houses, LLC 300 South Duncan Avenue Page 2 of 2 View looking northerly along South Duncan Avenue View looking southerly along South Duncan Avenue 1 Call, Rosemarie From:Marino Kolitsopoulos <marino@advancedrealtygroupinc.com> Sent:Friday, January 12, 2018 5:17 PMTo:Matzke, Lauren; Kuligowski, Patricia; Call, RosemarieSubject:RE: 300 S. Duncan LUP-2017-10011 and REZ-2017-10012 Excellent, please add my letter to the record and present it to the Council when appropriate. Thank you. From: Matzke, Lauren [mailto:Lauren.Matzke@MyClearwater.com] Sent: Friday, January 12, 2018 9:12 AM To: Marino Kolitsopoulos; Kuligowski, Patricia; Call, Rosemarie Cc: Soto, Camilo Subject: RE: 300 S. Duncan LUP-2017-10011 and REZ-2017-10012 Thank you for the email. Please note that the applicant has requested that these cases be continued to the April 4, 2018 City Council meeting. From: Marino Kolitsopoulos [mailto:marino@advancedrealtygroupinc.com] Sent: Thursday, January 11, 2018 4:58 PM To: Kuligowski, Patricia <patty.kuligowski@myclearwater.com>; Call, Rosemarie <Rosemarie.Call@myClearwater.com>; Matzke, Lauren <Lauren.Matzke@MyClearwater.com> Cc: Soto, Camilo <Camilo.Soto@MyClearwater.com> Subject: 300 S. Duncan LUP‐2017‐10011 and REZ‐2017‐10012 To Whom It May Concern, My name is Marino Kolitsopoulos and my company, 1250 Main LLC, owns the property located at 1712 Gulf to Bay Blvd. Recently, I was sent notice from the City that a property in the neighborhood located at 300 S. Duncan has been attempting to rezone to a Commercial zoning. I believe that this rezoning request is quite logical and brings a level of symmetry to the zoning map that it is currently lacking. My block for instance is exactly east of the area in question and has commercial zoning from Gulf to Bay all the way to Rainbow. Why should their block be zoned and treated any differently? Also, I believe that what Mr. Dorman and his group are doing will be a great improvement to the neighborhood. Currently 300 S. Duncan is an undesirable office structure that lacks the traffic and commercial frontage that is needed for a viable office complex today. Given the location of this property, it would seem that a use like storage would directly benefit the neighborhood more than an office complex; and may be the best use for this site. As it is now the 21st Century and technology has forced the office into our homes, automobiles, and pockets, the need for office space for smaller businesses is almost non‐existent. This is evidenced by the increasing number of office properties becoming run down and obsolete; just like this one. As technology continues to change our society, the need for local government to keep up and evolve to meet the municipal needs is paramount. Zoning will need to continue to evolve to serve the public properly and get beyond the idea of preserving a past that is no longer relevant. Respectfully, Marino Kolitsopoulos, CEO Advanced Realty Group, Inc. 2 2630 West Bay Drive Suite 105 Belleair Bluffs, FL 33770 727‐518‐8500 727‐518‐8553 fax 727‐418‐1773 direct Right-click or tap and hold here to download pictures. To help protect your privacy, Outlook prevented automatic download of this picture from the Internet. Virus-free. www.avg.com 1 Call, Rosemarie From:Matzke, Lauren Sent:Monday, January 15, 2018 1:45 PMTo:Call, RosemarieSubject:Fwd: 300 S Duncan/SkycrestAttachments:SKM_C25817121911070.pdf Sorry about that! I thought this had made it over earlier. Thanks for adding it! Get Outlook for iOS From: JoAnna Siskin <jsiskin@usameribank.com> Sent: Tuesday, December 19, 2017 10:09:19 AM To: Matzke, Lauren Subject: 300 S Duncan/Skycrest Lauren attached is the letter from Skycrest opposing the project at 300 S Duncan. JoAnna Siskin Retail Operations Coordinator 1617 Gulf to Bay Blvd Clearwater FL 33755 P: 727‐445‐6718 E: jsiskin@usameribank.com F: 727‐298‐0134 NOTICE: Pursuant to the Electronic Communications Privacy Act, 18 U.S.C. ?? 2510‐2522, the contents of this e‐mail and the attachments hereto (if any) are confidential, privileged, and/or otherwise exempt from disclosure and are intended only for disclosure to and use by the intended recipient of this message. If you are not the intended recipient of this message, the receipt of this message is not intended to and does not waive any applicable confidentiality or privilege and you are hereby notified that any dissemination, distribution, printing, or copying of the contents of this e‐mail is strictly prohibited. If you are not the intended recipient, please notify us by telephone or e‐mail and delete this e‐mail from your system. Further, e‐mail transmissions are not guaranteed to be secure or error‐free because information can be intercepted, corrupted, lost, destroyed, arrive late or incomplete, or contain viruses. WE THEREFORE EXPRESSLY DISCLAIM ANY REPRESENTATION OR WARRANTY REGARDING THE SAFETY AND INTEGRITY OF THIS E‐MAIL AND FOR ANY ERRORS OR OMISSIONS IN THE CONTENTS OF THIS E‐MAIL THAT ARISE AS A RESULT OF THIS TRANSMISSION OR ANY SUBSEQUENT RE‐TRANSMISSION Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: 9102-18 2nd rdg contd Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: OrdinanceIn Control: Legal Department Agenda Number: 10.10 SUBJECT/RECOMMENDATION: Continue second reading of Ordinance 9102-18 to April 19, 2018, relating to a Zoning Atlas Amendment from the Office (O) District to the Commercial (C) District for 300 South Duncan Avenue. SUMMARY: APPROPRIATION CODE AND AMOUNT: USE OF RESERVE FUNDS: Page 1 City of Clearwater Printed on 1/25/2018 Ordinance No. 9102-18 ORDINANCE NO. 9102-18 AN ORDINANCE OF THE CITY OF CLEARWATER, FLORIDA, AMENDING THE ZONING ATLAS OF THE CITY BY REZONING CERTAIN REAL PROPERTY LOCATED ON THE WEST SIDE OF SOUTH DUNCAN AVENUE APPROXIMATELY 280 FEET NORTH OF GULF TO BAY BOULEVARD, WHOSE POST OFFICE ADDRESS IS 300 SOUTH DUNCAN AVENUE, CLEARWATER, FLORIDA 33755, FROM OFFICE (O) TO COMMERCIAL (C); PROVIDING AN EFFECTIVE DATE. WHEREAS, the amendment to the Zoning Atlas of the City as set forth in this ordinance is found to be reasonable, proper and appropriate, and is consistent with the City's Comprehensive Plan; now, therefore, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF CLEARWATER, FLORIDA: Section 1. The following described property in Clearwater, Florida, is hereby rezoned, and the Zoning Atlas of the City is amended as follows: Property Zoning District See attached Exhibit A for Legal Description From: Office (O) (REZ2017-10012) To: Commercial (C) The map attached as Exhibit B is hereby incorporated by reference. Section 2. The City Engineer is directed to revise the Zoning Atlas of the City in accordance with the foregoing amendment. Section 3. This ordinance shall take effect immediately upon adoption, subject to the approval of the land use designation set forth in Ordinance 9101-18 by the Pinellas County Board of County Commissioners. Ordinance No. 9102-18 PASSED ON FIRST READING PASSED ON SECOND AND FINAL READING AND ADOPTED George N. Cretekos Mayor Approved as to form: Camilo A. Soto Assistant City Attorney Attest: Rosemarie Call City Clerk Exhibit “A” Legal Description Exhibit B ZONING MAP Owner(s): Rental Houses, LLC Case: LUP2017-10011 REZ2017-10012 Site: 300 South Duncan Avenue Property Size(Acres): 2.807 acres Land Use Zoning PIN: 14-29-15-00000-130-0200 From: Residential/Office General (R/OG) Office (O) To: Commercial General (CG) Commercial (C) Atlas Page: 288B C C LMDR O MDR RAINBOW DR S DUNCAN AVE S JUPITER AVE GULF-TO-BAY BLVD DARTMOUTH ST S KEYSTONE DR YELVINGTON AVE S KEYSTONE AVE 501 509 301 201 401 212 108 112 314 302 110 309 219 507 200 201 407 407 405 305 300 310 308 403 109 208 305 210 401 405 216 204 400 404 311 511 404 106 211 400 215206 406 116 510 200 400 212 207 115 111 111 116 309 401 306 307 205 201 205 115112 215 402 209 301 211 311 514 204 216 403 115 171216641628161616121664171516721680166016271623162416121724163116401660163016321668161317011673166016751650161016301709162616171635164717001632169816701700166316131656166916511637167416411623162116221632160816221620162516161665162016241629165016541614165816381636300 105 515 100 519 105 16611657164917131628171716181644163416441606165516141625A1623A1621A1627A-Not to Scale--Not a Survey-Rev. 11/16/17 C C LMDR C PLANNING & DEVELOPMENT DEPARTMENT COMMUNITY DEVELOPMENT BOARD STAFF REPORT MEETING DATE: December 19, 2017 AGENDA ITEM: H.6. CASE: REZ2017-10012 REQUEST: To amend the Zoning Atlas designation from Office (O) District to Commercial (C) District GENERAL DATA: Applicant ......................... Brian J. Aungst, Jr., Esq. Owner ............................. Rental Houses, LLC Location .......................... 300 South Duncan Avenue, located on the west side of South Duncan Avenue approximately 280 feet north of Gulf to Bay Boulevard Property Size ................... 2.807-acre portion of a 3.196-acre property Background: This case involves 2.807 acres of a 3.196-acre parcel located on the west side of South Duncan Avenue, approximately 280 feet north of Gulf to Bay Boulevard (SR 60). The property is owned by Rental Houses, LLC and is occupied by a three-story, 69,000 square foot office building with ancillary off-street parking. The overall parcel is a flag lot, where the proposed amendment area has frontage on South Duncan Avenue (310 feet) and Rainbow Drive (396 feet). A narrow portion of the parcel extends to Gulf to Bay Boulevard (60 feet of frontage), approximately 345 feet west of South Duncan Avenue, providing access to the office (excluded from the proposed amendment). Maps 1 and 2 show the general location of the property and an aerial view of the amendment area. The existing office was constructed in 1976, and is over 88% leased. The building currently houses many targeted industries (i.e., Financial and Professional Services) including medical offices, attorneys, mortgage firms, real estate office, accounting offices and other professional businesses. Currently, there is 8,000 square feet of office space available, and the asking rent is $10 per square foot. A development proposal to demolish the existing office and replace it with a 76,490 square foot self-storage facility consisting of 700 units spread across four buildings on the proposed amendment area and an 875 square foot sales office located on the remainder of the parcel has been submitted for review (continued case FLD2017-09018). The proposed self- storage use is not allowed within the property’s current zoning district. The request is to change the Zoning Atlas designation of the proposed amendment area from Office (O) to Commercial (C), thereby establishing a uniform future land use designation across the parcel. A request to amend the future land use category of Community Development Board – December 19, 2017 REZ2017-10012- Page 2 of 10 Level III Zoning Atlas Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION the proposed amendment area from the Residential/Office General (R/OG) category to the Commercial General (CG) category is being processed concurrently with this case (see LUP2017-10011). Map 1 Map 2 Vicinity Characteristics: Map 3 shows the existing surrounding uses. The immediate area to the north across Rainbow Drive is developed with single-family houses. Abutting to the south is an office (Synovus Bank) and an automobile service station (Thorntons). The area to the east consists of offices, as well as attached dwellings and a single-family detached dwelling. The area to the west is a mixture of office and medical clinic uses. Community Development Board – December 19, 2017 REZ2017-10012- Page 3 of 10 Level III Zoning Atlas Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Map 3 As shown on Map 5, the abutting Zoning Atlas designations are Office (O) District to the west and Commercial (C) to the south. To the north, across Rainbow Drive, is Low Medium Density Residential (LMDR) and to the east, across South Duncan Avenue, is Commercial (C). The surrounding vicinity has additional areas designated Low Medium Density Residential (LMDR) along the north and south sides of Rainbow Drive, and a mix of Office (O) and Commercial (C) along the south side of Rainbow Drive. Map 4 Map 5 Community Development Board – December 19, 2017 REZ2017-10012- Page 4 of 10 Level III Zoning Atlas Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION REVIEW CRITERIA: Consistency with the Clearwater Comprehensive Plan and Community Development Code and Regulations [Sections 4-602.F.1] Recommended Findings of Fact: The following objectives and policies of the Clearwater Comprehensive Plan are not supportive of the proposed amendment: Objective A.2.2 Future Land Use in the City of Clearwater shall be guided by the City’s Future Land Use Map, which shall be consistent with the Countywide Plan for Pinellas County (The Countywide Plan) including the Countywide Plan Map, and shall be implemented through the City’s Community Development Code. Policy A.5.5.1 Development should be designed to maintain and support the existing or envisioned character of the neighborhood. Objective A.6.1 The redevelopment of blighted, substandard, inefficient and/or obsolete areas shall be a high priority and promoted through the implementation of redevelopment and special area plans, the construction of catalytic private projects, city investment, and continued emphasis on property maintenance standards. Policy A.6.1.6 Land use decisions in Clearwater shall support the expansion of economic opportunity, the creation of jobs and training opportunities as well as the maintenance of existing industries through establishment of enterprise zones, activity centers and redevelopment areas and by coordination with the Chamber of Commerce, Tourist Development Council and other economic development organizations and agencies. Policy A.6.2.2 Encourage land use conversions on economically underutilized parcels and corridors, and promote redevelopment activities in these areas. Applicable sections of the Community Development Code which are not supportive of the proposed amendment: Division 10. Office District, Section 2-1101. Intent and Purpose. The intent and purpose of the Office "O" District is to provide the citizens of the City of Clearwater with convenient access to professional services and high quality jobs throughout the city without adversely impacting the integrity of residential neighborhoods, diminishing the scenic quality of the City of Clearwater or negatively impacting the safe and efficient movement of people and things within the City of Clearwater. Division 7. Commercial District, Section 2-701. Intent and Purpose. The intent and purpose of the Commercial District is to provide the citizens of the City of Clearwater with convenient access to goods and services throughout the city without adversely impacting the integrity of residential neighborhoods, diminishing the scenic quality of the city or negatively impacting the safe and efficient movement of people and things within the City of Clearwater. As stated in the introduction to the City’s Comprehensive Plan Future Land Use Element, the Goals, Objectives and Policies provide for sustainable redevelopment and infill development, as well as neighborhood preservation, and are “… designed to preserve and enhance community character and quality Community Development Board – December 19, 2017 REZ2017-10012- Page 5 of 10 Level III Zoning Atlas Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION of life, while ensuring continued economic vitality of the community.” The Future Land Use Map depicts spatially where certain types of development are envisioned to occur. While the Community Development Code provides a path for individual property owners to request amendments to the Future Land Use Map, review of such requests must consider the achievement of the City’s Goals on balance. In 2011, the City's Economic Development and Housing Department engaged TIP Strategies, Inc. to develop an Economic Development Strategic Plan to position Clearwater for future sustainable growth and economic prosperity. The Strategic Plan seeks to ensure long-term economic vitality through the guiding principles of tax base diversification, higher paying jobs, and business vitality. The City is committed to preserving land for targeted industries, and encourages the development of sites and buildings needed to accommodate higher intensity employment opportunities, consistent with the goals of the Economic Development Strategic Plan. Attracting target industries and higher wage jobs guide future economic development programs and activities in Clearwater. To attract target industries and accommodate higher-wage jobs, the City should more fully leverage existing sites for redevelopment. This site is considered a strategic location for office uses, given its proximity to the Downtown and SR 60. The subject property is designated Office (O), consistent with its current use as a multi-tenant office, and consistent with the properties to the west, on the south side of Rainbow Drive. The City’s Community Development Code establishes that the Office (O) District is the primary district in which high quality jobs and employment opportunities will be located, whereas the proposed Commercial (C) District is primarily focused on providing convenient access to goods and services, such as the retail uses and restaurants typically found within the Commercial (C) District. The Office (O) District is the appropriate zoning district for this property. The existing office is currently 88% leased, and many of the existing tenants are within targeted industries. According to the City’s Economic Development and Housing Department, the site is well-suited for continued office use, consistent with the City’s Economic Development Strategic Plan. Much of redevelopment is facilitated by removal of economically underutilized properties; however, the subject property is not economically underutilized, and the proposed use for the site as a self-storage use is the opposite of an office use. The existing office is a viable use, is not blighted or obsolete. Amending the zoning designation on the proposed amendment area would be inconsistent with Policy A.6.1.6 as it would permit redevelopment that does not expand economic opportunities or create jobs. Self-storage facilities of this size often have fewer than five employees, including part time employees. Such an amendment is also inconsistent with Policy A.6.2.2 as the site is not economically underutilized. The requested change to the Commercial (C) District requires an amendment to the Future Land Use Map as well to remain consistent. However, the current mix of future land use categories is sufficient in this area to support the envisioned character of the properties along Rainbow Drive and South Duncan Avenue, the primary frontages on which the subject site is located. The Residential/Office General (R/OG) future land use category that is found on the south side of Rainbow Drive, west of South Duncan Avenue, is consistent with both Office (O) District and Medium Density Residential (MDR) District, both of which permit uses that are in character with the single family residential neighborhood to the north of the property. Staff recognizes that that over time, uses may change, but the uses allowed through either of the consistent zoning districts are appropriate and in character with the surrounding residential development. Community Development Board – December 19, 2017 REZ2017-10012- Page 6 of 10 Level III Zoning Atlas Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION South Duncan Avenue forms the line of demarcation between the area envisioned to remain Office (O) District to the west, and the area already designated as Commercial (C) District to the east. Within the area designated Commercial (C) District, there are many underutilized properties, including vacant parcels and closed businesses in one-story buildings, that are envisioned to transition over time, consistent with the zoning designation in place. Commercial (C) District is generally designated the length of Gulf to Bay Boulevard, and in most areas, is only applied to parcels with frontage on Gulf to Bay Boulevard and those abutting, or generally within the first 280 feet from the right-of-way. There are limited other areas, including the three blocks east of the proposed amendment area, where the entire block north to Rainbow Drive is all Commercial (C) District. However, these areas are more typically limited to the intersections of two arterials where there are larger parcels and the Commercial (C) District extends further north and south of Gulf to Bay. Recommended Conclusions of Law: The request is inconsistent with the goals, objectives and policies of the Clearwater Comprehensive Plan and conflicts with said plan and the Community Development Code as indicated above. The proposed change does not support the City’s stated economic development goals and objectives. Compatibility with Surrounding Property/Character of the City & Neighborhood [Section 4-602.F.2, 4-602.F.3 and Section 4-602.F.4] Recommended Findings of Fact: Existing surrounding uses consist primarily of single family residential (detached dwellings) (north) and offices and medical clinics (west and south). There is an assortment of offices and residential (attached dwellings) to the east, across South Duncan Avenue, and a gas station (south). The proposed use of the subject property is self-storage. The proposed Commercial (C) zoning district is inconsistent with many of the surrounding zoning districts that exist in the vicinity of the subject property. The Commercial (C) zoning district permits a variety of commercial uses as minimum standard uses, including retail plazas, restaurants, offices, overnight accommodations, and vehicle sales/display. The proposed District does not appear to be appropriately located. While certain permitted uses may be compatible with the single-family uses in the area, these same uses are also already permitted through the existing Office (O) District. The request is not compatible with the surrounding area and may unreasonably affect the use of the properties in the area. Recommended Conclusions of Law: The proposed Commercial (C) zoning district is not in character with the zoning districts in the area. Further, the proposal is incompatible with surrounding uses and inconsistent with the character of the surrounding properties and neighborhood. Sufficiency of Public Facilities [Section 4-602.F.5] Recommended Findings of Fact: To assess the sufficiency of public facilities needed to support potential development on the proposed amendment area, the maximum development potential of the property under the present and requested City Community Development Board – December 19, 2017 REZ2017-10012- Page 7 of 10 Level III Zoning Atlas Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Future Land Use Map designations were analyzed (see Table 1). Even though this is a Zoning Atlas amendment application, maximum development potential is based on the underlying future land use, so for purposes of this analysis sufficiency of public facilities is based on the future land use map designation. Table 1. Development Potential for Existing & Proposed FLUM Designations Present FLUM Designation “R/OG” Requested FLUM Designation “CG” Net Change Site Area 2.807 AC (122,272 SF) 2.807 AC (122,272 SF) Maximum Development Potential 42 DUs1 61,136 SF 0.50 FAR 67 DUs2 67,249 SF 0.55 FAR 25 DUs 6,113 SF 0.15 FAR Notes: 1. Residential uses permitted through consistent Office (O) District as part of mixed-use project. 2. Residential uses permitted through consistent Commercial (C) District as part of mixed-use project, or potentially through a Comprehensive Infill Redevelopment Project. Abbreviations: FLUM – Future Land Use Map DUs –Dwelling UnitsAC – Acres FAR –Floor Area Ratio SF – Square feet As shown in the table, there is an increase in development potential across the amendment area which would increase demand on most public facilities, but would not degrade them below acceptable levels as detailed below. The following analysis compares the maximum potential development of the proposed Commercial General (CG) future land use developed with a self-storage use (67,249 square feet) to the maximum development potential of the existing Residential/Office General (R/OG) future land use category developed with an office use (61,136 square feet). Potable Water The increase in development potential from this amendment would result in an increase in potable water use of 612 gallons per day. This is determined by comparing the potential potable water utilization of the maximum square footage allowed by the proposed land use developed with a nonresidential use (6,725 gallons per day) to the potential utilization of a nonresidential use built out to the maximum square footage allowed by the current land use designation (6,113 gallons per day). Wastewater The increase in development potential from this amendment would also result in an increase in wastewater production of 489 gallons per day. This is determined by comparing the potential wastewater generation of the proposed land use developed with a nonresidential use (5,379 gallons) to the potential wastewater generation of the current land use designation developed with a nonresidential use (4,890 gallons). Community Development Board – December 19, 2017 REZ2017-10012- Page 8 of 10 Level III Zoning Atlas Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Solid Waste The proposed amendment could result in an increase of 70.3 tons per year of solid waste generated when comparing the amount of waste generated by a warehouse use to that of an office use. All solid waste disposal is handled by Pinellas County at the Pinellas County Waste-to-Energy Plant and the Bridgeway Acres Sanitary Landfill which has significant capacity. Additionally, the City provides a full-service citywide recycling program which diverts waste from the landfill, helping to extend the lifespan of Bridgeway Acres. There is excess solid waste capacity to serve the amendment area. Parkland The City’s adopted LOS for parkland acreage, which is 4 acres per 1,000 population, will not be impacted by this proposed amendment. Under both the existing and proposed land use, the LOS citywide will remain at 15.46 acres per 1,000 population. Stormwater Site plan approval will be required before the property can be redeveloped. At that time, the stormwater management system for the site will be required to meet all City and SWFWMD stormwater management criteria. Streets The subject property is located at the southwest side corner of South Duncan Avenue and Rainbow Avenue, approximately 280 feet north of Gulf to Bay Boulevard. To evaluate potential impacts to streets, the typical traffic impacts figure (trips per day per acre) in the Countywide Rules for the corresponding Countywide Plan Map categories (current and proposed) are compared. The current number of trips per day (250 trips) is calculated based on the typical traffic generation numbers for the Office (O) category (89 trips per day per acre). The proposed Countywide Plan Map category of Retail & Service (R&S) (433 trips per day per acre) would increase the number of trips per day to 1,215 trips per day. This is an increase of 965 trips per day compared to the number of trips under the current designation. The proposed self-storage use, if constructed, would generate fewer trips overall; however, evaluations of potential impacts are based on the maximum impacts possible through the proposed future land use changes. Recommended Conclusions of Law: Based upon the findings of fact, it is determined that although the proposed change will result in increased demand on many public facilities, it will not result in the degradation of the existing levels of service for potable water, sanitary sewer, solid waste, parkland, stormwater management and streets. Community Development Board – December 19, 2017 REZ2017-10012- Page 9 of 10 Level III Zoning Atlas Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION Location of District Boundaries [Section 4-602.F.6] Recommended Findings of Fact: Although the proposed location for the Commercial (C) District is consistent with the ownership lines for the parcel and would consolidate the subject property into a single zoning district, the proposed rezoning would result in the expansion of the Commercial (C) District across South Duncan Avenue. South Duncan Avenue is an appropriate street to continue to serve as the line of demarcation between the existing Office (O) District on the west side of street and the Commercial (C) District on the east side of the street. Recommended Conclusions of Law: The District boundaries are appropriately drawn regarding ownership lines, existing improvements and the natural environment. However, the District boundaries are inappropriately drawn regarding location and classifications of streets. SUMMARY AND RECOMMENDATION: No amendment to the Zoning Atlas shall be recommended for approval or receive a final action of approval unless it complies with the standards contained in Section 4-602.F, Community Development Code. Table 2 below depicts the consistency of the proposed amendment with the standards pursuant to Section 4-602.F: Table 2. Consistency with Community Development Code Standards for Review CDC Section 4-602 Standard Consistent Inconsistent F.1 The proposed amendment is consistent with and features the goals, policies and objectives of the Comprehensive Plan and furthers the purposes of this Development Code and other city ordinances and actions designed to implement the plan. X F.2 The available uses to which the property may be put are appropriate to the property which is subject to the proposed amendment and compatible with existing and planned uses in the area. X F.3 The amendment does not conflict with the needs and character of the neighborhood and the city. X F.4 The amendment will not adversely or unreasonably affect the use of other property in the area. X F.5 The amendment will not adversely burden public facilities, including the traffic-carrying capacities of streets, in an unreasonably or disproportionate manner. X F.6 The district boundaries are appropriately drawn with due regard to locations and classifications of streets, ownership lines, existing improvements and the natural environment. X Community Development Board – December 19, 2017 REZ2017-10012- Page 10 of 10 Level III Zoning Atlas Amendment Review PLANNING & DEVELOPMENT LONG RANGE PLANNING DIVISION The proposed use is inconsistent with certain goals and objectives of the Comprehensive Plan. The proposed use is inconsistent with the City’s strategic economic development plan. The property is not economically underutilized. The existing use of the property constitutes a higher level of viable economic use. The transition of properties along the Gulf to Bay Boulevard corridor to storage and warehousing does not constitute a preferred or desirable characteristic of this corridor. Large parcels with limited to no impacts as the result of constrained or limited employment and little or no traffic or trip generation resulting from lack of economic activity are not inherently advantageous or compatible with adjoining communities. To the contrary, such uses and activities lend themselves more appropriately to areas more suitable for limited commercial, employment, and transportation constraints. Based on the foregoing, the Planning and Development Department recommends the following action: Recommend DENIAL of the Zoning Atlas amendment from Office (O) District to Commercial (C) District. Prepared by Planning and Development Department Staff: Lauren Matzke, AICP Long Range Planning Manager ATTACHMENTS: Ordinance No. 9102-18 Resume Photographs of Site and Vicinity LUP2017-10011 / REZ2017-10012 Rental Houses, LLC 300 South Duncan Avenue Page 1 of 2 View looking west at the subject property, 300 South Duncan Avenue, from South Duncan Avenue East of the subject property, across South Duncan Avenue View looking southwesterly at the subject property, 300 South Duncan Avenue, from Rainbow Drive North of the subject property, across Rainbow Drive View looking easterly along Rainbow Drive View looking westerly along Rainbow Drive LUP2017-10011 / REZ2017-10012 Rental Houses, LLC 300 South Duncan Avenue Page 2 of 2 View looking northerly along South Duncan Avenue View looking southerly along South Duncan Avenue 1 Call, Rosemarie From:Marino Kolitsopoulos <marino@advancedrealtygroupinc.com> Sent:Friday, January 12, 2018 5:17 PMTo:Matzke, Lauren; Kuligowski, Patricia; Call, RosemarieSubject:RE: 300 S. Duncan LUP-2017-10011 and REZ-2017-10012 Excellent, please add my letter to the record and present it to the Council when appropriate. Thank you. From: Matzke, Lauren [mailto:Lauren.Matzke@MyClearwater.com] Sent: Friday, January 12, 2018 9:12 AM To: Marino Kolitsopoulos; Kuligowski, Patricia; Call, Rosemarie Cc: Soto, Camilo Subject: RE: 300 S. Duncan LUP-2017-10011 and REZ-2017-10012 Thank you for the email. Please note that the applicant has requested that these cases be continued to the April 4, 2018 City Council meeting. From: Marino Kolitsopoulos [mailto:marino@advancedrealtygroupinc.com] Sent: Thursday, January 11, 2018 4:58 PM To: Kuligowski, Patricia <patty.kuligowski@myclearwater.com>; Call, Rosemarie <Rosemarie.Call@myClearwater.com>; Matzke, Lauren <Lauren.Matzke@MyClearwater.com> Cc: Soto, Camilo <Camilo.Soto@MyClearwater.com> Subject: 300 S. Duncan LUP‐2017‐10011 and REZ‐2017‐10012 To Whom It May Concern, My name is Marino Kolitsopoulos and my company, 1250 Main LLC, owns the property located at 1712 Gulf to Bay Blvd. Recently, I was sent notice from the City that a property in the neighborhood located at 300 S. Duncan has been attempting to rezone to a Commercial zoning. I believe that this rezoning request is quite logical and brings a level of symmetry to the zoning map that it is currently lacking. My block for instance is exactly east of the area in question and has commercial zoning from Gulf to Bay all the way to Rainbow. Why should their block be zoned and treated any differently? Also, I believe that what Mr. Dorman and his group are doing will be a great improvement to the neighborhood. Currently 300 S. Duncan is an undesirable office structure that lacks the traffic and commercial frontage that is needed for a viable office complex today. Given the location of this property, it would seem that a use like storage would directly benefit the neighborhood more than an office complex; and may be the best use for this site. As it is now the 21st Century and technology has forced the office into our homes, automobiles, and pockets, the need for office space for smaller businesses is almost non‐existent. This is evidenced by the increasing number of office properties becoming run down and obsolete; just like this one. As technology continues to change our society, the need for local government to keep up and evolve to meet the municipal needs is paramount. Zoning will need to continue to evolve to serve the public properly and get beyond the idea of preserving a past that is no longer relevant. Respectfully, Marino Kolitsopoulos, CEO Advanced Realty Group, Inc. 2 2630 West Bay Drive Suite 105 Belleair Bluffs, FL 33770 727‐518‐8500 727‐518‐8553 fax 727‐418‐1773 direct Right-click or tap and hold here to download pictures. To help protect your privacy, Outlook prevented automatic download of this picture from the Internet. Virus-free. www.avg.com 1 Call, Rosemarie From:Matzke, Lauren Sent:Monday, January 15, 2018 1:45 PMTo:Call, RosemarieSubject:Fwd: 300 S Duncan/SkycrestAttachments:SKM_C25817121911070.pdf Sorry about that! I thought this had made it over earlier. Thanks for adding it! Get Outlook for iOS From: JoAnna Siskin <jsiskin@usameribank.com> Sent: Tuesday, December 19, 2017 10:09:19 AM To: Matzke, Lauren Subject: 300 S Duncan/Skycrest Lauren attached is the letter from Skycrest opposing the project at 300 S Duncan. JoAnna Siskin Retail Operations Coordinator 1617 Gulf to Bay Blvd Clearwater FL 33755 P: 727‐445‐6718 E: jsiskin@usameribank.com F: 727‐298‐0134 NOTICE: Pursuant to the Electronic Communications Privacy Act, 18 U.S.C. ?? 2510‐2522, the contents of this e‐mail and the attachments hereto (if any) are confidential, privileged, and/or otherwise exempt from disclosure and are intended only for disclosure to and use by the intended recipient of this message. If you are not the intended recipient of this message, the receipt of this message is not intended to and does not waive any applicable confidentiality or privilege and you are hereby notified that any dissemination, distribution, printing, or copying of the contents of this e‐mail is strictly prohibited. If you are not the intended recipient, please notify us by telephone or e‐mail and delete this e‐mail from your system. Further, e‐mail transmissions are not guaranteed to be secure or error‐free because information can be intercepted, corrupted, lost, destroyed, arrive late or incomplete, or contain viruses. WE THEREFORE EXPRESSLY DISCLAIM ANY REPRESENTATION OR WARRANTY REGARDING THE SAFETY AND INTEGRITY OF THIS E‐MAIL AND FOR ANY ERRORS OR OMISSIONS IN THE CONTENTS OF THIS E‐MAIL THAT ARISE AS A RESULT OF THIS TRANSMISSION OR ANY SUBSEQUENT RE‐TRANSMISSION Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: 9103-18 2nd rdg contd Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: OrdinanceIn Control: Planning & Development Agenda Number: 10.11 SUBJECT/RECOMMENDATION: Continue second reading of Ordinance 9103-18 to March 1, 2018 making amendments to the Clearwater Downtown Redevelopment Plan repealing and replacing Chapters 1-3 which update goals, objectives and policies; increasing density and intensity and revise height; modifying Character District boundaries; and expanding the Old Bay Character District boundaries northward. SUMMARY: APPROPRIATION CODE AND AMOUNT: USE OF RESERVE FUNDS: Page 1 City of Clearwater Printed on 1/25/2018 Community Development Board – January 9, 2018 City Council – January 18, 2018 Ordinance No. 9103-18 – Page 1 PLANNING & DEVELOPMENT DEPARTMENT COMMUNITY DEVELOPMENT BOARD STAFF REPORT MEETING DATE: January 9, 2018 AGENDA ITEM: D.1. CASE: Ordinance No. 9103-18 ORDINANCE NO.: 9103-18 REQUEST: Review and recommendation to the City Council on amendments to the Clearwater Downtown Redevelopment Plan repealing and replacing Chapters 1-3 which update goals, objectives and policies; increase density and intensity and revise height; modify Character District boundaries; and expand the Old Bay Character District boundaries northward. INITIATED BY: City of Clearwater, Planning and Development Department BACKGROUND: History of Downtown Planning The City of Clearwater (City) has been active in its pursuit of Downtown revitalization since the 1970s. The first planning study for Downtown Clearwater was released in 1977. In 1981, the City established a Community Redevelopment Agency (CRA) and created the Community Redevelopment Area that stretched from Clearwater Harbor to east of Missouri Avenue. At this time, the City also approved Downtown’s first plan known as the Redevelopment Plan. In 1993, the City Commission approved the Downtown Clearwater Periphery Plan, which addressed the development potential of four areas located on the edges of Downtown identified as important to the success of overall downtown redevelopment (i.e., Northwest, Southwest, Northeast and Southeast Expansion Areas). In 1995, the City Commission approved a major revision to the Redevelopment Plan, establishing five overall goals for Downtown and renaming it the Clearwater Downtown Redevelopment Plan (the Plan). Planning & Development Department Clearwater Downtown Redevelopment Plan Amendment Long Range Planning Division Community Development Board – January 9, 2018 Community Redevelopment Agency – January 16, 2018 City Council – January 18, 2018 Ordinance No. 9103-18 – Page 2 In 2004 a major update to the Plan was completed which incorporated the four periphery areas and the new eastern gateway to Downtown and expanded the Community Redevelopment Area into the Plan and the Downtown Planning Area. With this expansion, the total Downtown Planning Area expanded to almost 545 acres, inclusive of two areas that were within the Downtown Clearwater Periphery Plan that were not otherwise integrated into the CRA. This update also included the formation of six Character Districts and created flexibility for future growth with site plan and design review to implement design guidelines. The City also established the Public Amenities Incentive Pool, which can be allocated to specific projects that make a major contribution to Downtown. Clearwater Downtown Redevelopment Plan Update Overview Since the adoption of the Plan some redevelopment has occurred in the Downtown; however, there continues to be a lack of commercial development, erosion of neighborhood character, and limited new housing development. This update is primarily focused on the land use components of the Plan, with additional updates to incorporate current data. Chapter 4, Implementation Plan, is not proposed to be amended at this time; however, it is incorporated into the updated document and reformatted to be consistent with the Plan as a whole. This update of the Plan reaffirms the vision for Downtown as the urban core and heart of the City, and incorporates the goals and policies of several recently completed documents including the North Marina Area Master Plan, Clearwater Comprehensive Boating Plan, Imagine Clearwater, and the East Gateway District Vision Plan. Several changes to the Character Districts are proposed, including combining the Town Lake Residential and Town Lake Business Character Districts into one District, Prospect Lake, named for the City stormwater pond and park. This would reduce the number of Character Districts from six to five. A new direction for the District is envisioned and is appropriate for all properties within the two former Town Lake Districts. The East Gateway District has been rebranded as the Downtown Gateway, so the Character District name is updated accordingly. Additionally, this update proposes to expand the Old Bay Character District to include 9.671 acres that were included in the study area of the North Marina Area Master Plan but were not already in the Downtown Plan Area. The boundary revisions are illustrated on Map 1. (See page 4) To increase overall housing production, which is a component of addressing housing affordability concerns, development potential is proposed to be increased in all Character Districts. Additionally, changes are proposed to simplify properties’ development potential so it is not based on lot size, which eliminates the need for lot consolidation in certain Districts. In those Character Districts that are primarily low-scale and/or single family residential (i.e., Planning & Development Department Clearwater Downtown Redevelopment Plan Amendment Long Range Planning Division Community Development Board – January 9, 2018 Community Redevelopment Agency – January 16, 2018 City Council – January 18, 2018 Ordinance No. 9103-18 – Page 3 Downtown Gateway and Old Bay Districts), density is proposed to be increased to 35 dwelling units per acre, which has been identified as being conducive for “missing middle housing” consisting of single-family houses, multiplexes, townhouses and bungalow courts which offer a variety of needed housing types. This increase in density supports the desired residential infill development on small sites that is typical in these neighborhoods, compatible with the existing single family home and consistent with urban downtowns. In some instances the density may allow for a single additional unit on an existing parcel and is a gentle way to add density to an urban neighborhood, while also making existing sites and buildings more viable for development. In certain Districts, an increase to nonresidential development potential (floor area ratio) is also proposed to support the vision of multi-story buildings with structured parking along Downtown’s commercial corridors. Where nonresidential development potential was previously 1.0 FAR, it is proposed to be increased to 1.5 FAR to enable this transition. The western edge of the Prospect Lake District is proposed to receive the greatest increase in development potential (75 dwelling units per acre or 2.5 FAR) which would allow redevelopment that supports the eastern edge of the Downtown Core District. The update proposes changes to maximum heights within certain Character Districts that were formerly hinted at in Plan policies, which, coupled with the floor area ratio changes, reflects the importance of protecting the historic single-family character of certain Downtown neighborhoods (e.g., the Grove Street neighborhood) while supporting more intense and taller development along major streets. To fully integrate the properties in the proposed Old Bay Expansion Area into the Downtown Planning Area, additional steps will be necessary. The City’s Future Land Use Map and Zoning Atlas will need to be amended to designate these parcels with the Central Business District (CDB) future land use category and the Downtown (D) zoning district, consistent with the majority of the Downtown Planning Area. Similarly, those areas in the Prospect Lake and Downtown Gateway Character Districts that are not designated as Central Business District (CBD) future land use and Downtown (D) District would not be provided the same development potential proposed within the Plan unless the City processes Future Land Use Map and Zoning Atlas amendments to designate them accordingly. This would unify all of Downtown within the same category and allow the increased development potential proposed in the Plan to be applied to all properties in the Downtown Planning Area. The Plan proposes policy to support unification of the designations. The variety of existing future land use designations and zoning districts are shown on Maps 2 and 3. (See page 5) Planning & Development Department Clearwater Downtown Redevelopment Plan Amendment Long Range Planning Division Community Development Board – January 9, 2018 Community Redevelopment Agency – January 16, 2018 City Council – January 18, 2018 Ordinance No. 9103-18 – Page 4 Additionally, to implement the updated vision and goals of the Plan, the Downtown zoning district in the Community Development Code must be updated to allow many uses by right and to establish design standards for Downtown properties. The Design Guidelines are proposed to be removed from this Plan and relocated to the Downtown (D) District in the Community Development Code in the form of design standards. Generally the updated goals, objectives, policies and development potential support a multimodal Downtown, preservation of neighborhood character, allow for greater development opportunities for existing lots, and encourage a variety of housing types. Map 1 Proposed Expansion & New Districts Planning & Development Department Clearwater Downtown Redevelopment Plan Amendment Long Range Planning Division Community Development Board – January 9, 2018 Community Redevelopment Agency – January 16, 2018 City Council – January 18, 2018 Ordinance No. 9103-18 – Page 5 Map 2 Zoning Districts Map 3 Future Land Use Designations Planning & Development Department Clearwater Downtown Redevelopment Plan Amendment Long Range Planning Division Community Development Board – January 9, 2018 Community Redevelopment Agency – January 16, 2018 City Council – January 18, 2018 Ordinance No. 9103-18 – Page 6 Community Meetings Outreach to the various Downtown business and resident groups provided opportunities to review proposed changes throughout the planning process. Staff presented six times to the Downtown groups and organizations in 2016. Additionally, community meetings were held at the Clearwater Main Library where feedback display boards utilizing emojis and visual preference voting gathered public feedback on the Vision, Goals, and Guiding Principles and the proposed changes to the Character Districts. The goal was to reaffirm the vision for Downtown and the responses were very positive. ANALYSIS: The Plan has two purposes. It serves as a Special Area Plan in accordance with the Countywide Rules of Pinellas County, guiding development through goals, objectives and policies and regulating uses and development potential within the Character Districts. It also is the Community Redevelopment Plan for the 449 acres contained in the CRA, establishing policies that guide future actions and projects of the City’s Community Redevelopment Agency. Proposed Ordinance No. 9103-18 repeals and replaces Chapters 1 through 3 of the Plan (Exhibit A of ordinance). Chapter 4 is not being amended through this ordinance, but is anticipated to be updated concurrently with the 15-year review of the CRA Plan by Pinellas County in 2018. Below is a summary of the proposed amendments, the majority of which are within Chapter 3. Chapter 1 Introduction, History & Planning for Downtown (Pages 2-9 of Plan) The Introduction Chapter identifies the purpose of the Plan, provides a brief history Clearwater and details planning efforts for Downtown. This section is proposed to be reorganized and updated for clarity and succinctness. Chapter 2 Existing Conditions (Pages 12-41 of Plan) The Existing Conditions Chapter is a collection of data on the existing conditions of the Downtown Planning Area including land uses, historic resources, demographics, transportation, parking infrastructure, public recreation facilities, and existing City and/or CRA redevelopment programs and completed projects. Generally, data was updated and demographics utilized the 2010 U.S. Census and American Community Survey (ACS) 2011-2015 estimates. Planning & Development Department Clearwater Downtown Redevelopment Plan Amendment Long Range Planning Division Community Development Board – January 9, 2018 Community Redevelopment Agency – January 16, 2018 City Council – January 18, 2018 Ordinance No. 9103-18 – Page 7 Chapter 3 Land Use /Redevelopment Plan (Pages 44-125 of Plan) The Land Use/Redevelopment Plan Chapter establishes the goals, objectives and policies for Downtown and its Character Districts, as well as the development potential and height for properties within the Downtown Planning Area. Downtown Goals In addition to minor modifications to the original three goals within the Downtown Plan i.e., People, Accessibility (renamed from Movement), and Amenity, a fourth goal is proposed, Urban Design, to emphasize the importance of quality urban design in revitalizing Downtown. Guiding Principles The original Guiding Principles have been revised with three significant changes. The Plan proposes to view parking as infrastructure that supports Downtown as a collective whole and encourages integrated transportation options. Two additional Guiding Principles are proposed: Environment and Resilience. They emphasize the importance of incremental improvements and that Downtown will be prepared to positively adapt to a disruption. Character Districts, Generally As previously mentioned, this update modifies the Character Districts by combining two Character Districts into one (Prospect Lake) and proposes to expand the Old Bay District boundary, and subsequently the Downtown Planning Area. These modifications are based on expanded vision of development opportunities and change from 2004 within these areas, and incorporate recently completed supporting documents. Each District includes a vision for future development, as well as description of uses, function, development patterns, and policies that are specific to implementing the District’s vision. The amount of nonresidential or residential development (floor area ratio [FAR] or density) that can be built and any limitations on overall height are also specified and are illustrated on Maps 4 through 7. See paged 14-15. The proposed revisions include changes to permitted density, intensity and maximum heights in several Districts to support their individual visions, provide further redevelopment opportunities, facilitate transitions, and allow for additional infill housing and neighborhood redevelopment. However, it remains consistent that the most intensive development should occur in the Downtown Core and generally become less intensive to the north, south and east. A brief description of the vision and changes proposed within each Character District follow. Maps 4 through 7 show the proposed development potential. Planning & Development Department Clearwater Downtown Redevelopment Plan Amendment Long Range Planning Division Community Development Board – January 9, 2018 Community Redevelopment Agency – January 16, 2018 City Council – January 18, 2018 Ordinance No. 9103-18 – Page 8 Downtown Core District The Downtown Core District is envisioned to be the most dense and intense District and should continue to be a center for government and office uses with walkable block sizes and an interconnected street grid that make it pedestrian-friendly and balance the needs of all users. Development and redevelopment along Osceola Avenue is envisioned to be the active edge of the Downtown waterfront. Key components of the redevelopment strategy are to attract residential development to the Downtown Core and to implement Imagine Clearwater, which is addressed by including appropriate language within the vision and development patterns sections, as well as in District-specific policies. The Plan proposes a density increase of 5 dwelling units per acre (du/ac) which is the maximum able to be requested under the Countywide Rules. A summary of the proposed development potential for the Downtown Core is included in Table 1. Table 1. Downtown Core Development Potential EXISTING PROPOSED CHANGE FAR 4.0 4.0 no change Density 70 du/ac or 95 hotel units/ac 75 du/ac or 95 hotel units/ac + 5 du/ac increase, no change in hotel units/ac Height Unlimited* Unlimited* no change *Policies direct height along Cleveland Street to be consistent with historic building patterns. Old Bay District The Old Bay District is a mixed-use neighborhood that supports the Downtown employment base with residential uses, limited neighborhood commercial uses and office uses. The District is envisioned to remain low-rise and promote pedestrian and bicyclist connectivity. The Plan supports an activated waterfront area that balances the needs of the boating community and area residents and values views of and public access to the water. The boundary of the District is proposed to be expanded to include the 41 parcels to the north, totaling 9.671 acres that were part of the North Marina Area Master Plan. This will increase the size of the Downtown Planning Area from 544.929 acres to 554.6 acres. The Plan proposes increased nonresidential development potential for properties fronting on and westward of North Fort Harrison Avenue. Generally, the Plan proposes a density increase of 10 to 27.5 dwelling units per acre depending on property size and location, as well as simplification of density allocation. Currently the maximum permitted height varies by location to facilitate a transition in scale of development, and a similar transition at a lower height is proposed in the Planning & Development Department Clearwater Downtown Redevelopment Plan Amendment Long Range Planning Division Community Development Board – January 9, 2018 Community Redevelopment Agency – January 16, 2018 City Council – January 18, 2018 Ordinance No. 9103-18 – Page 9 Plan. The Plan proposes certain reductions in height to be more consistent with the neighborhood character, the preservation of which was already envisioned through District specific policies and supported by the 2014 ULI Advisory Services Panel Report. Reduced height with increased density supports development that fills out a site in an urban form, rather than a tower surrounded by parking. Additionally the changes in maximum permitted height are supported by the North Marina Area Master Plan’s vision for the area. The Plan also proposes to establish the maximum height in the Old Bay expansion area as 30 feet, which is consistent with the current allowable height. Table 2 compares the change in development potential, excluding properties with other zoning and future land use designations. Planning & Development Department Clearwater Downtown Redevelopment Plan Amendment Long Range Planning Division Community Development Board – January 9, 2018 Community Redevelopment Agency – January 16, 2018 City Council – January 18, 2018 Ordinance No. 9103-18 – Page 10 Table 2. Old Bay Development Potential EXISTING PROPOSED CHANGE FAR Fronting on N. Ft. Harrison Ave. and westward: 1.0 Fronting on N. Ft. Harrison Ave. and westward: 1.5 +0.5 increase for properties fronting on and westward of N. Ft. Harrison Ave. Eastward of properties fronting on N. Ft. Harrison Ave.: 0.5 Eastward of properties fronting on N. Ft. Harrison Ave.: 0.5 no change for properties eastward of properties fronting on N. Ft. Harrison Ave. Density Fronting on N. Ft. Harrison Ave. and less than 2 acres: 25 du/ac, or greater than 2 acres: 50 du/ac 35 du/ac or 50 du/ac for mixed use +10 du/ac increase for parcels less than 2 acres -15 du/ac decrease for properties 2 acres or larger ** Eastward of properties front on N. Ft. Harrison Ave. and less than 1 acre: 7.5 du/ac, or greater than 1 acre: 25 du/ac +27.5 du/ac increase for parcels less than 2 acres +10 du/ac increase for parcels 2 acres or larger West of N. Osceola Ave. and north of Seminole St. and equal 2 acres or greater: 50 hotel units/ac West of N. Osceola Ave. and north of Seminole St. and 2 acres or greater, excluding properties fronting on Cedar St.: 50 hotel units/ac Clarification that the hotel development potential does not apply within the Old Bay expansion area Bed and Breakfasts not permitted Bed and Breakfasts: 35 rooms/ac, not to exceed 10 rooms Bed and Breakfast density established Height Between N. Osceola Ave. and Ft. Harrison Ave. and between Jones and Drew St., and properties west of N. Osceola Ave. and between Drew and Georgia Sts.: 150 ft. West of N. Osceola Ave. and between Drew and Georgia Sts., or between N. Osceola and N. Ft. Harrison Aves. and between Jones and Drew Sts.: 150 ft. No changes for properties with a max height of 150 ft. West of N. Osceola Ave. between Georgia and Eldridge Sts.: 120 ft. West of Garden Ave. and south of Nicholson St.: 55 ft. -65 foot reduction in height for properties between Georgia and Eldridge Sts. *** -45 foot reduction in height for properties between Eldridge and Nicholson Sts.*** West of N. Osceola Ave. between Eldridge St. and northern boundary: 100 ft. East of Osceola Ave.: 40 ft. East of Garden Ave. and south of Nicholson St.: 45 ft. +15 foot increase for properties between N. Osceola and Garden Aves. +5 foot increase for properties east of Garden Ave. North of Nicholson St. not included in the Old Bay Character District, height varies by current zoning district North of Nicholson St.: 30 ft. Properties north of Nicholson Street included in the Old Bay Character District and height established at 30 ft. ** Staff research found there are 3 properties that would be impacted, one City-owned. *** Height reductions are supported by the North Marina Area Master Plan and current District policies. Planning & Development Department Clearwater Downtown Redevelopment Plan Amendment Long Range Planning Division Community Development Board – January 9, 2018 Community Redevelopment Agency – January 16, 2018 City Council – January 18, 2018 Ordinance No. 9103-18 – Page 11 South Gateway District The South Gateway District provides a transition from the Downtown Core District to the single family neighborhoods southeast of Downtown. The Plan envisions that South Fort Harrison will continue to be ideal frontage for commercial, office, and medical uses due to its proximity to the Morton Plan Hospital campus. Connections to the Pinellas and Druid Trails are encouraged. The District is largely redeveloped with commercial uses along South Fort Harrison Avenue. Along Turner Street many offices converted from homes and there are limited remaining residential uses. The Plan proposes development potential increases throughout the entire District. Table 3 compares the change in development potential for this District. Table 3. South Gateway Development Potential EXISTING PROPOSED CHANGE FAR 1.0 1.5 +0.5 increase Density Less than 2 ac: 25 du/ac or 2 acres and greater: 35 du/ac. 2 acres and greater, mixed use: 50 du/ac 35 du/ac or 50 du/ac for mixed use +10 du/ac increase for parcels less than 2 acres no change for parcels 2 acres or greater Height 50 feet 55 feet +5 foot increase Prospect Lake District This District is proposed to be formed by combining the Town Lake Residential District and the Town Lake Business Park District. Generally both Districts have the same development potential; however, Town Lake Business Park District is supportive of large scale suburban style office development which has not occurred and is not anticipated to develop in the future. When analyzing the development potential, goals, patterns and envisioned development of the two Districts they were consistent and compatible. As previously mentioned, the Plan proposes a substantial increase in development potential for properties west of South Prospect Avenue and Knights Alley. This increase is compatible with the adjacent Downtown Core District to the west and will allow both sides of Myrtle Avenue to develop at an appropriate scale and intensity. The Plan envisions Myrtle Avenue as a walkable urban street and new residents in the District will enliven Downtown. Within the areas generally north of Laura Street and east of Martin Luther King, Jr. Avenue reductions in height are proposed that establishes a standard consistent with the height limitations supported by existing policies. Some properties in the District are not currently zoned Downtown (D) and designated Central Business District (CBD) on the future land use map (See Maps 2 and 3 on page 5) therefore, the proposed development potential shown in the table will not apply to them unless their designations are amended. Table 4 compares the changes in development potential, excluding properties with other zoning and future land use designations. Planning & Development Department Clearwater Downtown Redevelopment Plan Amendment Long Range Planning Division Community Development Board – January 9, 2018 Community Redevelopment Agency – January 16, 2018 City Council – January 18, 2018 Ordinance No. 9103-18 – Page 12 Table 4. Prospect Lake Development Potential Character Districts EXISTING PROPOSED Prospect Lake CHANGE Town Lake Residential FAR 1.0 FAR West of S. Prospect Ave. and Knights Alley: 2.5 +1.5 increase for properties near Myrtle Ave. +0.5 increase in remainder of District Density 30 du/ac or 40 hotel units/ac, Bed and Breakfasts not permitted Remainder of District: 1.5 Height 75 ft. Density West of S. Prospect Ave. and Knights Alley: 75 du/ac or 40 hotel units/ac +45 du/ac increase for properties near Myrtle Ave. Town Lake Business Park FAR 1.0 Remainder of District 50 du/ac or 40 hotel units/ac, Bed and Breakfasts: 35 rooms/ac not to exceed 10 rooms +20 du/ac increase for remainder of District, Bed and Breakfasts added as a use and density established No change for hotel units/ac Density 30 du/ac or 40 hotel units/ac Bed and Breakfasts not permitted Height: South of Laura St., fronting on or south of Cleveland St.: 75 ft. no change for properties south of Laura St., fronting on or south of Cleveland St. Height 75 ft. Properties north of Laura St. and west of Martin Luther King, Jr. Ave.: 55 ft. -20 foot reduction in height for properties north of Laura St. and west of Martin Luther King, Jr Ave. ***** North of and not fronting on Cleveland St. and east of Martin Luther King, Jr. Ave.: 30 ft. -45 foot reduction in height for properties north of and not fronting on Cleveland St. **** **** Height previously reduced through policy. Downtown Gateway District This District was formerly called the East Gateway Character District and at the recommendation of the East Gateway District Vision Plan (2011) it was rebranded as the Downtown Gateway District. This District has a diverse neighborhood with a rich cultural base that creates a unique sense of place. This District is largely residential with commercial along Cleveland Street, Missouri Avenue and Gulf to Bay Boulevard. The growth and facility needs of medical office and small business provide a wide range of skilled and professional employment opportunities. The Plan proposes an increase in development potential for properties fronting on Cleveland Street between Missouri and Hillcrest Avenues or on Gulf to Bay Boulevard to support a concentration of multi-story buildings along these streets. Currently maximum height varies by use and the Plan proposes to regulate height by location. Generally, the proposed maximum height is a 5 to 30 foot increase from the current maximum height. Some properties in the District are not currently zoned Downtown (D) and designated Central Business District (CBD) Planning & Development Department Clearwater Downtown Redevelopment Plan Amendment Long Range Planning Division Community Development Board – January 9, 2018 Community Redevelopment Agency – January 16, 2018 City Council – January 18, 2018 Ordinance No. 9103-18 – Page 13 on the future land use map (See Maps 2 and 3 on page 5) therefore, the proposed development potential shown in the table will not apply to them unless their designations are amended. Table 5 compares the changes in development potential, excluding properties with other zoning and future land use designations. Table 5. Downtown Gateway Development Potential EXISTING PROPOSED CHANGE FAR 0.55 Fronting on Cleveland St. between Missouri and Hillcrest Aves. or fronting on Gulf to Bay Blvd.: 1.5 +0.95 increase for properties fronting on Cleveland St. between Missouri to Hillcrest Aves. or on Gulf to Bay blvd. Remainder of District: 0.55 no change Density 30 du/ac or 40 hotel units/ac 35 du/ac or generally, fronting on Missouri Ave., Cleveland St., Gulf to Bay Blvd. more specifically as shown on Map 6, Maximum Hotel Density,: 40 hotel units/ac + 5 du/ac increase, Clarifying appropriate hotel locations eluded to in District vision, no change in hotel units/ac Height Office: 50 ft. Commercial: 25-35 ft. Multifamily: 50 ft. South of Grove St., fronting on or south of Cleveland St. between Missouri and N. San Remo Aves., south of Laura St between Hillcrest and N. San Remo Aves., and eastward of Gulf to Bay Blvd. and south of De Leon St.: 55 feet. South of Drew St. between Missouri and Hillcrest Aves.: 45 feet South of Drew St. between N. Hillcrest and N. Highland Aves.: 30 feet Criteria for maximum height changed from by use to by location. + 5 to +30 foot increase in height compared to ranges permitted for different uses. Planning & Development Department Clearwater Downtown Redevelopment Plan Amendment Long Range Planning Division Community Development Board – January 9, 2018 Community Redevelopment Agency – January 16, 2018 City Council – January 18, 2018 Ordinance No. 9103-18 – Page 14 Map 4 Maximum Floor Area Ratio Map 5 Maximum Dwelling Units per Acre Planning & Development Department Clearwater Downtown Redevelopment Plan Amendment Long Range Planning Division Community Development Board – January 9, 2018 Community Redevelopment Agency – January 16, 2018 City Council – January 18, 2018 Ordinance No. 9103-18 – Page 15 Map 6 Maximum Hotel Density Map 7 Maximum Height Planning & Development Department Clearwater Downtown Redevelopment Plan Amendment Long Range Planning Division Community Development Board – January 9, 2018 Community Redevelopment Agency – January 16, 2018 City Council – January 18, 2018 Ordinance No. 9103-18 – Page 16 Future Elements Chapter 3 also includes sections that address recreation and open space, housing, transportation, streetscaping and wayfinding. The proposed amendments update these sections to reflect more current data and to incorporate future projects or improvements, many of which were identified in supporting documents (e.g., Imagine Clearwater, North Marina Area Master Plan, East Gateway District Vision Plan) and transportation plans. The Design Guidelines are proposed to be removed from the Plan, and will be integrated into the updated Downtown zoning district which is currently being drafted by staff and will be brought forward for City Council consideration in the near future. Chapter 4 Plan Implementation (Pages 128-163 of Plan) Chapter 4 sets forth how the Plan is to be implemented. Sections include Downtown Strategies, Capital Improvement Plan, and Tax Increment Revenue Projects, and the majority of the Chapter supports the Community Redevelopment Plan in accordance with Florida’s Community Development Redevelopment Act. At this time no amendments are proposed to Chapter 4; however, it has been reformatted and provided as part of the complete Plan document. Chapter 4 is anticipated to be updated concurrently with the 15 year review of the CRA Plan by Pinellas County in 2018. Appendix The Appendix provides supporting information that is too cumbersome to be incorporated into the body of the Plan. Several appendices are proposed to be repealed and replaced through Ordinance No. 9103-18, but Appendices 1, Expanded CRA Legal Description, and 8, Downtown-Gateway Strategic Action Plan, are unchanged. Generally, maps, data and methodologies have been updated to reflect current conditions and any changes between 2004 and the proposed amendments. Existing Appendix 9, The Design Guidelines Glossary, is proposed to be removed as the Design Guidelines contained within Chapter 3 are proposed to be removed. Additionally Appendix 10, Representative Downtown Architecture is proposed to be deleted. CONSISTENCY WITH COMPREHENSIVE PLAN A review of the Clearwater Comprehensive Plan identified the following Goal, Objectives and Policies which will be furthered by the proposed amendments to the Clearwater Downtown Redevelopment Plan: Goal A.1. The City of Clearwater shall continue to protect natural resources and systems throughout the City and ensure that these resources are Planning & Development Department Clearwater Downtown Redevelopment Plan Amendment Long Range Planning Division Community Development Board – January 9, 2018 Community Redevelopment Agency – January 16, 2018 City Council – January 18, 2018 Ordinance No. 9103-18 – Page 17 successfully integrated into the urban environment through land development regulation, management programs and coordination with future land use intensities and categories. Objective A.5.5 Promote high quality design standards that support Clearwater’s image and contribute to its identity. Policy A.5.5.1 Development should be designed to maintain and support the existing or envisioned character of the neighborhood. Policy A.5.5.2. Preserve the unique qualities of Clearwater and its cultural heritage as exemplified by historic buildings, landmarks, landscapes, streetscapes, lighting, and building design. Goal A.6 The City of Clearwater shall utilize innovative and flexible planning and engineering practices, and urban design standards in order to protect historic resources, ensure neighborhood preservation, redevelop blighted areas, and encourage infill development. Objective A.6.1 The redevelopment of blighted, substandard, inefficient and/or obsolete areas shall be a high priority and promoted through the implementation of redevelopment and special area plans, the construction of catalytic private projects, city investment, and continued emphasis on property maintenance standards. Policy A.6.1.8 The City shall continue to support and implement approved community redevelopment area plans, such as the Clearwater Downtown Redevelopment Plan adopted in 2004 and Beach by Design adopted in 2001. Policy A.6.1.10 Clearwater will continue to support the tax increment financing program and redevelopment efforts of the downtown area through activities of the economic development office and actions of the City Council as the Community Redevelopment Agency. Objective A.6.2. The City of Clearwater shall continue to support innovative planned development and mixed land use development techniques in order to promote infill development that is consistent and compatible with the surrounding environment. Planning & Development Department Clearwater Downtown Redevelopment Plan Amendment Long Range Planning Division Community Development Board – January 9, 2018 Community Redevelopment Agency – January 16, 2018 City Council – January 18, 2018 Ordinance No. 9103-18 – Page 18 Policy A.6.3.3. Consider conducting surveys to identify and evaluate potential historic resources for designation. Policy A.6.5.1 The City shall support the Pinellas Trail and examine opportunities for Trail extensions or spurs to connect regional attractions and employers Objective A.6.6 Tourism is a substantial element of the City’s economic base and as such the City shall continue to support the maintenance and enhancement of this important economic sector. Policy A.6.6.1 The City supports and encourages the continued development and redevelopment of overnight accommodation uses. Objective A.6.7. Redevelopment activities shall be sensitive to the city’s waterfront and promote appropriate public access to the city’s waterfront resources. Policy A.6.8.1. Build active, attractive communities that are designed at a human scale and encourage walking, cycling and use of mass transit. Policy A.6.8.3 Where appropriate, development shall provide a sense of pedestrian scale on streets through minimal front setbacks, similar building heights, street trees and proportionality of building heights to street widths. Policy A.6.8.6 Encourage the development of interconnected systems of natural areas, parks, sidewalks, greenways, trails and open spaces. Policy A.6.8.8. Design and construct pedestrian-oriented streets to include continuous tree-lined sidewalks buffered from traffic by on-street parking and/or landscaping and that include pedestrian amenities such as benches, trash receptacles, bus shelters and lighting. Policy A.6.8.9 Promote a variety of transportation modes such as walking, bicycling, ride sharing and mass transit to increase transportation choices and decrease dependence on the single-occupancy automobile. Objective B.1.2 Future improvements to arterial and collector streets shall be context sensitive by planning and designing the roadway based on the existing context of the surrounding built environment and the planned land use vision. Planning & Development Department Clearwater Downtown Redevelopment Plan Amendment Long Range Planning Division Community Development Board – January 9, 2018 Community Redevelopment Agency – January 16, 2018 City Council – January 18, 2018 Ordinance No. 9103-18 – Page 19 Policy B.1.2.7 The City shall install landscaping along sidewalks using tree canopy, where feasible, to provide shaded areas for pedestrians. Objective B.3.2 The City of Clearwater shall encourage and promote mass transit with appropriate land use, zoning and land development policies. Objective B.4.4 The City shall participate and cooperate with agencies and committees to enhance and promote the public transportation system. Goal C.1. An affordable variety of standard housing units in decent and safe neighborhoods to meet the needs of current and future residents regardless of race, nationality, age, marital status, handicap, or religion. Objective C.1.1 Assure an adequate supply of housing in Clearwater by providing for additional new dwelling units in a variety of types, costs, and locations to meet the needs of the residents of the City of Clearwater. Objective C.1.2 The City of Clearwater shall continue to provide assistance and incentives for the development of housing that is affordable to very low, low, and moderate income households, including those with special needs, consistent with the level of growth in these income categories. Objective C.1.6 Through both private and public resources, the City of Clearwater shall encourage the conservation, rehabilitation, and preservation of the existing housing stock, including historically significant housing. Objective G.1.5 Enhance and maintain the City's unique physical characteristics by making the best use of existing and potential recreation lands and open spaces. The Plan is consistent with the Clearwater Comprehensive Plan as evidenced by the numerous goals, objectives and policies identified above. The Plan establishes goals, objectives and policies that will ensure neighborhood preservation, redevelop blighted areas, protect historic resources, and support a multimodal Downtown. The Plan proposes to increase the intensity and density to create greater redevelopment opportunities, and modifies maximum height to clarify policies and be consistent with current and proposed policies. The Plan maintains the redevelopment strategy for the CRA that supports the elimination of blighting influences in the neighborhood through strategies and capital projects. It also supports a variety of housing in Downtown including market rate and affordable units. Existing redevelopment incentives are maintained in the Plan and include transfer of development rights and the allocation of the Public Amenities Incentives Pool. Planning & Development Department Clearwater Downtown Redevelopment Plan Amendment Long Range Planning Division Community Development Board – January 9, 2018 Community Redevelopment Agency – January 16, 2018 City Council – January 18, 2018 Ordinance No. 9103-18 – Page 20 SUMMARY AND RECOMMENDATION: The Community Development Board is reviewing the Plan in its capacity as the Local Planning Agency (LPA) and should make a recommendation regarding the updated Plan to the City Council. Additionally, the CRA should make a recommendation to the City Council regarding this document as the Redevelopment Plan for the CRA. Once the City Council approves the Plan, it will be submitted to the Board of County Commissioners for approval as the Community Redevelopment Plan for the CRA. The Plan will also be submitted to Forward Pinellas and the Countywide Planning Authority for review and approval as the Special Area Plan governing Downtown. The proposed amendments to the Plan implement the City Council’s desire to provide greater opportunities for redevelopment. These provisions confirm and reinforce the City’s commitment to implementing the strategies developed from the ULI study. In addition, the proposed amendments are consistent with and will further the goals of the Clearwater Comprehensive Plan. Further, the proposed ordinance establishes five character districts that regulate land use, density and intensity and design and increases the maximum floor area ratio and dwelling units per acre in certain areas, revises maximum height to clearly convey policy and provides language in support of the desired primarily pedestrian and multimodal Downtown. The proposed amendments to the Plan incorporate major policy provisions on Imagine Clearwater, North Marina Area Master Plan, and East Gateway District Vision Plan. The proposed amendments to the Old Bay District, as outlined above, will align the Plan with the North Marina Area Master Plan providing a unified vision for the area. Based upon the above, the Planning and Development Department recommends APPROVAL of Ordinance No. 9103-18 which replaces the 2004 Clearwater Downtown Redevelopment Plan Prepared by Planning and Development Department Staff: Ellen Crandall Senior Planner ATTACHMENTS: Ordinance No. 9103-18 2018 Clearwater Downtown Redevelopment Plan (Exhibit A) Resume ORDINANCE NO. 9103-18 AN ORDINANCE OF THE CITY OF CLEARWATER, FLORIDA, RELATING TO THE CLEARWATER DOWNTOWN REDEVELOPMENT PLAN REPEALING CHAPTER 1 INTRODUCTION, CHAPTER 2 EXISTING CONDITIONS, CHAPTER 3 LAND USE/REDEVELOPMENT PLAN, APPENDIX 2 DOWNTOWN MILESTONES, APPENDIX 3 EXISTING LAND USE CLASSIFICATIONS AND METHODOLOGY, APPENDIX 4 DEMOGRAPHICS METHODOLOGY AND ESTIMATES, APPENDIX 5 UTILITIES MAPS, APPENDIX 6 LAND USE DISTRIBUTION BY CHARACTER DISTRICT, APPENDIX 7 BUILD-OUT SCENARIOS, APPENDIX 9 DESIGN GUIDELINES GLOSSARY, APPENDIX 10 REPRESENTATIVE DOWNTOWN ARCHITECTURE; AND ADOPTING NEW CHAPTER 1 INTRODUCTION; ADOPTING NEW CHAPTER 2 EXISTING CONDITIONS, UPDATING DATA AND ANALYSIS OF EXISTING CONDITIONS AND IMPLEMENTATION OF PROJECTS; ADOPTING NEW CHAPTER 3 LAND USE/REDEVELOPMENT PLAN, UPDATING THE VISION, GUIDING PRINCIPLES, GOALS, OBJECTIVES, AND POLICIES, CONSOLIDATING DOWNTOWN CHARACTER DISTRICT BOUNDARIES, EXPANDING THE DOWNTOWN PLANNING AREA BOUNDARY NORTHWARD OF THE OLD BAY CHARACTER DISTRICT, AND AMENDING DENSITY, INTENSITY AND HEIGHT ENTITLEMENTS; ADOPTING NEW APPENDIX 2 DOWNTOWN MILESTONES AND NEW APPENDIX 7 BUILD-OUT SCENARIOS, UPDATING VERBIAGE; ADOPTING NEW APPENDIX 3 EXISTING LAND USE CLASSIFICATIONS, METHODOLOGY AND DISTRIBUTION BY CHARACTER DISTRICT, UPDATING DATA AND METHODOLOGY; ADOPTING NEW APPENDIX 4 DEMOGRAPHICS METHODOLOGY AND ESTIMATES, UPDATING DATA, METHODOLOGY AND MAPS AND ADOPTING NEW MAP; ADOPTING NEW APPENDIX 5 UTILITIES MAPS AND NEW APPENDIX 6 COMMUNITY REDEVELOPMENT AREA BOUNDARIES AND PERIPHERY PLANS MAP, UPDATING MAPS AND ADOPTING NEW MAPS; AND PROVIDING FOR SEVERABILITY AND PROVIDING AN EFFECTIVE DATE. WHEREAS, Forward Pinellas, in its role as the Pinellas Planning Council, has recognized the Clearwater Downtown Redevelopment Plan as an adopted Special Area Plan, pursuant to Section 6.5.4.3 of The Countywide Rules and the City of Clearwater (“the City”) has the authority pursuant to The Countywide Rules to amend a Special Area Plan adopted prior to August 7, 2015; and WHEREAS, Resolution No. 81-67, adopted on August 6, 1981, declared that a blighted area exists within a specified boundary in Downtown Clearwater and that there is a need for a Community Redevelopment Agency to carry out redevelopment activities in this blighted area; and WHEREAS, the City Commission, via Ordinance No. 2576-81, adopted a Community Redevelopment Plan for the Community Redevelopment Area on December 17, 1981; and WHEREAS, the City Commission approved a major revision to the Clearwater Downtown Redevelopment Plan in 1995; and 2 Ord. No. 9103-18 WHEREAS, the Clearwater Downtown Redevelopment Plan, which serves as both Special Area Plan and Community Redevelopment Plan for the City’s Community Redevelopment Area, was amended to expand the geographic scope of the City’s Community Redevelopment Area via Ordinance No. 7153-03, which was adopted on September 18, 2003 and has subsequently approved amendments thereto; and WHEREAS, the Pinellas County Board of County Commissioners approved the City’s Community Redevelopment Plan adopted by Ordinance No. 7231-04 on December 16, 2003 and has subsequently approved amendments thereto; and WHEREAS, the Countywide Planning Authority approved the updated and amended Clearwater Downtown Redevelopment Plan as the Special Area Plan for Downtown Clearwater on February 3, 2004 and has subsequently approved amendments thereto; and WHEREAS, the requirements of Florida Statutes, Chapter 163, have been met; and WHEREAS, the City has invested significant time and resources in studying Downtown Clearwater; and WHEREAS, a revitalized Downtown must be achieved to maintain a strong and healthy City; and WHEREAS, Downtown Clearwater is still in need of revitalization; and WHEREAS, Downtown is desired to be a place for people, with accessibility choices, with memorable and dynamic attractions and a built environment of high quality design; and WHEREAS, the City desires to draw residents and visitors to the Downtown waterfront, catalyze greater Downtown activity and investment and better connect the waterfront to the rest of Clearwater; and WHEREAS, the Clearwater Downtown Redevelopment Plan is the guiding plan and regulatory document for the Downtown Planning Area and recently completed supporting documents such as Imagine Clearwater, the North Marina Area Master Plan, the Comprehensive Boating Plan, and the East Gateway District Vision Plan need to be integrated into the Clearwater Downtown Redevelopment Plan; and WHEREAS, it is advisable to reaffirm and update the Vision, Guiding Principles, Goals, Objectives and Policies of the Clearwater Downtown Redevelopment Plan to capture the intent of the recently completed supporting documents; and WHEREAS, recent developments have demonstrated the need for additional entitlements, to make redevelopment more economically feasible; and WHEREAS, the need to create additional opportunities for commercial and office development and to allow for unified corridors with similar intensity and density support an increase of intensity in key areas of Downtown; and WHEREAS, the City desires to increase overall housing production in Downtown, which is a component of addressing housing affordability concerns; and 3 Ord. No. 9103-18 WHEREAS, the City desires to encourage additional diversity in the Downtown housing stock in order to create more options for home buyers, particularly first-time home owners or seniors looking to downsize or for more affordable price points, while preserving neighborhood character and compatibility with a downtown neighborhood; and WHEREAS, these proposed amendments to the Clearwater Downtown Redevelopment Plan will afford greater redevelopment opportunity through increased density and intensity for the continued revitalization of the Downtown Planning Area by private enterprise and is consistent with the needs of the City as a whole; and WHEREAS, the North Marina Area Master Plan study area included both the northern portion of the Old Bay Character District and 41 parcels (9.671 acres) northward of the district, which are outside of the Old Bay Character District and Downtown Planning Area; and WHEREAS, it is advisable to expand the Downtown Planning Area and the Old Bay Character District to be inclusive of the entire North Marina Area Master Plan study area upon adoption of the Clearwater Downtown Redevelopment Plan; and WHEREAS, these proposed amendments repeal and replace Chapters 1 through 3 and appendices 2 through 6, and delete appendices 9 and10 from the Clearwater Downtown Redevelopment Plan; Chapter 4 and appendices 1, 7 and 8 are substantively unaffected by this ordinance, other than reformatting, and could be updated when the Board of County Commissioners completes its Tax Increment Finance 15-year review around October 2018; and WHEREAS, the Community Redevelopment Agency has reviewed the proposed amendments to the Clearwater Downtown Redevelopment Plan, as detailed in Exhibit “A,” and recommends approval to the City Council; and WHEREAS, the proposed amendments to the Clearwater Downtown Redevelopment Plan, as detailed in Exhibit “A,” were reviewed by the Community Development Board, which is the local planning agency for the City of Clearwater for purposes of the Local Government Comprehensive Planning and Land Development Regulation Act, and the Community Development Board found the Proposed Plan to be consistent with the Comprehensive Plan of the City; and WHEREAS, the proposed amendments to the Clearwater Downtown Redevelopment Plan conform to the City’s general comprehensive plan; and WHEREAS, public input was gained through presentations and discussions in 2016 with Downtown Boards, organizations, and citizens; and at community meetings on April 26, 2017 and May 31, 2017, where attendees reaffirmed the proposed vision, guiding principles and increased entitlements for Downtown; now, therefore, 4 Ord. No. 9103-18 BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF CLEARWATER, FLORIDA: Section 1. Delete Appendices 9 and 10 from the current Clearwater Downtown Redevelopment Plan, and Chapters 1 through 3 and Appendices 2 through 6 of the current Clearwater Downtown Redevelopment Plan are repealed and shall be replaced by Exhibit “A,” which is hereby adopted; Chapter 4 and Appendices 1, 7 and 8 are substantively unaffected by this ordinance other than their reformatting and are included in Exhibit “A.” Section 2. The City Manager or designee shall forward the proposed Clearwater Downtown Redevelopment Plan amendments, as detailed in Exhibit “A,” to any agency required by law or rule to review or approve same. Section 3. Should any part or provision of this Ordinance be declared by a court of competent jurisdiction to be invalid, the same shall not affect the validity of the Ordinance as a whole, or any part thereof other than the part declared to be invalid. Section 4. This ordinance shall take effect immediately upon adoption, subject to the approval by the Pinellas County Board of County Commissioners and the Countywide Planning Authority. PASSED ON FIRST READING _____________________ PASSED ON SECOND AND FINAL _____________________ READING AND ADOPTED ___________________________ George N. Cretekos Mayor Approved as to form: Attest: ____________________________ ___________________________ Camilo Soto Rosemarie Call Assistant City Attorney City Clerk ORDINANCE NO. 9103-18 AN ORDINANCE OF THE CITY OF CLEARWATER, FLORIDA, RELATING TO THE CLEARWATER DOWNTOWN REDEVELOPMENT PLAN REPEALING CHAPTER 1 INTRODUCTION, CHAPTER 2 EXISTING CONDITIONS, CHAPTER 3 LAND USE/REDEVELOPMENT PLAN, APPENDIX 2 DOWNTOWN MILESTONES, APPENDIX 3 EXISTING LAND USE CLASSIFICATIONS AND METHODOLOGY, APPENDIX 4 DEMOGRAPHICS METHODOLOGY AND ESTIMATES, APPENDIX 5 UTILITIES MAPS, APPENDIX 6 LAND USE DISTRIBUTION BY CHARACTER DISTRICT, APPENDIX 7 BUILD-OUT SCENARIOS, APPENDIX 9 DESIGN GUIDELINES GLOSSARY, APPENDIX 10 REPRESENTATIVE DOWNTOWN ARCHITECTURE; AND ADOPTING NEW CHAPTER 1 INTRODUCTION; ADOPTING NEW CHAPTER 2 EXISTING CONDITIONS, UPDATING DATA AND ANALYSIS OF EXISTING CONDITIONS AND IMPLEMENTATION OF PROJECTS; ADOPTING NEW CHAPTER 3 LAND USE/REDEVELOPMENT PLAN, UPDATING THE VISION, GUIDING PRINCIPLES, GOALS, OBJECTIVES, AND POLICIES, CONSOLIDATING DOWNTOWN CHARACTER DISTRICT BOUNDARIES, EXPANDING THE DOWNTOWN PLANNING AREA BOUNDARY NORTHWARD OF THE OLD BAY CHARACTER DISTRICT, AND AMENDING DENSITY, INTENSITY AND HEIGHT ENTITLEMENTS; ADOPTING NEW APPENDIX 2 DOWNTOWN MILESTONES AND NEW APPENDIX 7 BUILD-OUT SCENARIOS, UPDATING VERBIAGE; ADOPTING NEW APPENDIX 3 EXISTING LAND USE CLASSIFICATIONS, METHODOLOGY AND DISTRIBUTION BY CHARACTER DISTRICT, UPDATING DATA AND METHODOLOGY; ADOPTING NEW APPENDIX 4 DEMOGRAPHICS METHODOLOGY AND ESTIMATES, UPDATING DATA, METHODOLOGY AND MAPS AND ADOPTING NEW MAP; ADOPTING NEW APPENDIX 5 UTILITIES MAPS AND NEW APPENDIX 6 COMMUNITY REDEVELOPMENT AREA BOUNDARIES AND PERIPHERY PLANS MAP, UPDATING MAPS AND ADOPTING NEW MAPS; AND PROVIDING FOR SEVERABILITY AND PROVIDING AN EFFECTIVE DATE. WHEREAS, Forward Pinellas, in its role as the Pinellas Planning Council, has recognized the Clearwater Downtown Redevelopment Plan as an adopted Special Area Plan, pursuant to Section 6.5.4.3 of The Countywide Rules and the City of Clearwater (“the City”) has the authority pursuant to The Countywide Rules to amend a Special Area Plan adopted prior to August 7, 2015; and WHEREAS, Resolution No. 81-67, adopted on August 6, 1981, declared that a blighted area exists within a specified boundary in Downtown Clearwater and that there is a need for a Community Redevelopment Agency to carry out redevelopment activities in this blighted area; and WHEREAS, the City Commission, via Ordinance No. 2576-81, adopted a Community Redevelopment Plan for the Community Redevelopment Area on December 17, 1981; and WHEREAS, the City Commission approved a major revision to the Clearwater Downtown Redevelopment Plan in 1995; and 2 Ord. No. 9103-18 WHEREAS, the Clearwater Downtown Redevelopment Plan, which serves as both Special Area Plan and Community Redevelopment Plan for the City’s Community Redevelopment Area, was amended to expand the geographic scope of the City’s Community Redevelopment Area via Ordinance No. 7153-03, which was adopted on September 18, 2003 and has subsequently approved amendments thereto; and WHEREAS, the Pinellas County Board of County Commissioners approved the City’s Community Redevelopment Plan adopted by Ordinance No. 7231-04 on December 16, 2003 and has subsequently approved amendments thereto; and WHEREAS, the Countywide Planning Authority approved the updated and amended Clearwater Downtown Redevelopment Plan as the Special Area Plan for Downtown Clearwater on February 3, 2004 and has subsequently approved amendments thereto; and WHEREAS, the requirements of Florida Statutes, Chapter 163, have been met; and WHEREAS, the City has invested significant time and resources in studying Downtown Clearwater; and WHEREAS, a revitalized Downtown must be achieved to maintain a strong and healthy City; and WHEREAS, Downtown Clearwater is still in need of revitalization; and WHEREAS, Downtown is desired to be a place for people, with accessibility choices, with memorable and dynamic attractions and a built environment of high quality design; and WHEREAS, the City desires to draw residents and visitors to the Downtown waterfront, catalyze greater Downtown activity and investment and better connect the waterfront to the rest of Clearwater; and WHEREAS, the Clearwater Downtown Redevelopment Plan is the guiding plan and regulatory document for the Downtown Planning Area and recently completed supporting documents such as Imagine Clearwater, the North Marina Area Master Plan, the Comprehensive Boating Plan, and the East Gateway District Vision Plan need to be integrated into the Clearwater Downtown Redevelopment Plan; and WHEREAS, it is advisable to reaffirm and update the Vision, Guiding Principles, Goals, Objectives and Policies of the Clearwater Downtown Redevelopment Plan to capture the intent of the recently completed supporting documents; and WHEREAS, recent developments have demonstrated the need for additional entitlements, to make redevelopment more economically feasible; and WHEREAS, the need to create additional opportunities for commercial and office development and to allow for unified corridors with similar intensity and density support an increase of intensity in key areas of Downtown; and WHEREAS, the City desires to increase overall housing production in Downtown, which is a component of addressing housing affordability concerns; and 3 Ord. No. 9103-18 WHEREAS, the City desires to encourage additional diversity in the Downtown housing stock in order to create more options for home buyers, particularly first-time home owners or seniors looking to downsize or for more affordable price points, while preserving neighborhood character and compatibility with a downtown neighborhood; and WHEREAS, these proposed amendments to the Clearwater Downtown Redevelopment Plan will afford greater redevelopment opportunity through increased density and intensity for the continued revitalization of the Downtown Planning Area by private enterprise and is consistent with the needs of the City as a whole; and WHEREAS, the North Marina Area Master Plan study area included both the northern portion of the Old Bay Character District and 41 parcels (9.671 acres) northward of the district, which are outside of the Old Bay Character District and Downtown Planning Area; and WHEREAS, it is advisable to expand the Downtown Planning Area and the Old Bay Character District to be inclusive of the entire North Marina Area Master Plan study area upon adoption of the Clearwater Downtown Redevelopment Plan; and WHEREAS, these proposed amendments repeal and replace Chapters 1 through 3 and appendices 2 through 6, and delete appendices 9 and10 from the Clearwater Downtown Redevelopment Plan; Chapter 4 and appendices 1, 7 and 8 are substantively unaffected by this ordinance, other than reformatting, and could be updated when the Board of County Commissioners completes its Tax Increment Finance 15-year review around October 2018; and WHEREAS, the Community Redevelopment Agency has reviewed the proposed amendments to the Clearwater Downtown Redevelopment Plan, as detailed in Exhibit “A,” and recommends approval to the City Council; and WHEREAS, the proposed amendments to the Clearwater Downtown Redevelopment Plan, as detailed in Exhibit “A,” was were reviewed by the Community Development Board, which is the local planning agency for the City of Clearwater for purposes of the Local Government Comprehensive Planning and Land Development Regulation Act, and the Community Development Board found the Proposed Plan to be consistent with the Comprehensive Plan of the City; and WHEREAS, the Plan conforms proposed amendments to the Clearwater Downtown Redevelopment Plan conform to the City’s general comprehensive plan; and WHEREAS, public input was gained through presentations and discussions in 2016 with Downtown Boards, organizations, and citizens; and at community meetings on April 26, 2017 and May 31, 2017, where attendees reaffirmed the proposed vision, guiding principles and increased entitlements for Downtown; now, therefore, 4 Ord. No. 9103-18 BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF CLEARWATER, FLORIDA: Section 1. Delete Appendices 9 and 10 from the current Clearwater Downtown Redevelopment Plan, and Chapters 1 through 3 and Appendices 2 through 6 of the The current Clearwater Downtown Redevelopment Plan is are repealed and shall be replaced by Exhibit “A,” which is hereby adopted; Chapter 4 and Appendices 1, 7 and 8 are substantively unaffected by this ordinance other than their reformatting and are included in Exhibit “A.” the Clearwater Downtown Redevelopment Plan, which is attached hereto as Exhibit “A,” and is hereby adopted Section 2. The City Manager or designee shall forward said the proposed Clearwater Downtown Redevelopment Plan amendments, as detailed in Exhibit “A,” to any agency required by law or rule to review or approve same. Section 3. Should any part or provision of this Ordinance be declared by a court of competent jurisdiction to be invalid, the same shall not affect the validity of the Ordinance as a whole, or any part thereof other than the part declared to be invalid. Section 4. This ordinance shall take effect immediately upon adoption, subject to the approval by the Pinellas County Board of County Commissioners and the Countywide Planning Authority. PASSED ON FIRST READING _____________________ PASSED ON SECOND AND FINAL _____________________ READING AND ADOPTED ___________________________ George N. Cretekos Mayor Approved as to form: Attest: ____________________________ ___________________________ Camilo Soto Rosemarie Call Assistant City Attorney City Clerk ClearwaterDowntown Redevelopment PlanDRAFT: December 29, 2017City of Clearwater Planning & Development DepartmentA Special Area Plan & Community Redevelopment Plan for the City of Clearwater Cover Photo Source: Mike Sanders, Bayview Hotel & Capitol Theatre, 1935Chapter 1 - IntroductionPurpose of this PlanHistory of ClearwaterPlanning for DowntownChapter 2 - Existing ConditionsThe Planning AreaLand UseProperty Ownership & Tax ExemptionsHistoric ResourcesDemographicsInfrastructureTransportation & ParkingPublic Recreation Facilities & Open SpaceExisting Downtown Redevelopment ProgramsInvestment in DowntownChapter 3 - Land Use / Redevelopment PlanVision & Guiding PrinciplesGoals, Objectives & PoliciesDowntown Character DistrictsDowntown Core DistrictOld Bay DistrictSouth Gateway DistrictProspect Lake DistrictDowntown Gateway DistrictHousing & Neighborhood ElementFuture Public Recreation Facilities & Open SpaceFuture Transportation & ParkingMaster Streetscape PlanMaster Wayfinding Plan222412121218182024273839394444465254606872768898102106124Chapter 4 - Plan ImplementationIntroductionRelationship of Downtown Plan to Community Development CodePublic Amenities Incentive PoolDowntown StrategiesCaptial Improvement Plan (CIP)Redevelopment IncentivesTax Increment Revenue ProjectionsAppendicesAppendix 1 - Expanded CRA Legal DescriptionAppendix 2 - Downtown MilestonesAppendix 3 - Existing Land Use lassifications, Methodolgy and Distribution by Character DistrictAppendix 4 - Demographics Methodology and EstimatesAppendix 5 - Utilities MapsAppendix 6 - Community Redevelopment Area Boundaries and Periphery Plan MapAppendix 7 - Build-Out Scenarios (2004)Appendix 8 - Downtown-Gateway Action Plan128128128129130136144153166166167169171174181183185Contentsi Acknowledgements & AmendmentsCLEARWATER CITY COUNCILGeorge Cretekos, MayorHoyt Hamilton, Vice MayorDoreen CaudellBob CundiffBill JonsonCLEARWATER COMMUNITY REDEVELOPMENT AGENCYGeorge Cretekos, ChairDoreen Caudell, TrusteeBob Cundiff, TrusteeHoyt Hamilton, TrusteeBill Jonson, TrusteeCITY ADMINISTRATIONWilliam B. Horne II, City ManagerJill Silverboard, Deputy City ManagerMicah Maxwell, Assistant City ManagerPamela K. Akin, City AttorneyCOMMUNITY DEVELOPMENT BOARDJohn Funk, ChairMichael Boutzoukas, Vice-ChairDavid E. AllbrittonChristopher AnuszkiewiczDarrell Michael FlaneryMary A. LauJohn QuattrockiCharles Reed Haydon, AlternatePLANNING & DEVELOPMENT DEPARTMENTMichael Delk, AICP, DirectorGina L. Clayton, Assistant DirectorLauren Matzke, AICP, Long Range Planning ManagerEllen “Ella” Crandall, ISA Certified Arborist, Senior Planner, Project ManagerKyle Brotherton, Senior PlannerMark T. Parry, AICP, Senior PlannerZain Adam, Ph.D., PTP, Senior PlannerWith Assistance From:ECONOMIC DEVELOPMENT & HOUSING DEPARTMENTDenise Sanderson, DirectorCharles “Chuck” Lane, Assistant DirectorJoe Riddle, Housing ManagerCOMMUNITY REDEVELOPMENT AGENCY STAFFAnne Fogarty-France, Downtown ManagerLaura Canary, Economic Development CoordinatorAmendedNovember 20, 2003 Ordinance 7231-03November 4, 2004 Ordinance 7343-04February 3, 2005 Ordinance 7367-05January 15, 2009 Ordinance 8014-09September 9, 2010 Ordinance 8192-10June 1, 2016 Ordinance 8885-16Adopted: September 18, 2003; Ordinance 7153-03 Importance of Downtowns in the 21st CenturyI do not know what the future of downtown is, but here is what I am certain of:• If we are to have an effective environmental policy, downtowns are important.• If we are to have an effective transportation policy, downtowns are important.• If we are to have meaningful historic preservation, downtowns are important.•If we want Smart Growth, downtown are not only important but also irreplaceable.• If a local official wants to claim the treasured mantle of fiscal responsibility, downtown revitalization is imperative.•If we want to avoid Generica, downtown is essential to establish differentiation.• If the community is trying to compete in economic globalization without being swallowed by cultural globalization, downtown revitalization has to be central to the strategy.•If new businesses, innovative businesses, and creative businesses are going to be fostered and encouraged, a community will need a downtown where that can take place.• If we are able to have buildings with meanings, buildings with value, buildings with values, they will be downtown.• If we are to have public places of expressing, we need a downtown.• If a community is going to embrace diversity instead of hide from it, celebrate diversity instead of deny it, then that has to take place downtown, it ain’t gonna happen anywhere else.(Donovan Rypkema, Journal of the American Planning Association, Winter 2003. Photo Source: (Left) Mike Sanders, Cleveland Street Businesses, 1934IntroductionPurpose | History | Plan for Downtown Clearwater Downtown Redevelopment Plan2 of 189 | December, 2017Chapter 1. IntroductionPURPOSE OF THIS PLANThis Plan lays the groundwork to reclaim Downtown as Clearwater’s historic urban core and heart of the City. The success and health of Downtown is directly linked to the health and success of the overall City. Downtown must be revitalized for the benefit of the whole city and all citizens. Public spaces and community gathering places are integral to strong communities, positive interaction and sense of place and pride. The residents of Clearwater will have an inviting Downtown that enhances their quality of life. Revitalizing Downtown is not looking to the past to duplicate how our forefathers utilized it, but building on our history to position Clearwater to meet future demands.This Plan serves as a Special Area Plan in accordance with the Countywide Rules of Pinellas County. As a Special Area Plan, this document is the land use plan for Downtown, guiding future development and redevelopment through goals, objectives and policies and by the establishment of development potential for five unique Character Districts. The Downtown Planning Area is delineated on the Countywide Plan Map as an Activity Center, and on the Transit Oriented Land Use Vision Map with the Special Center subcategory, a designation established in the updated Countywide Rules (adopted August 7, 2015) to recognize previously adopted Special Area Plans throughout Pinellas County. This Plan also serves as a Community Redevelopment Plan in accordance with Florida’s Community Redevelopment Act for a portion of the Downtown Planning Area. As a Community Redevelopment Plan, this document is the Capital Improvement Plan and also sets the policies that guide the future actions and projects of the City’s Community Redevelopment Agency. This Plan is implemented through the Community Development Code and its Downtown Zoning District and Development Standards. Quality urban design required by the Code is imperative to meeting the goals of this Plan.HISTORY OF CLEARWATERJohn Nolen Clearwater was one of the early Florida cities that recognized the need for a City plan, and in 1925 hired John Nolen, a nationally known planner, to prepare a plan for the City. Clearwater leaders determined that Nolen could provide the City with a competitive advantage: a comprehensive plan, a regional plan connecting the City with its environs, and a Downtown plan focused on the waterfront. Nolen’s 1926 plan was comprised of a Comprehensive City Plan and included a street thoroughfare system, locations of schools, playgrounds and parks, a civic center and Downtown business district as well as industrial areas north and south of Downtown. It also suggested rerouting the railroad tracks from Downtown to the east and establishing a regional rail system, development of an airport and cemetery, and establishment of zoning and subdivision controls. Many of Nolen’s concepts remain valid today, most importantly, the recognition of the waterfront as the City’s premier natural asset, the significance of Downtown as the center of the City, and a multi-faceted park system to serve all citizens. Growth of Florida The growth and changes in Clearwater over the years can be attributed to major events that had a similar effect in other Florida cities. Florida’s growth in the early 1800s had been primarily limited to the northern part of the State, with Pensacola, Tallahassee and St. Augustine being the main population centers. In 1842, the United States passed the Armed Occupation Act which granted 160 acres of land to any head of household or single man who would bear arms, live in Florida for five years and cultivate the land. This Act drew pioneers to settle the Clearwater area and central parts of Florida. During the decades of the 1880s and 1890s, the Victorian interest in healthful living enticed many tourists to Florida for the climate. The permanent population grew as many tourists made Clearwater their home. During this same time period, railroad expansion and the development of resort hotels in Florida cities accommodated tourists in fine style. In 1888, Russian immigrant Peter Demens completed the Orange Belt Railway through Clearwater, connecting St. Petersburg with Oakland, Florida, a distance of 117 miles. The Orange Belt Railway had railroad depots in both Clearwater and Palm Harbor. Henry Bradley Plant purchased Demens’ railway in 1897 and incorporated it into his existing railroad system which traversed the west coast of Florida. Due in part to the success of the 1888 Tampa Bay Hotel on the banks of the Hillsborough River, Plant decided to add another hotel to his Florida chain and selected the bluff in Belleair for the Belleview Biltmore Hotel. Opening in 1897 as the world’s largest occupied wooden structure, the Belleview Biltmore Hotel delivered its guests December, 2017 | 3 of 189Chapter 1. IntroductionPhoto Sources (Top to Bottom): Unknown, Postcard View, 1940s; Mike Sanders, Cleveland St. Army, 1940s; Unknown, Bank of Clearwater, 1940svia private railroad tracks directly to the plush hotel. The success of the Belleview Biltmore Hotel assisted in the growth of both Belleair and Clearwater.Florida Land Boom Clearwater experienced significant growth and public investments during the 1910s and 1920s. With the separation of the Pinellas Peninsula from Hillsborough County in 1912, Clearwater gained another distinction by becoming the seat of Pinellas County government. The first wooden courthouse constructed in 1912 was replaced by the 1917 courthouse at its current location on Fort Harrison Avenue at Court Street. Although a fire in 1910 destroyed significant parts of Downtown Clearwater, the City quickly rebuilt under strict building codes that required brick construction. Clearwater benefited from the Florida Land Boom during the 1920s, with the 1926 construction of the City’s first skyscraper, the Fort Harrison Hotel, the completion in 1927 of the Million Dollar Causeway from Downtown to Clearwater Beach and significant residential development on the mainland and the Beach. Unfortunately, like other Florida cities, Clearwater also suffered the economic difficulties of the Florida Bust and subsequent nationwide Great Depression beginning in 1929. During this difficult economic time, the federal government commissioned the construction of the main Post Office on Cleveland Street which was completed in 1933. This Mediterranean Revival style building still occupies a prominent location Downtown at the intersection of Cleveland Street and East Avenue. Post WWII Population Boom National events of the 1940s through the 1960s affected Clearwater in many ways. From the 1940s through the 1950s, World War II and its aftermath consumed the City and nation. In Clearwater and in much of Florida, the military activity assisted the local economy. Military personnel occupied the Belleview Biltmore and the Fort Harrison Hotels. After the war ended, Florida experienced a population boom, as did Clearwater. Another boon to Clearwater’s local economy during this time was the City’s selection as the spring training home of the Philadelphia Phillies baseball team in 1955. Also in the 1950s, the Chamber of Commerce started the Fun ‘N Sun Parade and Festival which originated as a tourist draw and now provides recreational activities for residents and tourists alike over a one month period. Movement out of Downtown The opening of Clearwater’s first shopping center in 1959 foreshadowed events to come. The Cleveland Plaza at the intersection of Cleveland Street and Missouri Avenue was constructed at a location relatively near but outside of the traditional Downtown. Unfortunately, other commercial businesses had already begun and continued their exodus from Downtown, with many locating to the “new” commercial centers along U.S. Highway 19 North. Clearwater Downtown Redevelopment Plan4 of 189 | December, 2017The City of Clearwater initially established a Community Redevelopment Agency for Downtown and adopted the Redevelopment Plan for Downtown Clearwater in 1981. The blighting factors identified for the Community Redevelopment Area (CRA) in 1981 included:xA predominance of defective or inadequate street layout by modern standards;xFaulty lot layout that limited the nature and extent of uses of properties;xDeterioration of sites, buildings, and other improvements;xDiversity of ownership which prevented the free alienability of economically feasibly sized properties; xUnusual conditions of title based on large institutional holdings which restricted the market supply and size of private enterprise land; andxA static tax base, with conditions of ownership which signified a continuing relative decline in the Downtown area’s values.At the original inception, the CRA comprised 247 acres stretching from Clearwater Harbor to the Cleveland Plaza shopping center vicinity and from Drew Street on the north to Chestnut Street on the south, and encompassed the traditional business district, Coachman Park, the Pinellas County Courthouse and government center, and significant vacant and underutilized land available for redevelopment. Periphery Plans, Downtown Plan Updates and CRA ExpansionIn 1993, the City adopted the Downtown Clearwater Periphery Plan which addressed planning issues for four areas adjacent to the Downtown. In 1995, the City approved a plan amendment to designate these four areas as Central Business District on the Future Land Use Map, thus linking the periphery areas to the traditional Downtown area. These actions recognized the integrated relationship between the core of Downtown and its surrounding residential areas. In 1995, the City Commission also approved a major revision to the 1981 Redevelopment Plan for Downtown. While retaining the original boundaries of the 1981 Plan, the newly named Clearwater Downtown Redevelopment Plan significantly expanded the policies for Downtown. The 1995 Plan established a Land Use Plan Map for the Downtown that designated allowable uses on a parcel-by-parcel basis. The Plan also established development potential for properties, defining commercial intensity and residential density by sub-area for the Downtown through the creation of Districts. A major portion of the 1995 Plan was devoted to redevelopment projects with implementation to be accomplished by either the public or private sector. In 2001, the City completed a major update to the Downtown Clearwater Periphery Plan, adopting it as a Special Area Plan for the periphery areas. This better defined the land use plan and development potential for the four periphery areas and provided policy guidance for private redevelopment. As In 1968, the Sunshine Mall opened as the City’s first enclosed mall, closely followed by the Clearwater Mall in 1973 and the Countryside Mall in 1975. These three events symbolized two major changes in Clearwater: the movement of commercial activity out of Downtown to the east and the movement of the residential center from the center of town to the north as a result of the Countryside residential area created by national developer U.S. Home, Inc. While the new residential area was greatly needed and reflected the countywide northward growth trend, these events had a negative impact on Downtown. The decline of the traditional downtown occurred in Clearwater, as in many American cities, fueled by these changes and the increased availability of private cars and the lack of mass transit systems. PLANNING FOR DOWNTOWNFirst Downtown Plan and CRA In 1970, Clearwater was an early leader in Florida’s downtown revitalization field as demonstrated by the establishment of a Downtown Development Board (DDB) through a special act of the Florida Legislature. In 1971, Clearwater citizens approved special taxing district powers for the DDB. In 1976, the DDB and the Clearwater City Commission jointly commissioned a major Downtown planning study. The Plan for Downtown Clearwater was presented in 1977 to the City by the principal consulting firm RTKL Associates, Inc. The final Plan included an urban design component, policy direction through goals and objectives and an implementation program. December, 2017 | 5 of 189Chapter 1. IntroductionPhoto Sources (Top to Bottom): Unknown, Cleveland St., 1940s; Maryce Garber, Cleveland St., 1950; Patti Bianco, Royal Palms Motel, 1950sa Special Area Plan, it served the same land use planning function for the periphery areas that the Clearwater Downtown Redevelopment Plan did for the original Downtown boundaries. In 2002, the City prepared a Findings and Declarations of Necessity Analysis for the 200-acre area generally east of the existing CRA, known as the “Gateway Expansion Area”, which included land governed by the Southeast and Southwest Expansion Areas of the Clearwater Downtown Periphery Plan. The study clearly demonstrated the need for revitalization outside of the existing CRA boundaries and documented the following conditions: xPoor lot layout relating to size, accessibility and use;xSite and environs deterioration;xInadequate and outmoded building density patterns;xDefective or inadequate street configurations, transportation facilities and parking facilities; xExcessive emergency calls;xUnsanitary and unsafe environment;xExcessive violations of the Florida Building Code;xDiversity of ownership;xFalling lease rates;xHigh residential and commercial vacancy rates; and xLack of appreciable increase in the past five years of the aggregate assessed values.These findings allowed the City to declare the Gateway Expansion Area to be a slum or blighted area, which the Board of County Commissioners approved that same year, thereby expanding the CRA boundaries in 2002, and bringing the total CRA size to 449 acres. In 2004 a major update to the Clearwater Downtown Redevelopment Plan was completed which incorporated the Gateway Expansion Area (expanded CRA) and the Northwest and Southwest Areas of the Clearwater Downtown Periphery Plan which were not previously integrated into the CRA into the Plan and the Downtown Planning Area. With this expansion, the total Downtown Planning Area expanded to 545 acres, illustrated on the CRA Boundaries and Periphery Plans Map in Appendix 6. At this time six Character Districts were established, as well as the framework for development in each District. The Plan maintained the Downtown Core as the traditional City center and identified the gateways to Downtown, urban neighborhoods and opportunities for new residential, office and commercial development. The Plan established flexibility for future growth with site plan and design review to implement the design guidelines. The overall maximum development potential permitted within Downtown was reduced from the 1995 Plan. The City retained the balance of that excess potential to allocate to specific projects that make a major contribution to Downtown through the creation of the Public Amenities Incentive Pool for the life of the Plan. Clearwater Downtown Redevelopment Plan6 of 189 | December, 2017such as a hotel and restaurants; enhancing the area’s unique character through new development that is compatible in scale and form with the historic buildings; putting people first; establishing a cultural hub; promoting a better environment; and unlocking development potential. Also in 2016 the Clearwater Comprehensive Boating Plan was developed by Moffatt & Nichol. ULI recommended the preparation of the plan as a first step in the long-range objective of making Clearwater, including its Downtown waterfront, the boating capital of the region, if not the State. At the Clearwater Harbor Marina, the plan recommended adding an attraction to draw boaters and non-boaters to the waterfront year-round, reorganizing parking, providing public restrooms, enhancing security, adding public art and artistic lighting, and providing wayfinding. Because the Comprehensive Boating Plan and the North Marina Area Master Plan were completed concurrently, the plan provided more detailed recommendations to improve facilities at the Seminole Boat Ramp and surrounding Marina, including: adding a waterfront hotel with boat slips for guests; enhancing the existing park and marina store; constructing additional staging docks and additional queuing docks to enhance the ramp’s functionality; maintaining parking for cars/trailers, even if it is moved to adjacent properties; providing public restrooms; and enhancing security. actions and tools needed to achieve the vision over a 20-year horizon. In 2017, the East Gateway District was renamed the Downtown Gateway. In 2014, the City contracted with the Urban Land Institute (ULI) to evaluate the City’s vision and Downtown redevelopment strategies. The ULI Advisory Services Panel’s final report recommended developing several additional plans including a comprehensive boating plan, a study of the “north marina area,” and a master plan for the waterfront Bluff. The ULI noted in their report that the Old Bay neighborhood has a unique mix of housing types that give a rare taste of “old Florida”, and the City should invest and enhance the existing community fabric consisting largely of historic bungalows and shotgun-style houses. ULI recommended comprehensively planning for the area, including the Seminole Boat Ramp area, to provide value to both the residents of the neighborhood and the City. In 2016 the City worked with Stantec to prepare the North Marina Area Master Plan, with a study area consisting of a majority of the Old Bay Character District and land northward. The North Marina Area Master Plan’s new vision for the area balances the needs of area residents and the boating community and also identifies appropriate redevelopment options. The public was engaged throughout the development of a preferred design concept for the area and implementation strategies for the plan. The plan identified eight key objectives: protecting views of water and bluff; improving connectivity to Downtown through roadway and trail improvements; creating a waterfront destination through the development of uses that attract visitors, residents and boaters, New Bridge In 2005 a new fixed span bridge replaced the existing drawbridge connecting mainland Clearwater with the Beach. Along with the benefit of improving vehicular circulation to the Beach, the bridge alignment and access has significantly impacted Downtown. Through-traffic was redirected from Cleveland Street to the one-way pair of Court and Chestnut Streets on the southern edge of Downtown. This allowed Cleveland Street to be reclaimed as a local street and regain its place as Downtown’s premier shopping street. These changes also created a new eastern gateway into Downtown located at the intersection of Gulf to Bay Boulevard, Highland Avenue and Court Street (also known as Five Points). Recent Plans and Studies The Clearwater Downtown Redevelopment Plan has been amended several times since 2004 to address the changing conditions of Downtown and to further improve the effectiveness of the Plan. Additionally, the City has completed several plans for smaller areas within Downtown that need to have their vision and policies incorporated into the Clearwater Downtown Redevelopment Plan. In 2011, the City hired Gensler to develop the East Gateway District Vision Plan. This plan utilized a neighborhood market/economic analysis to define the economic base for market-supportable revitalization efforts in the District. Community outreach and stakeholder involvement culminated in a community design charrette that provided a vision for the area and a concept plan and policy framework that identified specific implementation December, 2017 | 7 of 189Chapter 1. IntroductionThe 2014 ULI report identified the Bluff – the highest escarpment along the water’s edge in the State - as a prominent and exceptional asset on which the City could build its brand, and recommended that the City prepare a guiding vision for the area adjacent to the waterfront and Bluff. In 2017, the City completed Imagine Clearwater, which established a vision for Downtown’s waterfront as an active, authentic, iconic civic and open space that celebrates Clearwater’s history, natural beauty, culture and diversity and anchors an economically vibrant Downtown. The plan focused on developing a dynamic waterfront, an activated Bluff and a connected Downtown, and included a master plan for the area that proposed a redesigned waterfront park providing users a series of distinct experiences through several unique areas. To achieve a successful waterfront, the plan recognized that Coachman Park needs an active edge, and identified three City-owned parcels on the Bluff as important catalyst sites: the Main Library, to be activated with additional community uses to leverage its waterfront views; the Harborview Center, proposed to be demolished to create a civic gateway to the park and provide a location for private redevelopment – rental housing or a boutique hotel – to create more activity; and City Hall, to be relocated within Downtown to facilitate a mixed–use development or incorporate a cultural use on the prime waterfront property, to further activate Downtown. The plan identified that the corner of Cleveland Street and North Osceola must be 100% active and that pedestrian and bicyclist mobility is at the foundation of park activation and Downtown connectivity. Core elements of the master plan require charter referendum to accomplish. In November 2017, City residents approved the first referendum to allow construction and maintenance of certain improvements to support active and passive uses of the Downtown waterfront. 2018 Downtown Plan UpdateThe 2018 update of the Downtown Redevelopment Plan reaffirms the vision for Downtown as the urban core and heart of the City. It simplifies properties’ development potential so it is not based on lot size, which eliminates the need for lot consolidation in certain Districts. The Plan increases development potential in all Character Districts. In those Character Districts that are primarily low-scale and/or single family residential, density is increased to 35 dwelling units per acre. The density of 35 dwelling units per acre has been identified as being conducive for “missing middle housing” consisting of multiplexes, townhouses and bungalow courts which offer a variety of needed housing types. This increase in density supports the desired residential infill development on small sites that is typical in these neighborhoods, compatible with the existing single family neighborhoods and consistent with urban downtowns. In some instances the density may allow for a single additional unit on an existing parcel and is a gentle way to add density to an urban neighborhood, while also making existing sites and buildings more viable for development. Photo Sources (Top to Bottom): Maryce Garber, Memorial Causeway, unknown; Unknown, Post Office, 2000s; Pinellas County Economic Development, Capitol Theatre, 2014 Clearwater Downtown Redevelopment Plan8 of 189 | December, 2017More specifically, the 2018 update will expand the Old Bay Character District to include 9.671 acres that were included in the study area of the North Marina Area Master Plan, but not in the Downtown Plan Area. The Old Bay expansion will increase the Downtown Planning Area from 545 acres to 555 acres. The 2018 update also combines the Town Lake Residential and Town Lake Business Character Districts into one District, Prospect Lake, named for the re-named City stormwater pond and park. This reduces the number of Character Districts from six to five. The boundary revisions are illustrated on Map 1.1. Formerly, the Town Lake Business Park Character District encouraged suburban style office development, which, apart from Frank Crum, did not occur and is not anticipated to happen now. A new direction for the District is envisioned and is appropriate for all properties within the two former Town Lake Districts. Density is increased in the new Prospect Lake Character District. Previously, several developments in the area needed to utilize units from the Public Amenities Incentive Pool to obtain additional density, and where a higher density is appropriate and supported that density should be clear and accessible. The western edge of Prospect Lake Character District received the greatest increase in density to 75 dwelling units per acre, consistent with the Downtown Core Character District, to unify Myrtle Avenue as a corridor. Additionally, this area of the Prospect Lake Character District increased to 2.5 FAR to support office and commercial development. The update clearly defines the acceptable heights that were formerly hinted at in Plan policies, reflecting the importance of protecting the historic single-family character of the Grove Street neighborhood while supporting more intense and taller development along more major streets. And, as previously mentioned, the East Gateway District has been rebranded as the Downtown Gateway, this Plan updates the Character District name accordingly. To implement many of the updated goals of the Plan, the Downtown zoning district in the Community Development Code must be updated to allow many uses by right and to establish design standards for Downtown properties. Implementation will also require Future Land Use Map and Zoning Atlas amendments to sections of the Old Bay, Prospect Lake, and Downtown Gateway Character Districts to reclassify them as Central Business District (CBD) future land use and Downtown (D) District, thereby unifying the entire Downtown Planning Area. The Design Guidelines have been removed from this Plan and will be incorporated in the Downtown (D) Zoning District in the Community Development Code as design standards. Since the adoption of the 2004 Downtown Redevelopment Plan many notable goals have been achieved and projects developed including the Cleveland Streetscaping Phase I and II, Prospect Lake Park, Station Square Park, Main Library, Capital Theatre, Downtown Marina, Glen Oaks Stormwater Detention Facility and the Nolen apartments. Clearwater is poised for great accomplishments in Downtown. All of the elements are in place for success: a waterfront with exceptional natural beauty, locational advantages, committed citizens and determined elected officials. Let this Plan set the course towards the future success of Downtown. Notes: The section on planning history is based on John Nolen’s Comprehensive City Plan of 1926 and the research on Nolen by Bruce Stephenson, Rollins College. The Clearwater history section relied in great part on Michael Sanders’ book Clearwater, A Pictorial History. Cleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Bay BlvdHighland AveMartin Luther King, Jr AveTurner StWMap 1.1Proposed Expansion & New DistrictsClearwater DowntownRedevelopment PlanSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 20171 inch = 1,000 feet®Character Districts & Expansion Area2004 DistrictsDowntown CoreEast GatewayOld BaySouth GatewayTown Lake Business ParkTown Lake Residential2018 DistrictsDowntown CoreDowntown GatewayOld BayProspect LakeSouth Gateway2018 Proposed Expansion2018 Proposed Expansion Existing ConditionsPlanning Area | Land Use | Historic Resources |Demographics | Transportation | Recreation | Investment Clearwater Downtown Redevelopment Plan12 of 189 | December, 2017Chapter 2. Existing ConditionsTHE PLANNING AREAThe Clearwater Downtown Redevelopment Plan currently governs 545 acres comprised of 2,374 parcels, however the proposed Old Bay Expansion area was included in the following analysis, bringing the total to 555 acres, as seen on Map 2.1. This Plan serves a dual function as both the Special Area Plan for the entire Downtown Planning Area and as the Community Redevelopment Plan for the City’s Community Redevelopment Area (CRA) which comprises 79.5% (441 acres) of the Downtown Planning Area. Over the past 20 years, the CRA has had a positive impact on Downtown as evidenced by the public and private investment detailed in this Chapter. This Plan is intended to guide Downtown redevelopment for 20 years. LAND USEDowntown is characterized by a variety of uses with varying intensities and densities. Form and function vary depending on the specific location within the Downtown. The traditional business core is the most intensely developed area with a mix of historic buildings and new construction. Downtown enjoys a unique location on the Bluff overlooking Clearwater Harbor with a significant public park along that waterfront. There are also near-town neighborhoods rich in Florida vernacular architecture and neighborhood, supporting commercial areas. Despite these amenities that should make Downtown Clearwater a desirable place to live, work and play, there are several challenges that have limited economic growth and development in Downtown. From an economic development perspective, existing Class A office space does not meet the needs of local businesses and many property owners have failed to make improvements to existing structures that information technology, financial and professional services, headquarters, or other targeted industries require. To prevent existing businesses from leaving the City in search of preferable space and in order to create the conditions to attract new firms, higher intensity employment opportunities must be possible on new and existing sites. Establishing a stock of new and re-developed of the professional buildings will help the City attract target industries and accommodate higher wage jobs, which, in turn, will diversify the City’s tax base and improve the demographic mix. To create a vibrant Downtown neighborhood, dense residential development is needed. Additional housing choices within the Downtown Core will strengthen it as an “18-hour” neighborhood, supporting nightlife, entertainment and restaurants and other late-night businesses. Throughout Downtown a variety of housing types, at varying scales and prices, is needed to attract all income groups and to contribute to the customer base for neighborhood commercial establishments.Further, from a land use perspective, the lack of available sites in Downtown that do not have other constraints, such as potential environmental contamination (e.g., brownfields), size constraints (e.g., previously platted residential parcels), or older infrastructure is a significant challenge for both office and residential development. Downtown has a wide variety of existing land uses, illustrated on Map 2.4, a quarter being residential (28.1%), followed by office (12.6%) and then retail (8.6%). There are many “greyfield” sites that are developed but underutilized as a result of functional obsolescence. Outside of the Downtown Core, most commercial and office uses are in one story, surface parked buildings, which have the potential for profitable redevelopment as mixed-use, and could spur additional economic growth. vacant land, which accounts for 13.2% of the Downtown, also presents opportunities for infill development but may have other actual or perceived challenges. The largest areas of vacant land are found within the Prospect Lake and Old Bay Character Districts, with a scattering found throughout the other Districts. Governmental uses are found primarily concentrated within the Downtown Core and occupy 5% of the total land area. Institutional uses make up about 8% of the existing land use in Downtown, and include places of worship, schools, and other non-profit/charitable services. Vehicle service and industrial uses make up about 6% of Downtown’s land area, and are generally distributed throughout the Character Districts. Prior to the 1999 Community Development Code, vehicle service and industrial uses were permitted uses; however, they are now nonconforming. Vehicle service uses can typically be found around the Martin Luther King, Jr. Avenue corridor within Prospect Lake; and the industrial uses can largely be found along the Pinellas Trail (old railroad corridor) in the Old Bay District and also in the Prospect Lake District. Cleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Bay BlvdHighland AveMartin Luther King, Jr AveTurner StWMap 2.1Downtown Plan OverviewClearwater DowntownRedevelopment PlanSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 20171 inch = 1,000 feet®Proposed Old Bay Expanson Cleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Bay BlvdHighland AveMartin Luther King, Jr AveTurner StWMap 2.2Future Land UseClearwater DowntownRedevelopment PlanSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 20171 inch = 1,000 feet®Future Land Use(CBD) Central Business District(CG) Commercial General(I) Institutional(R/OG) Residential/Office General(R/OS) Recreation/Open Space(RH) Residential High(RM) Residential Medium(RU) Residential UrbanProposed Old Bay Expansion Cleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Bay BlvdHighland AveMartin Luther King, Jr AveTurner StWMap 2.3ZoningClearwater DowntownRedevelopment PlanSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 20171 inch = 1,000 feet®ZoningCommercialDowntownHigh Density ResidentialInstitutionalLow Medium Density ResidentialMedium Density ResidentialMedium High Density ResidentialOfficeOpen Space/RecreationPreservationProposed Old Bay Expansion Cleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Bay BlvdHighland AveMartin Luther King, Jr AveTurner StWMap 2.4Existing Land UsesClearwater DowntownRedevelopment PlanSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 20171 inch = 1,000 feet®Existing Land UsesSingle FamilyTwo FamilyMulti FamilyRetailOfficeInstitutionalOvernight AccommodationsVehicle ServicesIndustrialGovernmentalUtility/InfrastructureRecreationParkingProposed Old Bay ExpansionVacant December, 2017 | 17 of 189Chapter 2. Existing Conditions“If you plan cities for cars and traffic, you get cars and traffic.If you plan for people and places, you get people and places.”- Fred Kent, Project for Public Spaces Clearwater Downtown Redevelopment Plan18 of 189 | December, 2017Surface and structured parking occupies about 5.5% of the land in Downtown, and is especially prevalent along the waterfront in the Downtown Core. Recreation and open space uses account for 6.6% of the land mostly found west of Myrtle Avenue. Rounding out the existing land uses are overnight accommodations (3.1%) and utility/infrastructure (3.4%). The City’s Future Land Use Map designates the majority of the land within Downtown as Central Business District (CBD) while the eastern section has a variety of future land use designations, as illustrated on Map 2.2. The most prevalent zoning district in the Downtown is the Downtown (D) District while the remaining zoning districts occupy a smaller portion of Downtown and are illustrated on Map 2.3. Existing Zoning Districts. The majority of properties not designated as Central Business District/Downtown are located in the Downtown Gateway Character District with small portions in the Prospect Lake Character District. Additionally there is an area proposed to be incorporated into the Downtown Plan Area in the Old Bay Character District that is currently not designated as Central Business District/Downtown District. The 2018 update proposes to amend the future land use and zoning designations of the proposed expansion area and all properties in the Downtown Planning Area not currently Central Business District (CBD) future land use and Downtown (D) Zoning district as such. This will unify the Downtown and bring the Downtown Planning Area under a consolidated regulatory framework which allows more flexibility in establishing entitlements to implement the vision of the Plan. PROPERTY OWNERSHIP & TAX EXEMPTIONSBecause of the urban form and mix of uses generally found in downtowns, they typically contain the most economically productive parcels in a City, and provide the highest value per acre contribution to the tax base. As the government center for Pinellas County and the City of Clearwater, it is not unexpected that the County and City, in addition to the CRA, have larger property holdings in Downtown. The City and CRA’s properties primarily include governmental uses, recreational uses, parking, and vacant land, whereas the County’s properties are all governmental uses and parking. These properties are 100% tax-exempt, but future redevelopment of City/CRA-owned vacant parcels may result in these properties being added back to the tax rolls. Downtown Clearwater has a large number of properties that also receive tax exemptions from all or a portion of the taxable value. Several nonprofit organizations and non-governmental institutions, such as churches and schools, throughout Downtown utilize widely varying ad valorem tax exemptions (e.g. 0.24% to 100%). Such exemptions reduce the revenue collected through tax increment financing, thereby limiting the CRA’s ability to reinvest in Downtown through this funding mechanism. HISTORIC RESOURCESDowntown Clearwater maintains much of its heritage through the existing buildings in the traditional Downtown and nearby residential neighborhoods. While the preservation of historic resources has been identified as a Downtown revitalization strategy, significant progress has not been made. At present, three properties are listed in the National Register of Historic Places (NRHP): xCleveland Street Post Office - 650 Cleveland StreetxOld Pinellas County Courthouse - 315 Court StreetxMount Olive African Methodist Episcopal Church - 600 Jones StreetTwo studies documenting cultural resources have been conducted but at this time are outdated. In 1998, a historic preservation survey and planning project was conducted for the Clearwater Central Business District and Old Clearwater Bay Neighborhood. While the boundaries of that study are not coterminous with the current Downtown Plan Area, significant areas within the Plan area were surveyed. Concentrations of historic resources were identified in the Downtown Core, Old Bay, Prospect Lake and South Gateway Character Districts.Most of the resources identified in the 1998 survey were either single family or multi-family buildings and were mainly constructed between 1920 – 1949. Over half of the buildings identified were considered “contributing” resources to a historic December, 2017 | 19 of 189Chapter 2. Existing Conditionsdistrict, meaning the building contributes to the historic and architectural character of a larger area but alone may not be eligible for inclusion in the NRHP. This survey identified the North Ward Elementary School as being potentially eligible for listing in the NRHP and noted that a previous survey work identified six other properties as eligible. The study also recommended targeting certain historic buildings in the Downtown Core for rehabilitation to help jumpstart revitalization efforts. In 2005, a Historic Resource Reconnaissance Survey of the Downtown Core was prepared by Janus Research to identify historic resources that are potentially eligible for local designation or listing in the NRHP. The study also reevaluated conditions of properties that had previously been determined to be eligible for listing. Of the six resources that had been previously identified as eligible, only the Peace Memorial Presbyterian Church located at 110 South Fort Harrison Avenue remains eligible. Several of the previously identified eligible buildings have been demolished including the Calvary Baptist Church, 331 Cleveland Street, the Seaboard Air Line Railroad Depot, 657 Court Street and the Haven Street House, 400 Pierce Boulevard. The remaining resources have been altered to such a degree that they no longer meet the strict criteria required for designation. At this time the Pinellas County Courthouse is the only property designated as historic by the City of Clearwater. The other two National Register properties were identified by the 2005 report as eligible for local designation, along with the following properties: Photo Source (Bottom): Buell & Elligett, P.A.xCoachman Building, 503 Cleveland StreetxGuaranty Title and Trust Building, 411 Cleveland StreetxFt. Harrison Hotel, 210 South Fort Harrison AvenuexClearwater Masonic Lodge 127, 408 South Garden AvenuexBank of Clearwater Building, 500 Cleveland StreetThe study also identified 21 resources concentrated on Cleveland Street and Fort Harrison Avenue that could be rehabilitated and/or restored to gain contributing status within a historic district. Due to the fact that properties have been demolished, renovated and deteriorated, since the time of both studies and new properties have become eligible to be considered historic (50 years old), a new planning and eligibility study is warranted. Clearwater Downtown Redevelopment Plan20 of 189 | December, 2017DEMOGRAPHICSPopulationDowntown experienced a significant increase in population between 2000 and 2010, from 1,256 residents to 4,974 residents, which was primarily concentrated in the Downtown Gateway District (formerly the East Gateway). Current population estimates are slightly lower at 4,430 residents, where limited population growth has occurred since 2010 in the Downtown Core and South Gateway Districts, but the remaining Districts have shown declines. Graph 2.1 summarizes population in the Character Districts. This growth did not result in a diversification of Downtown’s resident population, a fact reflected in the recent demographic data collected during the ACS 2011-2015 estimates. Graphs 2.2 and 2.3 summarize age, race and ethnicity of Downtown’s population. According to the ACS 2011-2015 estimates, Downtown has seen an increase, as a percentage of the population, in the proportion of white residents since 2000 (from 73.8% to 81.5%), while the proportion of black or African American residents declined slightly (11.9% to 11.8%) and the other racial populations, including Asian, American Indian, and those identifying as two or more races or some other race, declined more significantly (14.3% to 7.3%). However, during this same timeframe, Downtown saw an increase in its Hispanic, Latino or Spanish origin population from 28.2% in 2000 to 46%. Downtown has a significantly higher percent of population identifying as Hispanic, Latino or Spanish origin compared to the City as a whole (13.9%), and the majority of this population within Downtown (92.9%) lives in the Downtown Gateway District.Downtown residents are younger on average compared to the City (median ages of 38.2 years and 44.8 years, respectively). This demographic varies by Character District. The Downtown Gateway has the youngest median age (31.7 years), whereas both Prospect Lake and the Downtown Core Districts have relatively older populations with median ages of 61.1 years and 64.1 years respectively. Generally, throughout Downtown there is a slightly higher percentage of males, although the Downtown Core’s population is 63.1% female. Graph 2.1. PopulationDowntownCoreOld BaySouthGatewayProspectLakeDowntownGateway4644626724193772797454637064843812,0733,5973,0355001,0001,5002,0002,5003,0003,5002000 Census (3,718 persons)2010 Census (4,974 persons)2011-2015 ACS (4,430 persons) December, 2017 | 21 of 189Chapter 2. Existing ConditionsGraph 2.2. Downtown Race/EthnicityWhiteBlackOtherHispanic/LatinoNon Hispanic/LatinoRace EthicitySource: mySidewalk.com; US Census 2011-2015 ACS23.0%23.7%22.9%13.8%16.6%0 - 1920 - 3435 - 5455 - 6465+Source: mySidewalk.com; US Census 2011-2015 ACSGraph 2.3. Downtown AgeHousingBetween 2000 and 2010 the City saw a very modest 1.8% increase in the number of housing units, whereas Downtown experienced more substantial growth (12.8%) during the same time period, increasing to 3,159 units overall. Between 2010 and 2015, Downtown experienced a slight (0.9%) decrease in the overall number of housing units, where new units were constructed within the Downtown Core (114 units) and Prospect Lake (43 units), while the Old Bay District and Downtown Gateway both lost units (63 housing units and122 housing units respectively). Recent figures are ACS 2011-2015 estimates that include units demolished within the time period but not new housing units that have been constructed since 2015 (e.g., Garden Trail and The Nolen apartments). On average, however, the housing available in Downtown is older, with the majority being constructed between 1940 and 1989 (70.4%), as depicted in Graph 2.4. Pre-1940s 1940 - 1969 1970 - 19891990 - 2000 Post 2000 Total267 1,068 8549.8% 39.1% 31.2%70 471 2,7302.6% 17.3% 100%Source: mySidewalk.com; US Census 2011-2015 ACSGraph 2.4. Downtown Housing Stock81.4%11.8% 6.8%45.9%54.1% Clearwater Downtown Redevelopment Plan22 of 189 | December, 2017Median home value has risen Citywide by 43.1% since 2000, to $162,285 in recent estimates, while the Downtown median home value increased by 111.3% to $183,676 during this same time (ACS 2011-2015). The Downtown Core and Old Bay Districts have the highest median home values within the Downtown, at $277,600 and $217,795 respectively; however, for the Downtown Core this reflects a decrease on average by 20.7% (down from $350,000 in 2000) whereas for the Old Bay District this is an increase of 123.4% (up from $97,500 in 2000). For greater analysis on housing see Housing and Neighborhoods in Chapter 3. There is a much larger proportion of renters located within Downtown, compared to the City. According to the ACS 2011-2015 estimates, the total percentage of renters within the Downtown is 76.6%, versus 41.7% for the City as a whole. This translates into a larger proportion of owner-occupied houses in the City (61.6% versus 23.4% in Downtown). Within the Character Districts this pattern is consistent except within the Prospect Lake District, which has nearly an even split of owner occupied and renter occupied housing units. Graph 2.5 shows the percentages of owner vs. renter occupancy in the Downtown.Because the majority of housing units are renter occupied throughout most of Downtown, it is important to note the median home rent. Citywide median home rent is $919, while the Downtown median rent is slightly more at $1,055. The Downtown Core median home rents are the highest at $1,768. Graph 2.6 shows the breakdown of median home rents. Graph 2.6. Median Home Rent$250$500$750$1000$1250$1500$1750$2000DowntownDowntown CoreOld BaySouth GatewayProspect LakeDowntown Gateway$1,055$1,768$1,080$562$719$785$919$952City of ClearwaterPinellas CountySource: mySidewalk.com; US Census 2011-2015 ACSHouseholdsDowntown experienced a 4.6% increase in the number of households between 2000 and 2010, but since has experienced a 2.3% decline to 2,307 households overall. The average household size both Citywide and within Downtown specifically has increased since 2000, from 2.2 (Citywide) and 2.05 (Downtown) persons per household in 2000 to 2.34 and 2.36 persons per household in 2010 respectively. Within the Character Districts, Downtown Gateway saw an increase in average household size of 17.9% to 2.7 persons per household, contributing to the Downtown-wide population increase, while the other Districts remained close to their 2000 average household sizes. Source: mySidewalk.com; US Census 2011-2015 ACSGraph 2.5. Downtown OccupancyCitywide, median household income has increased 9.2% from $40,480 in 2000 to $44,198 based on current estimates. Although current estimates of Downtown residents’ median household income is less ($35,427), it also grew during the same time. Within the Character Districts, the Old Bay and Downtown Gateway Districts are the closest to the Downtown average at $35,606 and $31,382 respectively. The South Gateway has the lowest median household income at $17,167, and the Downtown Core has the highest at $56,426. December, 2017 | 23 of 189Chapter 2. Existing ConditionsPhoto Source: (Center) Asplan Viak, Battery ParkThe majority of renters in Downtown pay over 15% of their income on average towards rent, with 33.2% of renters spending between 15% and 30% of their income towards rent. Over 27% of renters spend between 31% and 49% of their income towards rent, which meets HUD’s definition of being “cost-burdened”, while an additional 30.9% spend over 50% of their income towards rent, which HUD defines as having “severe rent burden”. Graph 2.7 shows both the percentage of income towards rent for all of Downtown as well as how that percentage is distributed through the Character Districts.Demographic SynopsisWhen compared to the City of Clearwater, Downtown is demographically different in many areas; however, the Downtown Planning Area is not homogenous and has areas of concentrated extremes within its boundary. Downtown residents are more ethnically diverse and younger on average than the City. This can be attributed to residents in the Downtown Gateway District where a high proportion of younger residents, as well as residents of Hispanic, Latino or Spanish origin live. Conversely, the other extreme is concentrated in the Downtown Core which is the least ethnically diverse and also has the oldest mean age. The Downtown Core is also the outlier with the smallest household size, and the highest median income, rent and home values. The concentration of high-rise condominium buildings in this District, some with water views, is consistent with this analysis. Similarly, the Old Bay Character District which has waterfront homes has the second highest median home values in Downtown. Though the Downtown’s median home value is higher than that of the City, there is a wide range of median home values across the Character Districts. However, a lack of recent data from the ACS for two Districts may contribute to the Downtown Core’s high values inflating the overall median home value for Downtown. The pattern of many Downtown residents spending more than 30% of their income towards rent, which is higher than the City as a whole, may be exacerbated by Downtown’s median income, which is less than the City’s. Clearwater Downtown Redevelopment Plan24 of 189 | December, 2017INFRASTRUCTURE WaterThe Downtown Planning Area is served by the City of Clearwater water system as illustrated on Appendix Map 5.A. The system receives water from City-owned wells, in addition to water purchased from Pinellas County Utilities. Additionally, Pinellas County does not limit the amount of water the City can purchase at this time. Adequate water transmission and distribution pipelines are currently in place. WastewaterDowntown Clearwater is served by the City’s Marshall Street Water Reclamation Facility (WRF), which has a permitted capacity of 10 million gallons per day (MGD). Current average flows are 5.4 MGD. The City is actively implementing capital improvement projects developed from comprehensive evaluations of the sanitary sewer collection system (SSCS) and WRFs. These include Cleveland Streetscaping Phase III project which will upgrade sewer and stormwater lines and multiple projects at the Marshall Street WRF. Typical CIP projects vary from feasibility studies/evaluations, SSCS and WRF upgrades/improvements, to routine preventative maintenance and replacement of pipelines and structures. Clearwater is also actively attempting to reduce inflow and infiltration (I&I), a significant factor in preventing sanitary sewer overflows. Appendix Map 5.B, portrays sanitary sewer service within Downtown.Graph 2.7. Percentage of Income Spent Towards RentSource: mySidewalk.com; US Census 2011-2015 ACSDowntown CoreOld BaySouth GatewayProspect LakeDowntown Gateway8.9%33.1%27.1%30.9%71.2%16.2%9.0%73.2%26.9%9.8%51.3%19.5%9.1%63.1%> 50%TowardsRent31 - 49%TowardsRent15 - 30%TowardsRent< 15%TowardsRentDowntown11.6%6.2%1.9%9.1%1.6%7.9%4.1%6.8% 1.5% December, 2017 | 25 of 189Chapter 2. Existing ConditionsStormwaterThere are two main drainage basins in the Downtown area: the Coastal Basin, which includes the Prospect Lake regional drainage facility, and the Stevenson Creek Basin. Both the Coastal Basin and the Stevenson Creek Basin drain to Clearwater Harbor.The western part of the Coastal Basin drains directly to Clearwater Harbor through many outfalls along existing seawalls. These storm systems, depicted in Appendix Map 5.C, have been in place for many years. Future redevelopment and streetscape projects can be designed and constructed to improve water quality and maintain drainage.The eastern part of the Coastal Basin is within the Prospect Lake regional stormwater detention and water quality facility which was completed in 2003. It provides stormwater attenuation and treatment for an approximately 150-acre drainage basin, eliminating the need for on-site stormwater facilities on adjacent properties. The outfall from the Prospect Lake facility was a part of the Myrtle Avenue Improvements project completed in 2004. The eastern part of the Downtown Planning Area lies within the Stevenson Creek watershed. The 2002 Stevenson Creek Watershed Master Plan identified areas within the 100- and 500-year floodplains adjacent to the creek, as well as projects that would reduce the size of the Special Flood Hazard Areas. The Glen Oaks Stormwater Detention Facility, a 20-acre flood control and water quality project, was completed in 2006. A portion of the project has reduced the size of area within below the 100-year floodplain between Drew and Court Streets and positively impacted properties located in the CRA. A total of nine structures containing 19 dwelling units are no longer located in the Special Flood Hazard Area. This reduction has also decreased flood levels on Cleveland, Court and Drew Streets and Lady Mary Drive.Currently under construction, the East Gateway Stormwater and Sanitary Sewer Improvements Project is upgrading stormwater, sanitary sewer, and potable water lines near the end of their design life. Water quality benefits of the project include removal of over 7,200 pounds per year of suspended solids, 26 pounds per year of total phosphorus, and 69 pounds per year of total nitrogen. Water quantity benefits include reductions in flood depths at several locations. The project will complete construction by late 2018.Trees & Green InfrastructureGreen infrastructure is an approach to water management that protects, restores, or mimics the natural water cycle. Green infrastructure is effective, economical, and enhances community safety and quality of life. Examples include pervious surfaces, grass parking, bioswales, Greenstreets, and Low Impact Development (LID) that combines landscaping and stormwater. Trees provide benefits in reducing air pollution, removing excess nutrients in storm water, reducing and delaying stormwater runoff, reducing heat island effect and creating a more welcoming and walkable environment. The City has invested in street trees with the planting and maintenance of trees and landscaping in the Downtown Planning Area and has planned for Clearwater Downtown Redevelopment Plan26 of 189 | December, 2017additional green infrastructure, most notably the Cleveland Streetscaping Phase III. In addition to planting trees, the City inventories the trees on City property including within the right-of-way to better manage the urban forest. The majority of trees are comprised of three main species: oak (Quercus species); Crape Myrtle (Lagerstroemia species) and Phoenix palms (Phoenix dactylifera) which is illustrated on Appendix Map 5.F. Reclaimed WaterReclaimed water service has been greatly expanded since the initial adoption of this Plan. While still not providing service to the entire Downtown Planning Area, reclaimed water service is available to many of the residential properties, specifically those in the northeast corner of the Downtown Gateway north of Cleveland Street between Hillcrest Avenue and Highland Avenue. Reclaimed water service is also available along: Pierce Street through the Downtown Gateway; Cleveland Street through the Prospect Lake District; and properties fronting Drew Street. Also, a small portion of the Old Bay District is served by reclaimed water. Reclaimed water lines are shown on Appendix Map 5.D.GasClearwater Gas has a natural gas distribution system throughout the Downtown Planning Area, which is illustrated on Appendix Map 5.E. Underground gas mains are located on most streets and alleys and service lines exist throughout the area. Sidewalks & StreetscapingThe Downtown Planning Area has a fairly complete sidewalk network; however, many in the Downtown Core are narrow. The Character Districts with residential neighborhoods including the Downtown Gateway and Old Bay have narrow rights-of-way that limit the addition of new sidewalks or the expansion of existing narrow ones. The commercial corridor of North Fort Harrison has been identified as an area in need of wider sidewalks to accommodate pedestrian activity and future development. Permanent and temporary streetscape improvements have been utilized to enhance and balance the public right-of-way for all users. Phases I and II of the Cleveland Streetscape project are complete and Phase III is anticipated to start in 2018. Temporary “pop-up” improvements including re-striping the road, adding temporary planters and benches, and painting a mural crosswalk were implemented along North Fort Harrison Avenue in the Old Bay Character District. These temporary improvements showcased possible options for permanent streetscape improvements and allowed the City to measure the treatments’ effectiveness in reducing speeding. Downtown ConnectivityA fiber optic loop connects major City and some County facilities, helping to meet citizens’ and businesses’ service requirements. The fiber ring supports all voice, data and video needs between the facilities located on the loop. This loop currently connects the Municipal Services Building, the Main Police Station, City Hall, the Harborview Center, the Main Library, Clearwater Gas, a few Pinellas County offices, and several other City facilities located outside of the Downtown Core. Private businesses are supported by four business-class Internet Service Providers (ISPs) (i.e., WOW!, Level 3, Fiberdirect and Spectrum). The City also offers free wi-fi to the public at several City facilities (i.e., City libraries, City Hall, and the Municipal Services Building). Additionally, wi-fi is available at Coachman Park and Station Square Park. The City will continue to evaluate opportunities to provide wi-fi at additional City facilities. December, 2017 | 27 of 189Chapter 2. Existing ConditionsTRANSPORTATION & PARKING Downtown Roadway Network Downtown’s roadway network structure is based on a rectilinear grid system. This grid network pattern provides maximum connectivity, efficiency in infrastructure layout, and opportunities for creating expandable block systems. The Downtown roadway network is intended to accommodate pedestrians, cyclists, transit, motorists and goods movement. There are several jurisdictional entities that govern the roadway network within and through Downtown, including the Florida Department of Transportation (FDOT) and the City of Clearwater. Pinellas County governs some adjacent roadways just outside of the Downtown Planning Area. Three major State routes serve Downtown Clearwater (i.e., State Road 60 (SR-60), State Road 590 (SR-590), and Alternate US Highway 19 (Alt. US-19)). With several roadway segments outside of the City jurisdiction, the City’s ability to make improvements, control access, or unify roadway character is limited. In light of this, coordination and cooperation between the governing agencies is needed to implement this Plan.An important part of a well-planned roadway network system is the relationship between the hierarchy of roads and land uses and the balance between mobility and access. Following is a brief description of the Downtown area roadways’ functional classifications, which are shown on Map 2.5. Local StreetsLocal streets provide direct property access and accommodate shorter, local trips to adjoining collector or arterial streets. Most are narrow with slower speeds and are often residential in nature. Local streets are under City jurisdiction.CollectorsCollectors have an even distribution of mobility and access functions. Residential properties may have direct access to collectors. They can be continuous through a community and their function is to connect arterials to local roadways. Travel on collectors occurs at relatively lower speeds and for shorter distances than on arterials. Some examples of collector streets in Downtown are: Fort Harrison Avenue, Cleveland Street, and Druid Road. Collector streets are under City jurisdiction.ArterialsArterials are high volume streets that place a greater emphasis on mobility (i.e., through traffic) rather than access to land use. These roadways have a range of design characteristics that affect operating speeds and access to the adjacent property. Arterials are continuous and regional in nature, providing connections to regional expressways as well as important centers of activity in a metropolitan area. Arterials serving the Downtown area are: SR-60, Drew Street, and Alt. US-19. Within the City, arterials are under the jurisdiction of FDOT and Pinellas County. Clearwater Downtown Redevelopment Plan28 of 189 | December, 2017Street Name Classification Jurisdiction Travel Lanes Accessibility 2009 ADT 2015 ADT 2016 ADT % GrowthNorth-South CorridorsFort Harrison Avenue Collector City 2 Center Turn Lane 16,500 14,300 15,400 8%Myrtle Avenue Minor Arterial FDOT 4 Undivided 15,300 15,300 16,500 8%Martin Luther King, Jr. Avenue Collector City 2 Undivided 3,800 4,100 4,200 2%Missouri Avenue Minor Arterial City 4 Undivided 11,200 12,100 13,300 10%Highland Avenue Collector City 2 Undivided n/a 12,700 13,000 2%East-West CorridorsDrew Street Minor Arterial FDOT/City 4 Undivided 18,400 20,000 20,000 0%Cleveland Street Collector City 2 Raised Median 7,200 8,800 4,900 -44%Court Street (2-way) Principal Arterial FDOT 4 Raised Median 27,500 34,000 35,000 3%Chestnut Street (1-way) Principal Arterial FDOT 4 One Way 14,000 18,500 19,000 3%Memorial Causeway Principal Arterial FDOT 4 Raised Median 34,500 36,500 39,500 8%Table 2.1. Downtown Main Roadways, Selected DataSource: Clearwater Traffic Engineering and Forward Pinellas, 2017Downtown Area Major East-West Roadways SR-60 CorridorThe SR-60 Corridor is the main east-west corridor through the City of Clearwater. Locally, it is called Gulf to Bay Boulevard for most of its length. SR-60 is primarily a commercial corridor connecting Tampa International Airport, Downtown Clearwater, and Clearwater Beach and provides direct access to businesses along it. In the Downtown area, Court Street from the intersection of Gulf to Bay Boulevard and Highland Avenue (Five Points) is designated as SR-60. This designation continues west until the Beach roundabout. Court Street from Highland Avenue to Martin Luther King Jr. Boulevard is a four-lane divided arterial with limited access. West of Martin Luther King Jr. Boulevard SR-60 is split into two one-way streets. Court Street carries westbound traffic, and Chestnut Street carries eastbound traffic. In this westbound segment, Court Street varies from three lanes to two through lanes with right and left turn lanes until just west of Osceola Avenue, where it tapers to two travel lanes across the bridge to the Beach. Similarly, eastbound Chestnut Street starts as two lanes, widening to as many as four through lanes before narrowing again east of Prospect Avenue and merging with Court Street near Martin Luther King Jr. Boulevard. The eastern section of SR-60, Memorial Causeway, is considered the route bottleneck where roadway capacity drops to a two-lane section. The impact of reduced capacity causes a significant delay on the Court Street segment in Downtown during daily peak-hours, weekends, and the Spring Break season. State Road 60 (SR-60) is designated as an unrestricted truck route. The entire length is automobile-centric and functions as a dangerous barrier for pedestrians and bicyclists rather than part of a well-balanced connective system. Cleveland StreetCleveland Street is a major east-west City collector and is Downtown’s Main Street that has been invested in with streetscaping and traffic calming. This prioritized much of the street’s public right-of-way for pedestrians. In the eastern portion of Downtown, Cleveland Street is a four-lane undivided collector from Highland Avenue to Missouri Avenue, whereas west of Missouri Avenue into the Downtown Core Cleveland Street becomes a two-lane divided urban collector with on-street parking and traffic calming measures. December, 2017 | 29 of 189Chapter 2. Existing ConditionsDrew StreetDrew Street is a primary east-west arterial connecting Downtown Clearwater with US Highway 19 North. The portion of Drew Street east of Fort Harrison Avenue is designated as SR-590. In the Downtown area, Drew Street is a four-lane undivided arterial with narrow travel lanes from North Osceola Avenue to Highland Avenue. West of North Osceola Avenue, Drew Street becomes a two-lane undivided roadway with on-street parking on both sides. There are several multimodal opportunities and initiatives to account for along the corridor in the Downtown area.Downtown Area Major North-South Roadways Fort Harrison AvenueFort Harrison Avenue is a major north-south collector. This commercial corridor consists of a two-lane roadway with a near-continuous center turning lane through Downtown. To the south, Fort Harrison Avenue connects Downtown with Clearwater’s Morton Plant Hospital and surrounding medical uses. To the north, Fort Harrison Avenue merges with Myrtle Avenue (Alt. US-19) at Pleasant Street connecting the Downtown area with the City of Dunedin. Myrtle AvenueMyrtle Avenue is a north-south arterial through Downtown, forming the boundary between the Downtown Core and Prospect Lake Districts. Myrtle Avenue provides an alternative travel option to Fort Harrison Avenue through the Downtown area. Myrtle Avenue is a four-lane undivided roadway under State jurisdiction, and on the north end is designated as U.S. Alt.-19 between Fort Harrison Avenue and Chestnut Street. To the south of Chestnut Street, outside of Downtown, Myrtle Avenue is under the City’s jurisdiction.Missouri AvenueMissouri Avenue is a north-south corridor in the central portion of Downtown. Missouri Avenue is a four-lane undivided city collector in the Downtown Plan Area. Missouri Avenue is designated as Alt. U.S. 19 south of Court Street. The corridor connects Downtown with the southern parts of Pinellas County. The majority of roadway speeds are designed for 25 mph travel unless they are posted differently. Arterial roadways such as Court Street, Drew Street, and Myrtle Avenue are posted at higher speeds ranging from 35 to 45 mph. Traffic Control Intelligent Transportation Systems (ITS) are advanced information and communications technology that are applied to surface transportation in order to achieve enhanced safety and mobility and to reduce the environmental impact of transportation. Clearwater Downtown Redevelopment Plan30 of 189 | December, 2017Downtown roadway signals are maintained and operated by the City’s Traffic Operations Division. Currently, the City of Clearwater uses Metropolitan Traffic Control System (MTCS) software for controlling the timing of traffic signals. The City is currently replacing the existing MTCS system with CENTRACS which will provide an integrated platform for traffic signal control, ITS field device monitoring/control, information management, and graphical data display. The goal of a traffic signal interconnect is to synchronize and coordinate the intersections in a specific corridor, allowing for large amounts of traffic to travel more smoothly and efficiently with maximum green-light time. While SR-60 is currently an ITS/ATMS corridor, the Pinellas County ATMS Master Plan identified Drew Street and Myrtle Avenue as ITS/ATMS corridors. Map 2.5 shows the locations of the traffic signals within the Downtown Planning Area including the following types:xIntersections – 35 locationsxTrail crossings – 10 locationsxRailway crossings – 15 locationsxRapid flashing beacon, pedestrian crossing signs – 4 locations xFire station emergency flasher – 1 locationExisting Traffic VolumesTraffic counts are used to reflect the existing level of automobile usage on a street. Average Daily Traffic (ADT), is regularly calculated for several roadways in Clearwater based on the number of vehicles that pass along a road over an average 24-hour weekday period. Table 2.1 provides current and historical ADT records of Downtown major roadways where FDOT performed traffic counts. As anticipated, the streets carrying the highest volumes of vehicles include: SR-60; Alt. US-19; and Drew Street. Many of the major area roadways have experienced growth in traffic volume over the past years with exception of Cleveland Street. Bicycle Facilities On-street bike facilities are very limited on arterial and collector streets. Shared bike lanes (sharrows) exist on Cleveland Street east of Missouri Avenue where the City has completed two phases of the Cleveland Streetscape project. Court Street from Hillcrest Avenue to Missouri Avenue also has sharrows, while bike lanes are formally designated with striping only on Court Street from Highland Avenue to Hillcrest Avenue. Both types of bike lanes were added to Court Street as part of FDOT resurfacing, restoration and rehabilitation (RRR) projects. Through the Pop-Up North Marina Project sharrows were added to Nicholson and Eldridge Streets. Additionally a dedicated bike lane was created in the Old Bay Character District along North Osceola Avenue north of Seminole Street. The Pinellas Trail is the primary off-street multimodal path in Pinellas County, running north-south through the Old Bay, Downtown Core, and South Gateway Districts. The trail provides regional access to the areas’ beaches and to the Sun Coast Regional Trail. The Pinellas Trail is considered the backbone of the City of Clearwater’s bicycle facilities infrastructure. Spanning approximately four miles through the City, it connects the City with the northern communities of Dunedin, Palm Harbor, Tarpon Springs and beyond, while its southern portion connects the City with Largo, Seminole, and St. Petersburg. The Pinellas Trail segment that passes through Downtown is approximately 1.5 miles in length. Where the trail crosses heavily-used roadways in Downtown (i.e., Drew, Court, and Chestnut Streets), trail users are required to yield to vehicular traffic. The Druid Trail is an east-west multiuser path which currently connects the Beach to the mainland. It extends from the Memorial Causeway Bridge eastward to the Pinellas Trail at Turner Street and continues eastward to South Betty Lane. The last phase of the Druid Trail connecting the Duke Energy Trail is anticipated to be completed in 2018. The Druid Trail primarily runs along Druid Street providing alternative access to retail along SR-60 and to the Beach through the Memorial Causeway.The Memorial Causeway Bridge provides a multimodal path that accommodates pedestrians and bicyclists and connects the mainland with the Beach. Bicycle parking facilities are available throughout the Downtown including the City’s first two bike corrals on Cleveland Street which were added in 2017. Freight Network Freight and goods movement is a vital and often underappreciated element of the transportation system. Everyone is directly impacted by how goods are delivered to distribution centers, stores and their homes. Downtown Clearwater has over 70 acres of land utilizing industrial and commercial uses and many of these uses employ sizeable numbers of people making efficient and safe freight movement an important component of the City’s economy. Alternate US-19, SR-60, and SR-590 December, 2017 | 31 of 189Chapter 2. Existing Conditionsroutes provide trucks with access to Downtown and connect with the national highway system and the area’s intermodal logistics facilities.The City does not restrict goods’ delivery times, allowing trucks to take advantage of the roads during off-peak travel times, and therefore, potentially reducing the costs of congestion on travel. The City allows truck parking on any public roads if they have a delivery on that roadway. The City imposes a weight restriction of 80,000 pounds and height restriction of 14.5 feet on vehicles without a FDOT oversized/overweight permit.Railway Network CSX Transportation owns the rail line that bisects Downtown. The line runs from Gary to St. Petersburg for a total of approximately 50 miles. The rail line has a single track line that runs on East Avenue in Downtown and has more than 15 at-grade level crossings in the Downtown Planning Area. Most of the railway crossings are equipped with automatic grade crossing warning devices (flashing lights, gates, etc). Currently CSX runs few trips through Clearwater. Public Transportation Public transit is a major transportation element in Downtown Clearwater that connects Clearwater residents with employment centers, public places and regional destinations. The transit services in the City are provided by the Pinellas Suncoast Transit Authority (PSTA). PSTA provides scheduled, fixed-route bus and trolley services within Pinellas County limits, including express routes across Tampa Bay connecting Pinellas County with Downtown Tampa. Eleven bus routes and three trolley routes (Jolley and Suncoast Beach Trolleys) serve Park Street Terminal in Downtown Clearwater. In Fiscal Year 2017 the average daily weekday ridership on these routes combined was more than 17,800. Currently, the majority of the routes serving Downtown Clearwater operate seven days a week. Routes 67, 73, and 76 operate Monday through Saturday, and routes 66L and 98 operate Monday through Friday. Table 2.2 and Map 2.6 summarize and show the PSTA transit routes serving Downtown Clearwater. Clearwater Downtown Redevelopment Plan32 of 189 | December, 2017Parking An adequate and convenient supply of parking is essential for the suc cess of Downtown Clearwater. According to a 2009 Downtown Parking Study, the existing parking supply is expected to be sufficient to support the anticipated future retail and restaurant growth both during typical weekdays and weekends. However, the existing parking supply is not expected to be sufficient to support anticipated future office parking demand based on higher occupancy rates for Class A office buildings. Currently, the City requires uses in Downtown to provide sufficient off-street parking to support the use(s) on site. Generally, parking Route Destination(s) Through HoursHeadway (Min) Ridership FY-16Peak Off-Peak18 Downtown St. Petersburg Largo Mall 5:30am - 11pm 20 30 1,138,14552 Grand Central Station, Pinellas Park Largo Transit Center 5am - 12am 20 30 1,206,02260 McMullen Booth Road Clearwater Mall 5am - 11pm 20 20 458,32561 Indian Rocks Shopping Center & Westfield Countryside Mall Park Street Terminal 5:30am - 8:30pm 60 60 187,07865 Seminole Mall Largo Diagnostic Clinic 6am - 7pm 60 60 95,20766L Tarpon Mall & Morton Plant Hospital Park Street Terminal5:30am - 9:30am2:30pm - 6:30pmN/A N/A 57,58967 Tampa Road Westfield Countryside Mall 6am - 7pm 60 60 110,87973 22nd Ave & 68th St St. Petersburg Tyrone Square Mall 6am - 7pm 60 75 102,47176 Westfield Countryside Mall St. Pete College - Clearwater 6am - 7pm 60 60 107,74778 Westfield Countryside Mall Dunedin City Hall 6am - 10pm 30 45 241,31298 Carillon Office Complex Criminal Justice Center5:45am - 8am3:45pm - 5:45pmN/A N/A 28,108JT Beach Route* Park Street Terminal 10am - 10pm 30 30 150,072JT Coastal Park Street Terminal 8:30am -12am 60 60 105,905SBT 75th Ave & Gulf Blvd, St. Pete Beach Pier 60 5am - 11pm 30 30 579,681* Service change February 2018 to go to Downtown ClearwaterSource: Pinellas Suncoast Transit Authority, 2017Table 2.2. PSTA Routesfor properties with frontage on Cleveland Street between Osceola Avenue and Myrtle Avenue is managed as infrastructure where surrounding parking garages and on-street parking support the businesses on Cleveland Street that do not have parking or space for parking are allowed to change uses without adding parking on site. However, there are many other areas of Downtown where the historic development patterns common in traditional downtowns otherwise make it difficult to incorporate off-street parking on site without compromising the urban form of development.While some parking areas are heavily utilized during the weekday daytime hours, those same parking areas may not be heavily utilized during weekend and evening hours (with the exception of during special events and holidays). Large events at Coachman Park significantly impact the Downtown parking system. However, these events do not occur more than 36 days per year. December, 2017 | 33 of 189Chapter 2. Existing ConditionsFacility Facility Type Location Capacity RestrictionsGarden Avenue Garage 28 North Garden Avenue 250 NoneMunicipal Services Building Garage 640 North Pierce Street 474 Employee Mon - FriStation Square Garage 628 Cleveland Street 96 NoneCounty Garage Lot 310 Court Street 11 3 HoursCoachman Park Lot 101 Drew Street 261 NoneCity Hall Lot 112 South Osceola Avenue 51/66 3 HoursCity Hall Overflow Lot 220 Pierce Street 63 NoneDowntown Marina North Lot 100 Drew Street 19 NoneDowntown Marina South Lot 150 Pierce Street 42 NoneMain Library Lot 100 North Osecola Avenue 76 RestrictedDolphin Tale Adventure Lot 36 North Osceola Avenue 50 RestrictedNorth Garden Avenue Lot 35 North Watterson Avenue 9 NoneHarborview Center Lot 300 Cleveland Street 168 NoneCourthouse Lot 475 Oak Avenue 35 3 HoursCourt Street & Garden Avenue Lot 318 South Garden Avenue 7 Permit Only / 3 HoursCourt Street & Fort Harrison Avenue Lot 351 South Fort Harrison Avenue 20 Permit Only / 3 HoursCourt Street & Osceola Avenue Lot 311 Osceola Avenue 39 3 HoursOak Avenue Lot 450 Oak Avenue 85/39 3 HoursPark / Pierce Streets Lot 620 Pierce Street 18/12 10 HoursChestnut Street Lot 615 Court Strreet 37 Permit OnlyFort Harrison Ave Lot 420 South Fort Harrison 26 3 HoursPinellas County Lot Pierce Street & Fort Harrison Avenue 105 Permit OnlyTable 2.3. Existing Parking FacilitiesSource: Clearwater Parking Division, Engineering Department, 2017The Downtown Core is the urban heart of the City and of Downtown and parking garages and public lots are concentrated in this area. The City continues to explore ways to improve the efficiency of the existing public parking supply through parking time limit restrictions, enforcement, permitting, wayfinding, and marketing. Phase III of the Cleveland Streetscape project will provide additional on-street parking in the form of reverse angle parking, the first of its kind in the City of Clearwater. The following is the parking supply for the Downtown Core: xParking lots: 1,223 spaces xParking Garages: 1,339 spaces xOn-street Parking: 379 spaces Table 2.3 and Map 2.7 summarize and show parking facilities, locations, types, number of spaces, and restrictions in the Downtown Core. Generally private lots are only for users of a specific business or property, public parking is available for any user in Downtown and combined public/private parking have specific limitations on the number of parking spaces or hours parking can be used by the public. #!(!(E!(!(!(!(EEE!(!(")!(")!(!(!(!(!(")!(#!(EE!(!(E")")E!(!(!(!(EEE!(!(!(!(!(%,!(!(!(!(!(!(EECleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Bay BlvdHighland AveMartin Luther King, Jr AveTurner StMap 2.5Traffic Control & Roadway HierarchyClearwater DowntownRedevelopment PlanSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 20171 inch = 1,050 feet®Control Devices & Roadway HierarchyDevices#Dynamic Message Sign (DMS)%,Emergency Flasher!(SignalsERailroad")Rapid Flashing Beacon (RFB)Roadway HierarchyArterial / FDOTCollector / CityTruck RoutesDowntown AreaProposed Old Bay Expansion !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!Cleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Bay BlvdHighland AveMartin Luther King, Jr AveTurner St606776737866L611865529866LMap 2.6PSTA Routes & StopsClearwater DowntownRedevelopment PlanSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 20171 inch = 1,050 feet®Routes & StopsStops!RoutesPSTAJolley TrolleySuncoast TrolleyDowntown AreaProposed Old Bay Expansion Clearwater Downtown Redevelopment Plan36 of 189 | December, 2017Cleveland StMyrtle AveCourt StChestnut StOsceola AveFt Harrison AveFranklin StPierce StPark StGarden AveDrew StMap 2.7Downtown Core ParkingClearwater DowntownRedevelopment PlanSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 2017Downtown ParkingTimed - MetersLimited - No Meters!!Unlimited - No MetersPrivate GaragePrivate LotPublic GaragePublic LotPublic/Private GaragePublic/Private LotReserved Lot1 inch = 425 feet® Clearwater CountryClubJack Russell StadiumGlen Oaks ParkCoachmanParkCleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Bay BlvdHighland AveMartin Luther King, Jr AveTurner StPinellas TrailNorth GreenwoodRecrecation CenterDruid TrailProspect LakeParkBayfront TennisCourtsClearwater HarborMarinaSeminole BoatRampStation SquareParkBayfront MemorialParkMap 2.8Public Recreation Facilities & Open SpacesClearwater DowntownRedevelopment PlanSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 20171 inch = 1,000 feet®Public Recreation Facilities& Open SpacesParksPinellas TrailDruid TrailDowntown AreaProposed Old Bay Expansion Clearwater Downtown Redevelopment Plan38 of 189 | December, 2017PUBLIC RECREATION FACILITIES & OPEN SPACEA total of 36.2 acres or 6.6% of the total land within Downtown is City-owned parkland as illustrated on Map 2.8. In addition, there are 1.5 miles of trails including the Pinellas Trail and the Druid Trail. There are a variety of recreational facilities within Downtown and several in close proximity to the Plan boundaries. The majority of parks are concentrated in the Downtown Core. Coachman Park, located in the western-most portion of the Core along Clearwater Harbor, is currently less than seven acres. The park is primarily passive; however, it has an amphitheater that attracts nationally-known artists and serves as a regional entertainment venue. Bayfront Memorial Park is west of Coachman Park, adjacent to Clearwater Harbor. This small passive park provides parking along the water and with the small pier, is used for markets. It also used to be home to sculptures which paid tribute to the World War I American Doughboys and the World War I Navy. These sculptures have been relocated to a landscape island on the Memorial Bridge. Currently Bayfront Memorial Park houses “The Middens”, a stainless shells sculpture that echo the region’s history of the native Tocobaga tribes and nod to the local estuary located just off the Harbor seawall. The Middens are illuminated at night with full-spectrum LEDs. The Bayfront Tennis Complex, also within the Downtown Core, is located to the west of City Hall on the lower end of the Bluff and is the City’s first tennis complex. One urban pocket park, Station Square Park, is located in the center of the historic commercial core on Cleveland Street and is used by many Downtown workers. The CRA programs various activities at Station Square Park (e.g., lunchtime music, yoga) and a variety of special events take place in the park. The Clearwater Harbor Marina is a beautiful marina with state-of-the-art concrete floating docks located just across from Coachman Park. The boat slips are accessible from the Intracoastal Waterway at the Memorial Causeway Bridge. There are 126 boat slips as well as over 1,000 feet of overnight side-tie mooring for visitors and over 600 feet of side-tie mooring for daytime visits and special events. The boat slip lengths range in size from 30 feet to 55 feet. The Fred E. Marquis Pinellas Trail, a countywide trail system, traverses Downtown running north/south and the Druid Trail traverses east/west. A significant portion of the Pinellas Trail in the Downtown Core shares the East Avenue right-of-way which was modified to one-way north-bound vehicular traffic to allow for wider trail area on the west side of the right-of-way. South East Avenue terminates at Turner Street in the South Gateway Character District where the Pinellas Trail continues southward along the CSX rail line. North of Drew Street in the Old Bay District, the Trail is located within a dedicated greenway corridor. The Druid Trail is largely in the right of way of Turner Street in the South Gateway. Shared bike lanes or “sharrows” support trail connectivity and have been implemented on Cleveland Street and North Osceola Avenue. The Seminole Boat Ramp is located in the northwestern section of the Old Bay District and functions as the City’s main boat launching facility. It has eight boat ramps, as well as a picnic area. The facility accommodates approximately 25,000 launches per year, and offers monthly and yearly launch passes. In 2017, the City initiated work to design and permit significant improvements to the property and ramp, including: reconfigured paved parking; additional overflow parking utilizing low impact development methods to manage stormwater and improve water quality; a pedestrian promenade and an elevated observation platform to enhance waterfront access for non-boaters; new greenspace by the Francis Wilson Playhouse located on adjacent City-owned property; additional landscaping improvements; and the consideration for adding public restrooms.Prospect Lake Park is located in the Prospect Lake District, east of the Downtown Core. It is a passive urban park providing a unique amenity within Downtown, including trails and benches around the lake. Even though Downtown has a significant amount of parkland, it lacks small pocket parks and playgrounds. Several recreation facilities are located along the perimeter of the Downtown including the Clearwater Country Club golf course, and Crest Lake Park, which is a community park with playground facilities, a lake and the City’s first dog park. David Martin Soccer Field was the only active recreation facility in Downtown, but it was relocated south of the Downtown Planning Area and incorporated into Glen Oaks Park in 2006. December, 2017 | 39 of 189Chapter 2. Existing ConditionsEXISTING DOWNTOWN REDEVELOPMENT PROGRAMSIn addition to the CRA, several programs have been established to support Downtown redevelopment efforts. A description of the main programs is listed below and a more comprehensive listing of incentives available to the private sector is provided in Chapter 4, Plan Implementation.Downtown Development BoardPursuant to Florida Statutes, the Downtown Development Board (DDB) was established in 1970. In 1971, Downtown property owners approved a referendum that created a Special Downtown Tax District to assist in revitalization efforts of Downtown and preserve property values. The DDB has seven elected board members and two ex-officio members from the CRA and represents the interests of Downtown property owners within the original CRA. The CRA provides professional staff support to the DDB. Brownfields ProgramIn order to assist in the redevelopment or reuse of abandoned, idled, or underutilized industrial and commercial properties that have, or are perceived to have, environmental contamination, the City of Clearwater established a Federal and State Brownfields program in 1996. This program provides environmental site assessment and analysis to identify potential presence of hazardous substances, petroleum, or other types of contamination. The documentation of the absence or presence of environmental impacts is of utmost importance to all parties affected. INVESTMENT IN DOWNTOWN Since the inception of the original Downtown CRA in 1981, considerable public and private investment has been made in the Downtown area. Often the first step in large investment projects is property acquisition and then remediation, assemblage, marketing and redevelopment. The City and CRA also provide incentives and investment in programs that support business development. Capital Improvement Projects and transportation comprise a large portion of investment in the Downtown Planning Area that enhances necessary infrastructure as well as quality of life. Investments in arts, culture and programming also improve quality of life and desirability of Downtown. Often a significant project will span multiple categories of investment. Selected investments are shown on Map 2.9. Below is a list of some recent and significant programs and projects undertaken by the City and/or CRA: Property AcquisitionsPierce Street Lot, 301 Pierce Streetx$4.25M purchase pricexKey property for Imagine Clearwater redevelopmentTriangle Property, 1384 Gulf to Bay Boulevardx$160k purchase pricexKey property for Cleveland Streetscaping Phase III and Mercado Former St. Pete Times Lot, 704 and 710 Court Streetx$2.4M purchase pricexKey properties for future Intermodal Center Clearwater Downtown Redevelopment Plan40 of 189 | December, 2017Multiple Brownfields Sites xHarbor Oaks Shopping Plaza, $110k for remediationxClearwater Automobile Salvage Yard,$1.2M purchase price and $648k for remediationxCar Pro Site, $296k purchase price and $661k assessment and remediationEconomy Inn Redevelopment Site, 1274 Cleveland Street, and adjacent parcel 1247 Grove Streetx$1.6M and $67.5k purchase prices, respectivelyCapital Improvement ProjectsClearwater Harbor Marina, 210 Drew Streetx$1.2M assistance for a 126 boat slip project and fishing pier Capitol Theatre, 405 Cleveland Streetx$8.8M renovation projectCleveland Streetscape Phase I &II, Osceola to Missouri Avenuesx$.1M for Phase I, $2.5M for Phase IIxNew sidewalks, stormwater, electrical improvements, street amenities, a wayfinding signage master plan and new plantingsMain Fire Station #45, 1140 Court Street x$10.3M construction fundingFive Points Intersection, Gulf to Bay Boulevard, Court Street, and Highland Avenuex$728k in improvements and landscapingRedevelopment IncentivesGarden Trail Apartments, 609 Seminole Streetx$354k in acquisition and environmental remediationCountry Club Townhomes, 1273 Drew Streetx$700k towards acquisitionx$449k for constructionx$320k for down payment assistanceMarriott Residence Inn, 940 Court Streetx$227k in impact fee, permit fee, and a portion of City TIF reimbursement Cleveland Street and Fort Harrison Avenue Façade Improvement Grantsx50+ buildingsxMore than $279,933 since 1996The Nolen Apartments, 949 Cleveland Streetx$700k fees reimbursed, 257 market rate units and 13,000 square feet of retail/restaurant spacex$725k to address soil condition and $485k to reduce stormwater fees and relocate utilitiesWater’s Edge Condominiums, 391 Cleveland Street x$1M reimbursement of impact fees, portion of sidewalks costs and site improvements paid from Ad Valorem taxesx153 units with 10,000 square feet of retail space Station Square Condominiums, 628 Cleveland Street x$1.2M for 99 public parking spaces Business DevelopmentBusiness SPARK, 112 South Osceola AvenuexNetwork of programs, services and facilities provided by public and private partners to support businesses and entrepreneurs in every stage of developmentThe Ring Workspaces, 600 Cleveland Streetx$600k investment in a private, state-of-the-art coworking office facilityClearwater Main Library, 100 N. Osceola AvenuexInterlocal agreement with the Clearwater Main Library to conduct activities that support community learning in the areas of STEM (science, technology, engineering and math), entrepreneurship and small business developmentCommunity Arts, Culture & Eventsx30-year agreement with Ruth Eckerd Hall for the operation of the Capitol Theatre xSculpture 360, rotating artwork in the median of Cleveland Street in the Downtown CorexSecond Century public Art GalleryxDowntown waterfront marketsxEl Dia del Nino (Children’s Day), a neighborhood event to celebrate the Downtown Gateway communityxPublic art banners and art wraps on utility signal boxesxProgramming, events and activation of parks (Station Square) and public spacesxInterlocal agreement with Clearwater Police Department for Community Policing in Downtown Gateway which has decreased drug dealing, prostitution and street crimeTransportation & MobilityxJolley Trolley (non-profit trolley system) and Water Taxi/Ferry subsidiesxBeach Connector Trail portion of the Druid TrailxDowntown Wayfinding ")")")")!(!(!(!(#*#*#*#*#*#*!(rrrCleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Bay BlvdHighland AveMartin Luther King, Jr AveTurner StPierce Street LotThe Nolen ApartmentsWater's Edge CondosCountry Club TownhomesTriangle PropertyCar ProEconomy Inn SiteFive Points IntersectionFire Station #45Marriott Residence InnHarbor Oaks Shopping CenterSt. Pete Times LotCleveland St. Phases I & IIStation Square CondosCapitol TheatreHarbor MarinaGarden Trail ApartmentsClearwater Auto SalvageMap 2.9Selected Downtown InvestmentsClearwater DowntownRedevelopment PlanSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 20171 inch = 1,000 feet®InvestmentsrBrownfields!(Capital Improvement Project")Property Acquisition#*Redevelopment IncentivesDowntown AreaProposed Old Bay Expansion Land Use/Redevelopment PlanVision & Guiding Principles | Goals, Objectives, Policies | Character Districts Clearwater Downtown Redevelopment Plan44 of 189 | December, 2017Chapter 3: Land Use / Redevelopment PlanVISION & GUIDING PRINCIPLESThe Downtown Redevelopment Plan provides a flexible framework for the redevelopment of Downtown into a place that attracts people and businesses. This Plan establishes guiding principles that create the foundation for this planning effort and ensure that it reflects the goals and vision of the community. They also provide a means for guiding and evaluating the City’s and CRA’s future efforts and reinvestment. Future development, programs, funding initiatives, and City improvements should be evaluated on their success in achieving the following principles.VISION Downtown Clearwater will thrive as the urban core and heart of the City, as the center of business and government, and as an attractive place to live, work, shop and play. A revitalized Downtown will be achieved through quality urban design, continued creation of a high quality public realm, and a dense and livable pattern which will strengthen the overall health of the City. Guiding Principles AuthenticThe City will embrace an authentic urban environment focused on Downtown’s heritage as the urban core and neighborhoods as the heart of the community. The City will celebrate the achievements of the first 100 years and Downtown will continue as a vibrant place for public expression and celebration of the diversity in the City’s second century. Economic CenterDowntown is a major center of activity, business and governments. The location of the Pinellas County seat within Downtown Clearwater is a point of civic pride and economic development opportunities. Downtown will continue to attract an array of innovative businesses, including the technology sector, by creating a welcoming business environment, by expanding the major retail core, and with its rich human capital and unique sense of place. Linked SuccessThe health and success of Downtown is linked to the health and success of the overall City. The City will utilize all tools and incentives available in the Community Redevelopment Agency to revitalize Downtown. Integrated VarietyThe Downtown will be a community with an integrated mix of retail, residential, office and recreation uses. The development of a variety of residential projects will support individuals and families with diverse social and economic backgrounds and encourage the resurgence of residences to Downtown. Retail GridCleveland Street is the spine of the Downtown street grid and retail network and is valued as the “Main Street” with historic character and setting. Active ground floor uses along North and South Osceola and North Fort Harrison Avenues will support the retail network. Primarily PedestrianAll of Downtown must be developed with streets that are safe and attractive places that balance walking, biking, transit and driving a car. The public right-of-way will address the needs of all users as Complete Streets. To promote pedestrian-oriented development some automobile-oriented uses will not be permitted. Walkable block sizes and street grids are key for walkability and livability and will be developed and maintained throughout the Downtown Planning Area. Waterfront & HarborA redesigned waterfront will be a catalyst for a more vibrant Downtown providing residents, workers and visitors a welcoming and safe public access to unique and beautiful amenities. An active and inviting Osceola Avenue will firmly and permanently connect Downtown with the waterfront and Clearwater Harbor. Views of and access to the water will be promoted. December, 2017 | 45 of 189Chapter 3. Land Use / Redevelopment PlanUrban DesignQuality urban site development patterns and architectural design will be achieved through design standards to encourage development and events that activate the public realm, including streetscaping and improvements to the public right-of-way. Open spaces should be the public “living rooms” that foster a vibrant community. Pinellas TrailThe Pinellas Trail is a unique regional resource for recreation and economic development. Development abutting the Trail will be connected to and oriented towards the Trail. A multimodal network expanding from the Trail throughout Downtown and to the greater City will be promoted as an essential part of the mobility and livability of Clearwater. Park OnceA park once management strategy will be developed by efficiently managing supply and demand for Downtown parking as a collective whole and encouraging an integrated transportation system throughout Downtown.ArtsThe visual, performing and public arts will be enabled, encouraged and expanded as a vital part of Downtown. The City will weave art and culture into the fabric of everyday life in Downtown. Adaptive ReuseThe City will encourage adaptive reuse of properties, in addition to the redevelopment of buildings like the existing City Hall site, in order to continue the reinvestment and rehabilitation of Downtown into a place that is engaging and inviting to all people. The adaptive reuse of existing and underutilized buildings will enhance economic growth.EnvironmentDowntown Clearwater will be competitive, vibrant, and green. The Downtown is interconnected and diverse and will promote sustainability by balancing the environment, economy and community. To achieve environmental stewardship and community vibrancy redevelopment should utilize green building practices including Low Impact Development (LID), Leadership in Energy and Environmental Design (LEED), and Florida Green Building Coalition (FGBC). ResilienceDowntown will be economically, socially and environmentally resilient, so that rapid recovery from natural and man-made disasters, climate change, and economic shifts is possible. A strong vision of the future community and an action-oriented stance will prepare Downtown to positively adapt to a disruption. Photo Sources: (Top) WalkableWPB.com, Green Street, 2017; (Center) Chris Whitis, Parking Garage Art Studios, 2017 Clearwater Downtown Redevelopment Plan46 of 189 | December, 2017GOALS, OBJECTIVES & POLICIESFour goals have been established to guide the direction of development, redevelopment and public actions within Downtown. Multiple objectives establish how the City will achieve the goals. Collectively, the goals and objectives are organized into four categories: People, Accessibility, Amenities, and Urban Design. Listed afterwards, policies provide detailed direction towards attainment of the goals and objectives. Goals & Objectives1. People Goal Downtown shall be a place that attracts residents, visitors, businesses and their employees and enables the development of community. The City shall encourage a vibrant and active public realm, recreation and entertainment opportunities, and support the community and neighborhoods. Objective 1A: Maintain Downtown as the City of Clearwater government center and encourage Pinellas County government to remain in Downtown. Objective 1B: Support the relocation of Clearwater City Hall to another location within Downtown Area Plan. Allowing the former City Hall site, which is in a prime waterfront location, to be utilized for mixed-use, high-rise development with residential and commercial ground floor uses. The location, placement and design of a new City Hall should reflect the building’s civic importance as a community-gathering place. Objective 1C: Osceola Avenue should develop as an active street frontage. The pedestrian experience from Downtown to the waterfront will be active and engaging.Objective 1D: Encourage a variety of office-intensive businesses, including finance and insurance, IT/Software, professional services, data management, analytics and services, and medical to relocate and expand in Downtown to provide a stable employment center. Objective 1E: Maintain Cleveland Street as Downtown’s Main Street which is valued for its historic character and pedestrian scale. Objective 1F: Allow for a variety of residential densities and housing types to provide for a range of affordability and mix of incomes consistent with the Character Districts. Objective 1G: Continue to utilize a variety of incentives to encourage the construction of new residential uses to locate Downtown. Objective 1H: Maintain, activate and program parks, plazas and recreational areas. Objective 1I: Create, facilitate and maintain a safe Downtown environment for all residents, visitors, businesses and their employees by addressing real and perceived public safety issues. Objective 1J: Recognize and celebrate the unique features of Downtown neighborhoods. 2. Accessibility GoalDowntown will have a connected network with mobility choices. Objective 2A: Maintain and reclaim the Downtown street grid to provide multiple access points in and through Downtown. Vacations of streets and alleys are discouraged.Objective 2B: Strengthen Cleveland Street, Osceola and Fort Harrison Avenues as local, pedestrian oriented streets. Identify other local streets to be reinvigorated with active ground floor uses. Objective 2C: Continue to implement the Master Streetscape and Wayfinding Plan to support pedestrian and bicycle activity. December, 2017 | 47 of 189Chapter 3. Land Use / Redevelopment PlanObjective 2D: Maintain and improve the Pinellas Trail as both a recreational amenity and as a unique opportunity for economic development. Enhance Trail connectivity from the Downtown to the waterfront and Beach. Promote Downtown Clearwater as a destination accessible by the Pinellas Trail. Objective 2E: Implement Complete Streets on Downtown roadways. Objective 2F: Provide safer and more convenient bike facilities, including a bike share program. Objective 2G: Facilitate pedestrian and bicycle-friendly amenities along and expanding from the Pinellas Trail. Objective 2H: Support temporary techniques that improve the street environment such as murals, temporary planters, sharrows, bike lanes and painted intersections until permanent improvements are made.Objective 2I: Identify and reduce pedestrian and vehicle conflicts, focusing on multi-lane road crossings and areas of limited visibility.Objective 2J: Pursue a premium transit system between Downtown, Clearwater Beach, Tampa International Airport, and St. Pete/Clearwater International Airport.Objective2K: Strengthen connections between Downtown and Clearwater Beach. Objective 2L: Coordinate with Pinellas County to improve the Pinellas Trail throughout Downtown. Objective 2M: Create parking as infrastructure through a park once strategy that utilizes consolidated parking to serve all of Downtown and reduces the requirement for use-by-use on-site parking.Objective 2N: Encourage development of joint use public/private parking with PSTA. Objective 2O: Support water taxis/ferries serving the Clearwater Harbor Marina. 3. Amenity GoalDowntown will be a memorable place to be enjoyed that is enhanced by Clearwater’s waterfront location, natural resources, built environment and history. Objective 3A: Redevelop and expand the Downtown waterfront as a park accessible to all residents and visitors functioning as a cohesive system that is dynamic, connected, well-designed, and economically productive. Clearwater Downtown Redevelopment Plan48 of 189 | December, 20174. Urban Design GoalDowntown will be a dynamic built environment of dense and livable patterns and active and attractive streets through the use of quality urban design and architecture.Objective 4A: Encourage redevelopment that contains a variety of building forms and styles.Objective 4B: Establish and utilize design standards and Character District requirements to ensure that development projects enhance the built environment. Objective 4C: Develop a plan that identifies street frontages and context sensitive development standards to create a livable and vibrant Downtown. Objective 4D:Encourage renovation, restoration and reuse of existing historic structures to maintain the character of Downtown’s neighborhoods. Objective 4E:Provide shade trees as a critical element for walkable streets.PoliciesPolicies are detailed actions to achieve the more broad goals and objectives. The policies do not correspond to one specific goal the way objectives do, but as a collective whole these policies support and help obtain all goals and objectives. Policy 1:The City shall prioritize sidewalk construction within Downtown that enhances pedestrian linkages and/or completes a continuous sidewalk system on all streets.Policy 2:Sidewalk easements will be supported to facilitate wide sidewalks in areas with limited rights of way. Policy 3:The City will develop Pinellas Trail spurs to connect the Trail to the waterfront and promote Downtown as a destination along the Pinellas Trail. Policy 4:Uses along the Pinellas Trail shall be oriented toward the Trail to take advantage of the people drawn to this recreational/transportation amenity. Connections to the Pinellas Trail are to be incorporated in site plans when property is adjacent to the Trail or when the proposed use would benefit through a connection.Policy 5:The City shall continue to provide bike parking and consider developing incentives to promote additional bike parking on private development, particularly those along the Pinellas Trail. Objective 3B: Create a civic gateway to the Downtown waterfront. Promote Osceola Avenue as the active edge to the expanded Coachman Park. Objective 3C: Enhance public access to the intracoastal waters along the Downtown waterfront with interactive design features such as kayak launch and water step, as well as natural amenities and active family uses. Objective 3D: Utilize portions of the library for alternative uses that may include a restaurant, special events, group gathering, and expansion of art galleries.Objective 3E: Continue to promote and enhance the Clearwater Harbor Marina to establish Clearwater as the boating destination of the region. Objective 3F: Promote the visual and performing arts.Objective 3G: Create and activate space to work as signature destinations, including civic plazas, markets and retail gathering places that promote economic growth for Downtown.Objective 3H: Create a connection along Stevenson Creek with a trail and community amenities. December, 2017 | 49 of 189Chapter 3. Land Use / Redevelopment PlanPhoto Sources: (Center) Ella Crandall, Safety Harbor BoardwalkPolicy 6:Shared parking for commercial, office and mixed uses is encouraged wherever possible.Policy 7:The City shall evaluate the need, size and location for a parking garage(s) to support entertainment, retail, restaurant uses and large events. Policy 8:The CRA will develop property owner incentives for building improvements to support intensive office uses including IT/software, finance and insurance, professional and data management, analytics and services.Policy 9:Encourage internet service and telecommunications providers to continue upgrading and expanding infrastructure capacity and service area.Policy 10:The CRA may evaluate participating with the private sector in land assembly to facilitate projects consistent with this Plan. Policy 11:The CRA may consider reimbursement of impact fees and permit fees as an incentive for redevelopment projects that are consistent with this Plan. Policy 12:The City shall make use of Community Development Block Grant, HOME Investment Partnership Program, State Housing Initiatives Partnership program, and other federal, state, and county funds for Downtown infrastructure and increasing affordable housing options. Policy 13:The City will encourage non-conventional stormwater management practices including Low Impact Development (LID), Green Streets and alternative and integrated stormwater treatment systems. Policy 14:Encourage the use of solar panels above surface and structured parking and other structures as appropriate. Policy 15:The City and CRA will continue to partner with and promote groups and programs that create and provide public art. Policy 16:The City will establish minimum standard uses in the Downtown zoning district that can be approved through a building permit, provided all design standards and other requirements are met. Policy 17:The Downtown zoning district will establish the quality and design features expected for renovation, redevelopment and new construction in Downtown. Clearwater Downtown Redevelopment Plan50 of 189 | December, 2017Policy 28: Properties whose uses have resulted in a higher police level of service than typical properties are encouraged to redevelop with uses consistent with the applicable Character District; if a higher police level of service continues, the use will be the focus of nuisance abatement strategies and law enforcement. Policy 29:The City shall work to increase coordination and communication among residents, Police Officers and Code Compliance staff in an effort to proactively solve problems. Policy 30:Community policing innovations in the CRA shall continue to focus on a variety of policing strategies that increase police visibility and reduce opportunities for criminal activities. Such innovations include, but are not limited to, intensified motorized patrol, bicycle patrol, field interrogations, the establishment of a business and/or neighborhood block watch and the continued presence of a police substation in the CRA.Policy 22:The use of Termination of Status as a Nonconformity shall be limited to render nonconforming height and/or density and intensity conforming and shall not be used to legitimize nonconforming uses and site conditions. Policy 23:Drive-through facilities, where permitted, must be accessory to the primary use and be designed to minimize views of the facility from rights-of-way in order to maintain a pedestrian orientation and preserve the urban form of Downtown. Policy 24:To ensure balance among all users and modes of transportation certain automobile-oriented uses are not supported in the Downtown Plan Area. Policy 25:The City shall continue to encourage neighborhood associations that empower residents to improve their neighborhood and strengthen ties between residents and government. Policy 26:Property owners/developers are encouraged to meet with area neighborhood associations/business groups prior to submitting a major redevelopment project for City review. Policy 27:Prior to the disposition of City and/or CRA-owned properties, a determination shall be made regarding the most appropriate use consistent with this Plan and may require certain uses and site design requirements. Policy 18:The design of all projects in Downtown shall incorporate pedestrian-scale elements that create and maintain an inviting pedestrian environment. Policy 19:The City shall maintain the Public Amenities Incentive Pool, established in 2004, that provides density and intensity increases for projects in excess of the allowable maximum development potential. The Pool is allotted based on a provision of selected public amenities.Policy 20:Transfer of Development Rights is permitted for all projects to assist development provided that both the sending and receiving sites are located in the Downtown Plan Area. Approval of Transfer of Development Rights on a site may allow an increase in the development potential in excess of the maximum development potential of the applicable Character District. The number of development rights transferred to any site with a future land use designation of Central Business District (CBD) are not limited. All uses of transferred development rights shall ensure that the receiving site remains consistent with the vision of the applicable Character District.Policy 21:Projects located at or near the border of the Downtown Plan Area shall use effective site and building design features to ensure an appropriate transition and buffer to less intensive areas. Clearwater Downtown Redevelopment Plan52 of 189 | December, 2017DOWNTOWN CHARACTER DISTRICTSThe Downtown Planning Area is 555 acres and contains several unique commercial areas and residential neighborhoods. This Plan establishes development potential and policies guiding private development as well as City actions. Different areas of Downtown have different characteristics and functions; therefore, development potential, building heights and policies reflect those differences. The Downtown Planning Area is divided into five Character Districts to address each unique area, as shown on Map 3.1. Each District contains a narrative on existing conditions, District vision, intensity, density and height, and development patterns, as well as policies specific to that area. Where applicable District specific criteria or completed plans are incorporated into the District’s vision and policies and are described as supporting documents. 2018 Update on Character DistrictsSince the adoption of the Plan many changes have occurred in the Downtown; however, there continues to be a lack of commercial development, erosion of neighborhood character, and limited new housing development. The 2018 update modifies District boundaries by consolidating two Districts into one and expanding another. Additionally, changes to properties’ development potential are incorporated to allow for greater redevelopment opportunities of existing lots and structures and to encourage new residential development that is in character with existing neighborhoods. Previous policies encouraged lot consolidation for redevelopment which resulted in the demolition of structures that contributed to the character and pattern of the neighborhood and these policies have been removed. These changes are coupled with new and revised policies for each Character District to provide further guidance to achieve their vision. The 2018 update incorporates the goals and policies of several recently completed documents including the North Marina Area Master Plan, Imagine Clearwater and the East Gateway District Vision Plan. The North Marina Area Master Plan’s study area included the northern portion of the Old Bay Character District and 41 parcels (9.671 acres) to the north, outside of the District. The 2018 update includes an expansion of the Old Bay Character District and Downtown Planning Area to include these properties. To fully integrate these properties into the Downtown Planning Area, additional steps will be necessary. The City’s Future Land Use Map and Zoning Atlas will need to be amended to designate the parcels with the Central Business District (CDB) future land use category and the Downtown zoning district, which the majority of the Downtown Planning Area is currently designated. The 2018 update also addresses those parcels in the Prospect Lake and Downtown Gateway Character Districts that were not amended when the Downtown Plan Area boundaries were previously expanded in 2004. Policies address the need to also amend these properties’ future land use and zoning designations to Central Business District (CBD) and Downtown (D) District, respectively, which will consolidate all parcels within these two Districts into the same category, providing clarity regarding development potential and future opportunities to residents and the development community. Relationship to Community Development CodeWhile the Character Districts set the development potential and development policies, redevelopment must also be consistent with the zoning district provisions which include development standards in the Community Development Code. The review and approval process will be consistent and predictable. This will expedite developments which achieve the objectives of this Plan. The revitalization of Downtown Clearwater is critical to the City’s overall success. The City will use all economic development and CRA tools and incentives available to revitalize the Downtown. These concepts guided the formation of the Plan’s goals, objectives and policies and provided direction for the types of City strategies, public investments and development incentives that should be used to encourage and help facilitate private investment that will make Downtown a place in which all people can enjoy. Old BayDowntownCoreProspectLakeDowntown GatewaySouthGatewayCleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Bay BlvdHighland AveMartin Luther King, Jr AveTurner StMap 3.1Character DistrictsClearwater DowntownRedevelopment PlanSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 20171 inch = 1,000 feet®Proposed Old Bay Expansion Clearwater Downtown Redevelopment Plan54 of 189 | December, 2017DOWNTOWN CORE DISTRICT The Downtown Core is bounded by Drew Street on the north, Myrtle Avenue on the east, Clearwater Harbor on the west and Chestnut Street on the south as illustrated above. The Downtown Core is composed of 619 parcels totaling 128.9 acres in area and represents 23.2 % of the Downtown Plan Area. Existing Conditions The Downtown Core is the government center and an important employment area in the City. Many of the Pinellas County and City of Clearwater government offices are located in the Downtown Core as well as private offices and supporting uses. Since 2004 Technology and I/T businesses have expanded in the District and two large residential developments were completed: Station Square on Cleveland Street and Water’s Edge on Osceola Avenue overlooking the waterfront. The Downtown Core is the outlier in several demographic categories. The District’s residents are older on average (mean age 64.1 years) and have the smallest household sizes (mean people per Graph 3.2. Downtown Core Race/Ethnicityhousehold 1.3 persons). Further, the District has the highest median home value at $277,600 and the highest median home rents at $1,768, as well as the highest median income at $56,429. The District also has the highest concentration of white residents in the Downtown Planning Area at 97.3%. Graph 3.1. Downtown Core OccupancySource: mySidewalk.com; US Census 2011-2015 ACSWhiteBlackHispanic/LatinoNon Hispanic/LatinoRace EthnicitySource: mySidewalk.com; US Census 2011-2015 ACS99.1%0.9%1.8%98.2% December, 2017 | 55 of 189Chapter 3. Land Use / Redevelopment PlanCleveland Street is Downtown’s “Main Street” and has a historic character/setting and functions as the major retail street within Downtown. On the eastern end of Cleveland Street is the U.S. Post Office and on the western end is the remodeled and reinvigorated Capitol Theatre, which attracts national musical and cultural acts. Cleveland Street has been improved with streetscaping, public art through Sculpture 360, Dolphin Trail, and the Clearwater Arts Alliance signal box art wraps, and with the renovation of Station Square Park into a plaza park with seating, programming and area for community activities. The Clearwater Main Library overlooks Coachman Park and provides events, programming, education and unique maker studios. Coachman Park is located directly on the beautiful intracoastal waterfront with the Downtown Marina and hosts many signature events including the Fourth of July and Clearwater Jazz Holiday. There is a significant amount of underutilized surface parking at the waterfront. At the prime corner of Osceola Avenue and Cleveland Street which overlooks Clearwater Harbor is the largely vacant Harborview Center. There are a number of institutional uses within the Downtown Core, as well as underdeveloped and vacant land.Court and Chestnut Streets are important corridors to the Beach and City but create challenges for connectivity and balance among other users and modes of transportation due to some automobile-oriented development, pattern and speeds. Similarly, but less intensely, Myrtle Avenue is primarily utilized by through traffic and is uncomfortable for people walking. The Pinellas Trail runs north-south through the Core and connects the heart of Downtown to the City at large. District VisionThe Downtown Core will continue as the center of local government including Pinellas County and City of Clearwater offices. As the historic urban center and heart of Clearwater, the Downtown Core will be characterized by a wide variety of permitted uses developed with the highest intensity of use in the City. The dense urban pattern will facilitate a walkable network oriented for all users. The Downtown Core will be an entertainment destination including an active waterfront, marina, cultural events and attractions, festivals, markets, restaurants, bars, brewpubs/microbreweries, theaters and shopping attractive to all ages. People are the heart of any thriving downtown and as such a key component to the revitalization of the Downtown Core is to attract residential uses, while allowing a variety of housing types and prices. Once a residential base is firmly in place, retail, restaurant and service uses will likely follow. Clearwater Downtown Redevelopment Plan56 of 189 | December, 2017Development PatternsAmong the Downtown Character Districts, the Downtown Core will have the highest density for residential and hotel uses and the highest intensity for non-residential uses and an integrated mix of uses. The Downtown Core shall be redeveloped as a pedestrian-friendly place achieved through a diversity of uses, walkable block sizes and an interconnected street grid, and streetscape improvements that balance the needs of all users. Parking for the majority of uses will be managed as infrastructure supporting the entire Downtown Core. Development and redevelopment along Osceola Avenue shall contribute to the active edge of the Downtown waterfront. The intersection of Osceola Avenue and Cleveland Street, the gateway to the Downtown waterfront, shall have 100% activation on the ground floor of all four corners with commercial uses that generate customers and street activity and invite all people to gather and create community. Cleveland Street will continue to be the spine of Downtown’s entertainment and retail network, and new construction and redevelopment will respect and be integrated with the existing predominant building height, placement and orientation. Additional attention and improvements in aesthetics, pedestrian crossings and active uses will be directed towards Fort Harrison, Osceola and Myrtle Avenues to improve the whole street network. Success for a walkable downtown relies on a connected and expansive network of mobility options. Significant barriers and gaps such as multi-lane through roads with uninviting and limited pedestrian facilities undermine the network. Court and Chestnut Streets will be walkable urban corridors that are safe for people and will continue the urban and human-scale development patterns required throughout the District. The northwest corner of South Myrtle Avenue and Court Street, which has been identified as a possible intermodal site, will be a key corner requiring commercial ground floor uses oriented towards the street to facilitate safe pedestrian activity. The Pinellas Trail will be integrated into the fabric of the Downtown Core by providing safe and convenient connections to the Downtown waterfront and to the Memorial Bridge and across to the Beach. Additionally improvements to the Trail within the Downtown Core and the Intensity, Density & Height Development potential and maximum permitted heights for all Character Districts are shown on Maps 3.2- 3.6. Downtown Core development potential is specified in Table 3.1. The Downtown Core allows for the highest density and intensity of development in the Downtown. The Downtown Core has no maximum height restriction; however the building height for properties along Cleveland Street must respect the historic building pattern through location, coverage and stepbacks. Druid Trail will connect the balance of the City with the Downtown. Development abutting the Pinellas Trail should be oriented towards the Trail, particularly with new ground up development on vacant lots north of Cleveland Street and along Court and Chestnut Streets. Supporting DocumentsImagine ClearwaterIn 2017, the City completed Imagine Clearwater, a vision plan for the Downtown waterfront that focused on how to better connect the waterfront with Downtown, how to draw residents and visitors there and how to catalyze greater activity and investment in Downtown. In order to achieve the vision of creating an active, authentic, iconic civic and open space that celebrates Clearwater’s history natural beauty, culture and diversity and anchors an economically vibrant downtown, the Plan is centered on the implementation of the following four key strategies:xThe waterfront must be anchored by a dynamic new open space xCoachman Park needs an active edge xAn improved Osceola Avenue should complement Cleveland StreetxAccess to the site should incorporate all modes of transportation FAR 4.0Density75 dwelling units per acre or95 hotel units per acreHeight Unlimited*Table 3.1. Downtown Core Development Potential* Policies direct height along Cleveland Street December, 2017 | 57 of 189Chapter 3. Land Use / Redevelopment PlanPhoto Source: (Top) Crandall, Outdoor Dining, 2017Imagine Clearwater envisions an enlarged and redesigned Coachman Park which currently extends from Drew Street to Cleveland Street and is open to the public and hosts dozens of public concerts and festivals each year. The waterfront park envisioned in Imagine Clearwater is one that includes five distinct areas - the Civic Gateway, Bluff Walk, the Green, Coachman Garden, and the Estuary. These areas will provide a variety of spatial experiences with opportunities for active and passive use. This variety, along with additional programming, is intended to accommodate people of all ages and interests, which will help draw people to the park. In addition to creating a unique and exciting waterfront, a central element of Imagine Clearwater is to activate the Bluff. Framing the park with active uses, such as residential, hotel, dining and cultural uses will increase activity and safety within the park and attract people to the area. An active Bluff will also better connect the waterfront with Downtown and leverage City investments, and create physical connections to attract people from Downtown to the waterfront and vice versa. Improved connectivity and access to the waterfront through a variety of modes is also central to the success of the Downtown waterfront/bluff area; therefore, Imagine Clearwater also includes a multimodal strategy that includes a variety of pedestrian routes, shared bicycle lanes, a Jolley Trolley route, the Clearwater Ferry and parking dispersed throughout the park. The referendum needed for these changes to the waterfront passed in November of 2017. The Clearwater Comprehensive Boating PlanThe Downtown Marina should continue to be promoted to establish Clearwater as the boating destination of the region. The Clearwater Comprehensive Boating Plan (2016) identified specific implementation recommendations to achieve this goal: reorganize parking, provide public restrooms, enhance security, add public area wayfinding and add artistic lighting on the Clearwater Memorial Bridge. Downtown Core District PoliciesThe following policies shall govern development within the Downtown Core, as well as City actions:Policy 1:Establish a time frame for the demolition of the Harborview Center and redevelopment of the site as a civic gateway to the Downtown waterfront. Policy 2:Redevelopment of all properties west of Osceola Avenue and south of Cleveland Street must consider natural features and be integrated into the Imagine Clearwater Master Plan. Policy 3:The City shall perform a parking needs analysis to establish priorities for parking solutions and consider the development of a parking structure that will support Downtown as a whole. Clearwater Downtown Redevelopment Plan58 of 189 | December, 2017Policy 4:To ensure a public realm that is friendly and safe for people walking, driveways and curb cuts shall be prohibited on Cleveland Street between Myrtle Avenue and Osceola Avenue and on Fort Harrison Avenue between Drew Street and Court Street where alternative access can be provided. Policy 5:Buildings and development should be people-oriented. Policy 6:Redevelopment and new construction along Cleveland Street shall be compatible with and contribute to pedestrian vitality, human scale and the historic fabric of Downtown through the use of build-to-lines, building stepbacks, active ground level uses and architectural features and details. Policy 7:Develop improved crossing at Court and Chestnut Streets for pedestrians and bicyclists for safety and to reinforce the existing urban development pattern. Policy 8:The City will coordinate with FDOT to ensure future designs of Alt. US-19 will balance the needs of all users and provide pedestrian connections to make a walkable Downtown.The Downtown Clearwater waterfront will be an active, authentic, iconic civic and open space that celebrates Clearwater’s history, natural beauty, culture, and diversity and anchores an economically vibrant downtown. December, 2017 | 59 of 189Chapter 3. Land Use / Redevelopment PlanImagine ClearwaterBY THE NUMBERS19.0acres of park space(110% increase)4.0acres of flexible even use(25% increase)miles of newlypedestrianizedIntracoastal Edge0.30.4miles ofnew Bluff WalkIMAGINE CLEARWATER VISION AND GUIDING PRINCIPLES Clearwater Downtown Redevelopment Plan60 of 189 | December, 2017which contributes to the lack of a cohesive identity. Although the most eastern portion of the District does not enjoy close proximity to the waterfront it has the Pinellas Trail connecting it to the Downtown Core. OLD BAY DISTRICT The Old Bay District is generally bounded by Blanche B. Littlejohn Trail and Myrtle Avenue on the east, Clearwater Harbor on the west, Drew Street to the south, and Cedar Street to the north as illustrated above. Also illustrated above is the Old Bay expansion area outlined in black. There are 342 parcels totaling 95.4 acres of land within the District representing 17.2 % of the land area within the Downtown Plan Area. Existing CharacterThe Old Bay District is a transitional area between the Downtown Core to the south and the lower density residential areas to the north, outside of the Plan area. North Fort Harrison Avenue is the main commercial corridor in this District, and serves as the northernmost gateway into Downtown. Many of the neighborhood roads are narrow, except for Drew Street which is a four lane undivided road. The Pinellas Trail crosses Drew Street at an unsignalized location. Drew Street also has limited pedestrian crossings from the District into the Downtown Core to the south. North Fort Harrison Avenue has narrow sidewalks and divides the District into two distinct sections Graph 3.4. Old Bay Race/EthnicityGraph 3.3. Old Bay OccupancySource: mySidewalk.com; US Census 2011-2015 ACSWhiteBlackTwo + RacesOther, One RaceAmerican IndianAsianHispanic/LatinoNon Hispanic/LatinoRace EthnicitySource: mySidewalk.com; US Census 2011-2015 ACS74.0%6.6%10.9%6.1%1.7%0.7%21.3%78.7% December, 2017 | 61 of 189Chapter 3. Land Use / Redevelopment PlanThe Old Bay Character District has several unique demographic and housing statistics. The District has a high median home value at $217,795, likely due to proximity along Clearwater Harbor, but with one of the oldest housing stocks (mean housing age 1964). This District has among the highest median home rent at $1,080 which is greater than Downtown, City and County averages. Old Bay is comprised of a mix of land uses including residential (single-family and attached dwellings), commercial, institutional, governmental, and recreational. This mix gives the District great diversity and contributes to its eclectic character. Many residential parcels are adjacent to non-conforming industrial and vehicle service uses. The District’s unique character is derived from its location on the Bluff and the significant number of older structures (greater than 50 years old). The water (west) side of North Fort Harrison is predominantly residential comprised of a mix of one and two story single family homes and attached dwellings as well as a few taller residential buildings. The majority of housing types are consistent with an urban neighborhood and create inviting streets that are people oriented. The North Ward Elementary School, the City of Clearwater’s former Partnership School, is located on the northern edge of the District, but is now closed. A historic survey identified the school as being potentially eligible for the National Register of Historic Places. The District is also home to the Francis Wilson Playhouse, as well as the privately operated Clearwater Basin Marina, and the publicly operated Seminole Boat Ramp, both of which generate boat traffic. Clearwater Gas’ administrative offices and warehouse continue to be located within the District between North Myrtle Avenue and the Pinellas Trail. There are many underutilized and vacant properties scattered throughout the District. District VisionThe Old Bay District will be a mixed-use neighborhood supporting the Downtown employment base with residential and limited neighborhood commercial and office uses. The District provides additional public waterfront access for boaters and non boaters outside of the Downtown Core. The unique and charming character will be preserved, and the District will be a safe and fun place to live, work, and play, day and night. A hotel at the Clearwater Basin Marina and a restaurant by the Playhouse would both activate the waterfront area and bring more amenities for the boating community. Redevelopment at or near the Seminole Boat Ramp must balance the needs of the boating community and area residents. Dry boat storage was not found to be an essential commodity to enhance Clearwater as the boating destination of the region, and would not contribute to an active and pedestrian-oriented waterfront. Clearwater Downtown Redevelopment Plan62 of 189 | December, 2017Reopening the North Ward School as a public school or marine/maritime school or visual and performing arts school is encouraged to enhance the neighborhood and utilize the unique structure. Additionally the North Ward School could be adapted to a community/cultural center, art gallery or museum and improved with publicly accessible amenities like a playground, garden, or space for outdoor events to expand the cultural attractions in the District. Historic designation of the North Ward School to preserve the structure while allowing for adaptive reuse is supported. Renovations and adaptive reuse of existing older structures are encouraged in the District. Preserving the existing housing stock is essential to maintaining the neighborhood’s character, charm and appeal. Small infill redevelopment such as single family homes, townhomes, bungalow courts and duplexes that are typically found in urban neighborhoods are appropriate for the District as well. Infill developments on existing smaller lots will provide a needed variety of housing while limiting the visual impact of increased density often associated with large residential towers and surface parking. Creative workspaces and community-use facilities with reasonably priced housing will create a catalyst for economic development. Live-work bungalows are supported in the block south of Cedar to Nicholson Street between Fort Harrison and Garden Avenue. The development pattern in the balance of the District is expected to remain urban in character reflecting the low-rise scale (one to three stories) of the existing neighborhood with greater height and intensity along North Fort Harrison Avenue and at the southwestern edge adjacent to the Downtown.The character of Old Bay should be strengthened through streetscape elements that identify the District as a Downtown neighborhood and promote pedestrian and bicyclist connectivity. Emphasis should be placed on tying the eastern and western areas of the District together by providing linkages between the waterfront and the Pinellas Trail. The City will coordinate with Pinellas County to improve the Pinellas Trail. The City rights-of-way that dead-end at the Harbor will be retained for public access. Public improvements to the Seminole Boat Ramp will enhance waterfront access and appearance and create inviting public access to the waterfront. Current planned improvements include additional parking, a pedestrian promenade through the marina, an elevated observation platform, new greenspace by the Playhouse, landscaping, and public restrooms. Redevelopment should provide opportunities for comfortable walking and access to public areas including the Seminole Boat Ramp and Pinellas Trail. The crossing of the Pinellas Trail on Drew Street will be improved for bicyclist and pedestrian safety. The District will be a place that facilitates a healthy, active, and social lifestyle. Views of and public access to the water offer a unique opportunity to create a special place. View corridors of the water from the bluff and specifically from Nicholson Street and across the School Board property will be required. Intensity, Density & HeightDevelopment potential and maximum permitted heights are shown in Map series 3.2-3.6. The Old Bay development potential is specified in Table 3.2. The Old Bay District is a transitional District and the development potential varies to provide a buffer from the most intense uses to the single family home neighborhoods, outside the District. Additionally the development potential supports a concentration of commercial uses along North Fort Harrison Avenue. FARFronting on N. Ft. Harrison Ave. & westward: 1.5Eastward of properties fronting on N. Ft. Harrison Ave.: 0.5Density35 dwelling units per acre or50 dwelling units per acre for mixed useWest of N. Osceola Ave. & north of Seminole St. & 2 acres or greater, excluding properties fronting on Cedar St.: 50 hotel units per acreBed and Breakfasts: 35 rooms per acre, not to exceed 10 roomsHeightWest of N. Osceola Ave. & between Drew and Georgia Sts. & properties between N. Osceola & N. Ft. Harrison Aves. & between Jones & Drew Streets: 150 feetWest of Garden Ave. & south of Nicholson St.: 55 feetEast of Garden Ave. & south of Nicholson St.: 45 feetNorth of Nicholson St.: 30 feetTable 3.2. Old Bay Development Potential December, 2017 | 63 of 189Chapter 3. Land Use / Redevelopment PlanDevelopment PatternsRedevelopment in the Old Bay District will provide a variety of housing types and densities, mixed use developments as well as neighborhood-scale retail and office development; however, the retention, renovation, and restoration of existing historic homes throughout the District is strongly encouraged. New development and redevelopment will be oriented towards the street. Wide sidewalks will enhance the walkability of the neighborhood. The development potential and height encourages a form of development that fills out a site and reduces vacant space around buildings. Bed and breakfasts may operate within the District; however hotel development may only occur in the area west of North Osceola Avenue, north of Seminole Street and excluding those properties fronting on Cedar Street. Height of development shall be conscious of the transition from the Downtown Core where height is unlimited to the established single family residential scale in the District. North Fort Harrison Avenue is the main commercial area providing neighborhood commercial uses on properties on both sides of the street, but existing residential may remain and mixed-use is anticipated. Wide sidewalks with limited curb cuts are desired for a safe and comfortable experience. New development and redevelopment will contribute to an active and friendly place for walking and biking.The Pinellas Trail is an economic opportunity for residential and commercial investment. The continuation of residential uses along the Trail is encouraged. The properties at the intersection of the Pinellas Trail and Drew Street are the most appropriate for restaurant, brewpub or cultural uses; however, other sites along the Trail may be considered for compatible trail-oriented uses. While development adjacent to the Pinellas Trail may delineate the boundaries between the public and private realm, access should be provided so residents can enjoy this amenity and business can be supported by Trail users. The City’s Gas Department administrative offices and warehouse shall remain at its location between Myrtle Avenue and the Trail. Supporting DocumentsNorth Marina Area Master PlanThe North Marina Area Master Plan was commissioned by the City of Clearwater in response to ULI recommendations which identified a variety of opportunities in the Old Bay District. At the time it was conducted the North Marina Area Master Plan boundary only partially overlapped with the northern area of the Old Bay District. This area of overlap constituted 103 parcels totaling 32 acres. The portion of the North Marina Area Master Plan boundary that extended north beyond the District included an additional 41 parcels totaling 9 acres. The Master Plan recommends the additional area be incorporated into the Old Bay Character District and Downtown Planning Area. The overall goals of the North Marina Area Master Plan are incorporated into the vision and policies of this District and are supported throughout the Downtown Redevelopment Plan. Clearwater Downtown Redevelopment Plan64 of 189 | December, 2017The goals for the North Marina Area Master Plan are to: 1) balance the needs of the boating community, area residents, and the development community; and 2) provide the greatest value to the residents and the City. The plan also focuses on enhancing the publicly-accessible open space elements at the Seminole Boat Ramp. The Plan builds upon existing assets and establishes a vision that was defined through extensive public engagement to remedy existing deficiencies. Redevelopment in the area should include a connection to the Pinellas Trail, multimodal connections, and improvements to the Seminole Boat Ramp to enhance both waterfront access and appearance.The Plan identifies North Fort Harrison Avenue as a mixed-use corridor, with mid-rise residential above active uses and parking or single story buildings with parking in rear, and reduced driveways to prevent conflicts with pedestrians. Historic houses along North Fort Harrison Avenue can remain and be compatible with the limited redevelopment anticipated. Through the planning process the community indicated the greatest support for low-rise development (1 to 3 stories or up to 40 feet tall) on the waterside (west of North Fort Harrison Avenue). The community supported green space as an amenity within the North Marina Area. At the boat ramp the community supported a sit down casual restaurant, waterfront boardwalk and restrooms. The Plan identifies key catalyst sites and uses for redevelopment including a hotel on the northeast portion of the Clearwater Basin Marina and tourism development along North Osceola Avenue near the boat ramp. The Plan includes several suggestions for the North Ward School encouraging that it be reopened, and envisions a makers courtyard at the Cedar block with live-work bungalows with “makers” shops, galleries, and kitchen incubators.Old Bay District PoliciesThe following policies shall govern development within the Old Bay District, as well as City actions.Policy 1:Amend the Future Land Use Map and Zoning Atlas to designate parcels in the Old Bay expansion area Central Business District (CBD) and Downtown (D) District, consistent with the remainder of properties in the Old Bay District.Policy 2:Conduct an updated historic survey to identify potential contributing structures to a historic district within the District. Policy 3:Pursue historic designation of the North Ward School. Policy 4:Establish a building renovation assistance program (e.g., low-interest loans or grants) to revitalize and retain the older housing stock in the District. Policy 5:Develop North Fort Harrison Avenue as a pedestrian-oriented gateway into the Downtown. Policy 6:Utilize sidewalk easements along North Fort Harrison Avenue to achieve wider sidewalks where existing public right-of-way is inadequate. Policy 7:Mixed-use development is encouraged along North Fort Harrison Avenue.Policy 8:Improve North Fort Harrison Avenue with streetstcaping that incorporates lighting, Low Impact Development, and Green Streets to connect Old Bay to the Downtown Core. Policy 9:Connections from the Pinellas Trail to Clearwater Harbor and the Seminole Boat Ramp should be accomplished through signage, lighting, sidewalks and bicycle/pedestrian facilities.Policy 10:Limited commercial nodes that are compatible with the neighborhood and supports trail users may be permitted along the Pinellas Trail. Policy 11:Activate the Seminole Boat Ramp to be a recreation site and improve it with pedestrian paths, picnic areas, park benches, landscaping, lighting, and Low Impact Development (LID) techniques. Policy 12:Support the continuation of the Francis Wilson Playhouse. December, 2017 | 65 of 189Chapter 3. Land Use / Redevelopment PlanPolicy 13:Protect view corridors from Nicholson Street through design standards, building placement, orientation. Policy 14:Coordinate with Pinellas County Schools to explore options to repurpose the North Ward School. Policy 15:Explore options to facilitate the development of affordable live/work bungalows with maker’s shops, galleries, and restaurant startups.Column intentionally left blank Clearwater Downtown Redevelopment Plan66 of 189 | December, 2017The North Marina Area is a vibrant waterfront community on Clearwater HarborWith a variety of uses, it attracts residents, businesses, visitors, and the boating community. It is unique, charming and peaceful, with historic character and culture. It promotes a healthy, active, social, family-friendly, and environmentally-responsible lifestyle. It is a safe and fun place to live, work and play, day and night. Clearwater Downtown Redevelopment Plan68 of 189 | December, 2017SOUTH GATEWAY DISTRICT The South Gateway District is generally bounded by parcels fronting on Chestnut Avenue on the north, the Pinellas Trail on the east, South Fort Harrison Avenue on the west and Druid Road on the south as illustrated above. The District is comprised of 61 parcels of land totaling 23.1 acres and represents 4.2% of the total Downtown Plan Area. Existing ConditionsThe South Gateway is the principal entryway to Downtown from the south. It is also a transition area between the more intensely developed Downtown Core and the Harbor Oaks neighborhood to the southwest and to Morton Plant Hospital further south. Though it is a small area it is largely redeveloped with a mix of townhomes, retail, office, and County buildings, with some remaining vacant/underutilized parcels. The District has one of the three grocery stores serving the Downtown area and a retail center along the heavily-used commuter route of South Fort Harrison Avenue. The single family houses along Turner Street have largely been adapted to neighborhood scale office and residential. Two trails cross the District, the Pinellas Trail running north/south and the Druid Trail running east/west. According to the U.S. Census, the South Gateway Character District has the lowest median household income at $17,167, but residents also have the lowest median home rent at $562, so few are cost burdened (pay more than 50% of income towards rent). The District also has the highest renter occupancy at 89%. Because there are less Source: mySidewalk.com; US Census 2011-2015 ACSGraph 3.6. South Gateway Race/EthnicityWhiteBlack AsianTwo + RacesHispanic/LatinoNon Hispanic/LatinoRace EthnicitySource: mySidewalk.com; US Census 2011-2015 ACSGraph 3.5. South Gateway Occupancy79.4%16.3%2.6%1.7%27.9%72.1% December, 2017 | 69 of 189Chapter 3. Land Use / Redevelopment Planthan 30 residential properties in this District, the majority of which are part of a newer townhouse complex with property values above the City and Downtown median home values and known rental values significantly higher, the apportioning of data for this small geographic area may have skewed the results in this District.District VisionThe South Gateway will continue to provide a transition from the Downtown Core to the single family neighborhoods to the southeast and the Morton Plan Hospital medical area to the south. Adaptive reuse of single family houses into neighborhood scale office will characterize much of Turner Street and is encouraged. Community shopping uses that serve the nearby neighborhoods, employees and commuters and existing offices should remain. South Fort Harrison Avenue will continue to be ideal frontage for commercial, office, and medical uses due to its proximity to the Morton Plant Hospital campus. Curb cuts along South Fort Harrison Avenue are discouraged. The District is also envisioned to redevelop with residential uses such as townhomes and apartments. The South Gateway will be pedestrian friendly and support the multi-modal improvements and connections in Downtown. Intensity, Density & HeightDevelopment potential and maximum permitted heights are shown in Map series 3.2-3.6. The South Gateway development potential is specified in Table 3.3. Development Patterns Due to its adjacency with the Downtown Core and established development patterns, the scale and context of buildings are to be urban in nature and promote a pedestrian-friendly environment. Connections within the District to the Pinellas and Druid Trails are encouraged through site design, streetscape improvements and landscaping. While development adjacent to the Pinellas Trail may delineate the boundaries between the public and private realm, access should be provided so residents can enjoy this amenity and business can be supported by Trail users. FAR 1.5Density 35 dwelling units per acre or50 dwelling units per acre for mixed-useHeight 55 feetTable 3.3. South Gateway Development Potential Clearwater Downtown Redevelopment Plan70 of 189 | December, 2017South Gateway District PoliciesThe following policies shall govern development within the South Gateway District, as well as City actions:Policy 1:The visual connection between the South Gateway and Harbor Oaks Historic District should be strengthened through streetscaping elements and building design. Policy 2:The intersection of the Pinellas Trail and the Druid Trail will be improved with wayfinding to promote the significance of the City’s multimodal network. Uses that support the trail and its users are encouraged. Policy 3:Improve the identification and wayfinding of the Druid Trail as part of the regional network with signage and trail markings. Clearwater Downtown Redevelopment Plan72 of 189 | December, 2017PROSPECT LAKE DISTRICTThe Prospect Lake Character District is bounded by Drew Street on the north, Missouri Avenue on the east, Myrtle Avenue on the west and on the south by Court Street and parcels fronting on Chestnut Street as illustrated above. There are 440 parcels of land totaling 131.9 acres in this District. The Prospect Lake District represents 23.8%of the land area within the Downtown Plan Area.Existing ConditionsThis District includes a mix of retail, office, utility/infrastructure, and residential uses as well as a significant amount of underutilized and vacant property, including the partially constructed 1100 Cleveland building. The Prospect Lake Character District has near even renter and owner occupancy rates and an older housing stock (median housing age 1964). The District has the largest concentration of black residents in the Downtown Planning Area at 23.1%. Recent developments include Fire Station 45 and the Residence Inn both on Court Street, and the Tampa Bay Times building on Cleveland Street. Graph 3.8. Prospect Lake Race/EthnicityThere are also non-conforming vehicle service and industrial uses. There is a concentration of residential housing with historic character along Grove Street between Martin Luther King, Jr. Avenue and Cleveland Street. Parcels in the northeast corner of the District are not designated Central Business District future land use or Downtown zoning district, as shown on Maps 2.2 -2.3. Additional single family homes are scattered throughout the area west of Madison Avenue. Northeast Cleveland Street has small office and commercial buildings. Small portions Graph 3.7. Prospect Lake OccupancySource: mySidewalk.com; US Census 2011-2015 ACSWhiteBlackTwo + RacesHispanic/LatinoNon Hispanic/LatinoRace EthnicitySource: mySidewalk.com; US Census 2011-2015 ACS71.4%23.1%5.5%14.2%85.8% December, 2017 | 73 of 189Chapter 3. Land Use / Redevelopment Planof the District contain a street grid, but the grid is lacking in other areas of the District. In 2003 the City completed construction of Prospect Lake Park in the vicinity south of Park Street between Prospect and Ewing Avenues which provides an alternative to on-site stormwater retention for properties within the watershed area as shown in Map 14 in Chapter 4. In addition, Prospect Lake Park functions as a passive park with pedestrian pathways surrounding the perimeter of the lake. The Nolen, a mixed use development at the southeast corner of Cleveland Street and South Prospect Avenue and along Prospect Lake Park was mostly completed in 2017. The 1100 Cleveland building is redeveloping as a multi-story apartment building with commercial business on the first floor. The parcels between Myrtle Avenue and Prospect Avenue are underutilized, primarily with one- to two-story buildings, vacant lots, and some of the aforementioned vehicle service uses. At the southwest corner of Cleveland Street and North Missouri Avenue, along the eastern edge of the District, is the corporate headquarters of FrankCrum. This large parcel is suburban in character, whereas the remainder of the District is more urban. District VisionThe Prospect Lake District is a transitional area between the Downtown Core with the highest intensity of development and Downtown Gateway District which is primarily a mix of low scale housing and commercial development. This District is an emerging residential district, and further growth is anticipated and desired. The significant amount of vacant and nonconforming properties provide opportunity, and the allowable density will facilitate a variety of residential development ranging from large-scale multi-family to smaller infill projects. The addition of new residents in the Prospect Lake District will enliven Downtown and provide a market for new retail developments and food and drink establishments. A variety of office and commercial uses currently exist and are encouraged to continue, and in specific areas more intense commercial and office development is envisioned. Alternate U.S. Highway 19 (Alt. US-19) has been re-designated from South Fort Harrison Avenue to Myrtle Avenue and functions as the primary north-south through route. Challenges to walkability and crossing due to traffic volume must be mitigated by design to facilitate Myrtle Avenue as a walkable urban street. Additionally, while Myrtle Avenue serves as the dividing line between the Downtown Core and the Prospect Lake District, where a transition in intensity of development is appropriate the area between Myrtle and Prospect Avenues shall support a higher intensity and density than the remainder of the District. Clearwater Downtown Redevelopment Plan74 of 189 | December, 2017Intensity, Density & HeightDevelopment potential and maximum permitted heights are shown in Maps 3.2-3.6. Prospect Lake development potential is specified in Table 3.4. Greater development potential along the western edge of the District allows for development of Myrtle Avenue as a cohesive corridor. Development PatternsSupporting more intense development along the eastern frontage of Myrtle Avenue that is balanced and in character with the Downtown Core is important to bridge the current divide that exists between the east and west sides of the corridor. The blocks east of Myrtle Avenue have the potential to develop at scales that support the eastern edge of the Downtown Core and provide a more active and urban setting around Prospect Lake, which serves as a natural transition to less intensive development to the east. Properties fronting on Cleveland Street and northward will be lower in scale and height to transition to the existing single-family development pattern in the Grove Street neighborhood. Renovation of small historic single-family homes in this area is encouraged while new construction in the vicinity should respect the height and scale of the Grove Street neighborhood. Residential development south of Cleveland Street or along South Prospect Avenue adjacent to Prospect Lake Park should be oriented toward the park and Cleveland Street. Commercial uses of the type and scale to serve local residential areas are permitted and encouraged along Northeast Cleveland Street, Cleveland, Court and Chestnut Streets and Myrtle and Martin Luther King, Jr. Avenues. However, more intense non-residential development may be considered along Myrtle and Missouri Avenues and Court and Chestnut Streets. Hotels, in particular, are permitted on property fronting Cleveland, Court and Chestnut Streets. Existing residential scale offices along Northeast Cleveland Street and Grove and Gould Streets are encouraged to remain and improve. Furthermore, adapting these structures into mixed use or live/work arrangements is permitted and encouraged. Generally, live/work arrangements are permitted throughout the District as are bed and breakfasts.Development throughout the District (residential and nonresidential) shall be designed to create an urban environment that is comfortable and safe for people walking while accommodating vehicles where appropriate.Prospect Lake District PoliciesThe following policies shall govern development within the Prospect Lake District, as well as City actions:Policy 1:Preferred housing styles north of Laura Street are a variety of small scale residential including but not limited to quads, multi-plexes, bungalow courts, townhouses and single family houses of a size and scale consistent with the neighborhood.Policy 2:Explore options to centrally locate parking to serve the District’s commercial uses as infrastructure. Policy 3:Existing neighborhood scale office and commercial uses north of Laura Street are encouraged to remain and be renovated. FARWest of S. Prospect Ave. & Knights Alley: 2.5Remainder of District: 1.5DensityWest of S. Prospect Ave. & Knights Alley: 75 dwelling units per acreRemainder of District: 50 dwelling units per acreEntire District: 40 hotel units per acre,Bed and Breakfasts: 35 rooms per acre, not to exceed 10 rooms HeightSouth of Laura St., fronting on or south of Cleveland St.: 75 feetNorth of Laura St. west of Martin Luther King, Jr. Ave.: 55 feetNorth of & not fronting on Cleveland St. & east of Martin Luther King, Jr. Ave.: 30 feetTable 3.4. Prospect Lake Development Potential December, 2017 | 75 of 189Chapter 3. Land Use / Redevelopment PlanPolicy 4:The City will coordinate with FDOT to ensure future designs of Alt. US-19/Myrtle Avenue, will incorporate complete streets design. Policy 5:The City will coordinate with FDOT to improve pedestrian and bicyclist crossing north and south of Court and Chestnut Streets.Policy 6:Amend the Future Land Use Map and Zoning Atlas to designate all parcels in the Prospect Lake Character District as Central Business District (CBD) and Downtown (D) District, consistent with the remainder of properties in Prospect Lake.Column intentionally left blank Clearwater Downtown Redevelopment Plan76 of 189 | December, 2017DOWNTOWN GATEWAY DISTRICT The Downtown Gateway District is generally bounded by Drew Street on the north, Highland Avenue on the east, Missouri Avenue on the west and Court Street on the south as illustrated above. This District is comprised of 914 parcels totaling 175.3 acres and represents 31.6%of the total Downtown Plan Area. Existing ConditionsThe Downtown Gateway District is a predominantly residential district with limited low scale commercial buildings along Missouri Avenue, Court and Cleveland Streets and Gulf to Bay Boulevard. This area of Clearwater is known for its large Hispanic population, primarily from the Hidalgo region of Mexico, which brings a unique culture and a variety of businesses not found in other areas of the Downtown or City. The Downtown Gateway is the outlier in several demographics categories. It was one of the only Districts to see population growth between 2000 and 2010. The District has 92.8% Graph 3.10. Downtown Gateway Race/Ethnicityof the Downtown’s total Hispanic population, the youngest median age in the Downtown Planning Area at 31.7 years, and the highest average persons per household at 2.7 persons. In addition to having a high percentage of rental units (88% of housing units), this District also has the highest percent of cost burdened persons spending more than 50% of income on rent. Source: mySidewalk.com; US Census 2011-2015 ACSGraph 3.9. Downtown Gateway OccupancyWhiteBlackTwo + RacesOther, One RaceAsianHispanic/LatinoNon Hispanic/LatinoRace EthnicitySource: mySidewalk.com; US Census 2011-2015 ACS80.2%12.8%3.3%1.9%1.8%60.9%31.1% December, 2017 | 77 of 189Chapter 3. Land Use / Redevelopment PlanThe intersection of Missouri Avenue and Cleveland Street is a major entry node, but the main entrance to the District and Downtown is at Five Points, the intersection of Gulf to Bay Boulevard, Court Street, and Highland Avenue. This intersection was enhanced in 2012 with streetscaping and a stone obelisk gateway feature. When the Memorial Bridge Causeway opened in 2005 and routed traffic from Gulf to Bay and Cleveland Street to SR- 60/Court Street it emphasized the street’s wide and underutilized rights-of-way with low traffic counts. Several streets in the District are narrow and have limited space in the right-of-way for sidewalks. Many properties have non-conforming parking in the right-of-way that backs out into the road. Phase III of the Cleveland Streetscaping Project is anticipated to improve the public realm with pavers or painted concrete, lighting, benches, additional shade from trees, on-street parking, expanded outdoor café opportunities and will enhance an already walkable environment with wider sidewalks. The natural amenity of Stevenson Creek runs south-north, entering Clearwater Harbor near Sunset Point Road, and is largely inaccessible as a source of recreation or beauty.Within the Downtown Gateway there is a mix of businesses and some notable reinvestment in the District. The District contains two of the Downtown’s grocery stores, a medical training facility and a community of Hispanic businesses. A large private school is located on Court Street, just west of Five Points. An institutional use on Park Street provides community services including feeding and assistance for the homeless. Notable reinvestment includes the office and retail properties on the east and west side of the obelisk that renovated at a similar time as when the Photo Sources: (Center) Howard Warshauer, Community Garden, 2017City improvements were completed. The former Economy Inn site was purchased and demolished by the Community Redevelopment Agency and now a portion of the site is a community garden. The development of 33 affordable townhouses located at the corner of Drew Street and North Betty Lane was completed in 2014. Clearwater Downtown Redevelopment Plan78 of 189 | December, 2017District VisionThe Downtown Gateway will be a walkable, vibrant, stable, and diverse neighborhood defined by its unique cultural base and mixed land uses. Cultural events and attractions, festivals, markets, restaurants, and shopping will be integrated into the neighborhood. The function and aesthetics of the gateway to Downtown will be improved with attractive streetscape and landscaping elements with appropriate wayfinding signage that identify the District as a Downtown neighborhood and promote pedestrian and bicyclist connectivity. Phase III of the Cleveland Streetscaping Project is anticipated to provide much of this. A unique sense of place will be created with a destination market place and festival core along Cleveland Street and/or Gulf to Bay Boulevard that will foster multi-cultural community gathering. Stevenson Creek will be improved to connect the District to Glen Oaks Park across Court Street to the south and the Clearwater Country Club across Drew Street to the north. The residential neighborhoods will remain as traditional urban neighborhoods with a mix of low-rise housing types. Small infill redevelopment such as single family homes, townhomes, bungalow courts and duplexes that are compatible with single family neighborhoods and typically found in an urban downtown are appropriate for the neighborhood.Intensity, Density & HeightDevelopment potential and maximum permitted heights are shown in Maps 3.2-3.6. Downtown Gateway development potential is specified in Table 3.5. A concentration of commercial uses is supported along Cleveland Street and Gulf to Bay Boulevard. Development PatternsThe existing residential areas should retain their scale and development patterns, with infill developments that gently increase intensity while maintaining the scale and character of the neighborhood. New commercial development is supported along Missouri Avenue, Cleveland Street and Gulf to Bay Boulevard and should provide employment opportunities for the District’s residents as well as serve the daily commercial and service-oriented needs of the neighborhood. The growth and facility needs of medical offices and small businesses that contribute to the local and regional economy and provide a wide range of skilled and professional employment options will be supported. Where commercial and office development abut residential areas, primarily along the northern and eastern edges of the District, redevelopment should be at a scale compatible with those areas. Consolidation of small obsolete development parcels/buildings may be needed for an adequate lot size to accommodate redevelopment. Pedestrian and bicycle access and connectivity will be included in developments and are critical for livable and walkable communities. FARFronting on Cleveland St. between Missouri & Hillcrest Aves. or fronting on Gulf to Bay Blvd.: 1.5Remainder of District: 0.55Density35 dwelling units per acreGenerally, fronting on Missouri Ave., Cleveland St., Gulf to Bay Blvd. more specifically as shown on Map 3.4, Maximum Hotel Density: 40 hotel units per acreHeightSouth of Grove St., fronting on or south of Cleveland St. between Missouri & N. San Remo Aves., or south of Laura St. between Hillcrest & N. San Remo Aves., & properties eastward of Gulf to Bay Blvd. & south of De Leon St.: 55 feetSouth of Drew St. between Missouri & Hillcrest Aves.: 45 feetSouth Drew St. between N. Hillcrest & N. Highland Aves.: 30 feetTable 3.5. Downtown Gateway Development Potential December, 2017 | 79 of 189Chapter 3. Land Use / Redevelopment PlanSource: Gensler & Social Compact, 2012Supporting DocumentsEast Gateway District Vision PlanIn January 2012 the City engaged the residents, business and property owners in the District and surrounding neighborhoods to develop the East Gateway District Vision Plan. The Vision Plan recognized that the District has all the offerings of a traditional neighborhood development: live, work, play and educate, and is uniquely located on the urban edge of the world class destination beaches of Clearwater. The Vision Plan focuses on the creation of a “place” centered on a walkable destination corridor and recognizes four zones to achieve these goals (shown on the inset map below). Zone I West Commercial Anchor is the major entry node at the intersection of Missouri Avenue and Cleveland Street. It is anticipated that this area will serve as an “attractor” from the region for a variety of commercial activities.Zone II Corridor Development identifies the opportunity to re-create Cleveland Street and Gulf to Bay Boulevard as a destination marketplace. This opportunity was created by the re-routing of beach traffic onto Court Street with the opening of the Memorial Causeway Bridge. The Cleveland Streetscape Phase III is a crucial component of the revitalization process and will accelerate neighborhood improvements. East Gateway Vision Plan Zones Clearwater Downtown Redevelopment Plan80 of 189 | December, 2017Zone III Open Space is defined as the natural amenity of Stevenson Creek running through the center of the community. The Vision Plan identifies the creek as a connector to the peripheral community park amenities of Glen Oaks Park and the Clearwater Country Club, and envisions the Creek’s transformation into a community amenity through simple trail/boardwalk and pavilion offerings, and community gardens. A children’s playground in this area would minimize the need to cross Court Street. As a community on the “urban edge”, the offering of open space not only makes it an attractive alternative to the “urban core”, but becomes the differentiator that can distinguish the community. Zone IV Festival Core relies upon the establishment of a core gathering place to foster community identity, pride and ownership. The Vision Plan identifies the intersection of Gulf to Bay Boulevard, Hillcrest Avenue and Cleveland Street as the District’s “Main and Main” as an appropriate location for a Festival Core. The community vision, organized around the four development zones, supports the Downtown Gateway vision, development patterns and District policies contained within. Downtown Gateway District Policies Policy 1:Encourage a mix of affordable and market-rate housing options.Policy 2: Prohibit the rehabilitation of existing motels into residential apartments. Policy 3:Support the assembly of vacant and underutilized properties, as well as the demolition of deteriorated buildings to accommodate redevelopment projects. Policy 4: Encourage the adaptive re-use of underutilized buildings.Policy 5: Transform Stevenson Creek drainage canal into a north-south linear greenway trail. Policy 6:Create a Market/Mercado and/or Festival Core. Policy 7:Encourage community-led public art.Policy 8: Amend the Future Land Use Map and Zoning Atlas to designate all parcels in the Downtown Gateway Character District as Central Business District (CBD) and Downtown (D) District, consistent with the remainder of properties in the Downtown Gateway.Column intentionally left blank Old BayDowntownCoreProspectLakeDowntown GatewaySouthGatewayCleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Bay BlvdHighland AveMartin Luther King, Jr AveTurner StJones StSeminole StCedar StEldridge StNicholson StCourt StLaura StGrove StNE Cleveland StMadison AvePark StFranklin StHillcrest AveBetty LnLincoln AveMap 3.2Maximum FARClearwater DowntownRedevelopment PlanSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 20171 inch = 1,000 feet®Maximum FAR0.50.552.54.0Proposed 2018 AmendmentsOld Bay Expansion AreaDowntown Gateway Amendment Area1.5 Old BayDowntownCoreProspectLakeDowntown GatewaySouthGatewayCleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Bay BlvdHighland AveMartin Luther King, Jr AveTurner StJones StSeminole StCedar StEldridge StNicholson StCourt StLaura StGrove StNE Cleveland StMadison AvePark StFranklin StHillcrest AveBetty LnLincoln AveMap 3.3Maximum DensityClearwater DowntownRedevelopment PlanSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 20171 inch = 1,000 feet®Maximum Dwelling Units per Acre355075Proposed 2018 AmendmentsOld Bay Expansion AreaDowntown Gateway Amendment Area Old BayDowntownCoreProspectLakeDowntown GatewaySouthGatewayCleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Bay BlvdHighland AveMartin Luther King, Jr AveTurner StJones StSeminole StCedar StEldridge StNicholson StCourt StLaura StGrove StNE Cleveland StMadison AvePark StFranklin StHillcrest AveBetty LnLincoln AveMap 3.4Maximum Hotel DensityClearwater DowntownRedevelopment PlanSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 20171 inch = 1,000 feet®Overnight Accommodations (Hotel) Units per AcreN/A405095Overnight Accommodations (Bed & Breakfast) Rooms per Acre10Proposed 2018 AmendmentsOld Bay Expansion AreaDowntown Gateway Amendment Area Old BayDowntownCoreProspectLakeDowntown GatewaySouthGatewayCleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Bay BlvdHighland AveMartin Luther King, Jr AveTurner StJones StSeminole StCedar StEldridge StNicholson StCourt StLaura StGrove StNE Cleveland StMadison AvePark StFranklin StHillcrest AveBetty LnLincoln AveMap 3.5Maximum Mixed-Use DensityClearwater DowntownRedevelopment PlanSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 20171 inch = 1,000 feet®Mixed-Use DensityN/AProposed 2018 AmendmentsOld Bay Expansion AreaDowntown Gateway Amendment Area50 Units per Acre Old BayDowntownCoreProspectLakeDowntown GatewaySouthGatewayCleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Bay BlvdHighland AveMartin Luther King, Jr AveTurner StJones StSeminole StCedar StEldridge StNicholson StCourt StLaura StGrove StNE Cleveland StMadison AvePark StFranklin StHillcrest AveBetty LnLincoln AveMap 3.6Maximum HeightClearwater DowntownRedevelopment PlanSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 20171 inch = 1,000 feet®Height30UnlimitedProposed 2018 AmendmentsOld Bay Expansion AreaDowntown Gateway Amendment Area75100 (Hotel Only)1504555 Clearwater Downtown Redevelopment Plan88 of 189 | December, 2017HOUSING & NEIGHBORHOOD ELEMENT Residential UseThe following analysis utilizes data from the 2000 and 2010 U.S. Censuses and the 2011-2015 American Community Survey (ACS) to track growth and changes. Due to the ACS being an on-going, but randomly selected analysis, residential units that were constructed after 2010 are not included in this review. Character District boundaries do not always follow Census Tract boundaries; therefore data available at the Census Tract level was apportioned using MySidewalk. Existing Residential ConditionsThe Clearwater Downtown Redevelopment Plan currently governs 545 acres comprised of 2,374 parcels; however the proposed Old Bay Expansion area was included in the following analysis, bringing the total to 555 acres. Of the 555 acres, approximately 28% or 148.8 acres are devoted to residential land uses as follows: 13% multi-family; 5% two-family or duplex; and 9% single-family dwellings. In 2010 there were a total of 2,864 housing units in Downtown, a 9% increase since 2000. During this same period, Downtown’s population increased almost 34%, from 3,718 people in 2000 to 4,974 persons in 2010. Although the median age of the housing units in Downtown is 1974, 47% were constructed pre-1969. Renters primarily occupy housing in Downtown. According to the 2011-2015 ACS, approximately 77% of the total housing stock was renter-occupied whereas the rental rate for the City as a whole was only 41.7%. This is quite similar to the rental rates in 2000, which were 75% and 38% respectively. The median home value in Downtown has risen significantly since 2000, from $48,154 to $203,325 (+322%). Downtown housing values are higher than the City’s median home value of $175,272, which also saw increases (+84%). For a better understanding of the location and types of housing located in Downtown, a detailed review of each Character District follows.Downtown Core DistrictIn the Downtown Core only 8.8% of the land area is developed as residential, there are two parcels of single-family dwellings and there are no duplexes. There are several large multi-family developments, some of which are age-restricted to 55 and above including the Oaks of Clearwater and Prospect Towers of Clearwater. Nine percent (9%)of the housing units were built prior to 1969, while the majority of housing units (45%) were constructed between 2000 and 2009. The large multi-family projects are either located on Clearwater Harbor, directly across the street from it or along Cleveland Street. According to the 2011-2015 ACS, only 20% of housing is owner-occupied, a number that has declined since 2000 when 33% of units were owner-occupied. As of the 2011 – 2015 ACS, the median home value is $316,163, which is 43% greater than the Downtown Plan Area’s median value and 57% than the City’s overall median housing value. Old Bay DistrictApproximately 23.5% of the land area in the Old Bay District is used for residential purposes. The majority of these properties are located west of Osceola Avenue and between Garden Avenue and Blanche B. Littlejohn Trail. Old Bay is characterized by a variety of housing types ranging from small older single-family homes to newer multi-family housing located along Clearwater Harbor, but on average the housing stock is 10 years older (median age 1964) than in Downtown generally. Seventeen percent (17%) of the housing units were constructed before 1940 and another 25% were constructed between 1940 and 1959. The home ownership rate in Old Bay is 33%, which is greater than in the Downtown as a whole (23%). Home values are slightly higher with the median home value at $240,644 compared to $203,325 in the entire Downtown. The majority of higher home values are concentrated west of North Fort Harrison Avenue along the waterfront and the remainder of the District has more modest housing values. Garden Trail Apartments, a new affordable housing development was recently completed and is not included the 2010 U.S.Census data used above. South Gateway DistrictAlthough there are still very few housing units (39) in South Gateway occupying only 14.8% of the District’s land area, this is an increase in 22 units since 2003. The Harold Court 24-unit townhome development was constructed in 2006 and is the District’s largest residential development. Over the years some of the District’s housing stock, mainly along Turner Street, has been converted to office December, 2017 | 89 of 189Chapter 3. Land Use / Redevelopment Planuses. According to the 2011-2015 ACS, only 11% of the housing in South Gateway is owner-occupied and has a median value of $280,371, which is 32% more than the Downtown median housing value.Prospect Lake District Most of the residential uses located in the Prospect Lake Character District are located in the vicinity of Drew and Grove Streets with some additional units scattered throughout the area between Court and Pierce Streets, Martin Luther King, Jr. and Madison Avenues. Single-family and multi-family dwellings comprise the majority of housing in this District and 49% are renter-occupied. The median home value is $151,600, which is less than the median value of the Downtown Plan Area. Housing stock in the District is older (median age 1964), with the largest percentage of residential units built before 1939 (31.8%). The Nolen, a recently completed large mixed use development, represents some of the newer housing construction. Additionally the long delayed Strand development at 1100 Cleveland Street is now under permitting review for mixed use. Downtown Gateway DistrictThe majority of land (53.8%) in the Downtown Gateway District is devoted to residential uses. Twenty-one percent of the area is occupied by multi-family uses, while two-family dwellings occupy almost 15% and single-family dwellings occupy just over 18%. Cleveland Street and Gulf to Bay Boulevard are primarily commercial corridors, while the remainder of the District is residential. The housing in Downtown Gateway is similar in age to that found in other Character Districts. Almost 66% was constructed before 1969. Like the majority of Downtown, this District has a high percentage of rental units approaching 88% of the total. The median home value is $147,626 which is almost 32% less than the median for the Downtown Plan area.Existing Income ConditionsIn addition to the high renter-occupancy rate and an aging housing stock, an important factor affecting housing in Downtown is low income levels. The median household income in Downtown is $43,259, which represents a 64% increase since 2000 but still remains less than the current estimates for the City as a whole ($49,749 median). Large concentrations of low- and moderate-income persons are found in all Character Districts, with the exception of the Downtown Core. In fact, all but two Census block groups located in Downtown have been classified by the Department of Housing and Urban Development (HUD) as low and moderate income. Table 3.6. Median Household IncomeCharacter District Median IncomeDowntown Core $56,426Old Bay $35,606South Gateway $17,167Prospect Lake no dataDowntown Gateway $31,382Downtown $35,427City of Clearwater $44,198Source: mySidewalk.com; US Census 2011-2015 ACS Clearwater Downtown Redevelopment Plan90 of 189 | December, 2017This means that at least 51% of the household incomes are less than 80% of the median income for the City. Following is a breakdown of median income by each Character District.Existing Housing ProgramsThe City of Clearwater Economic Development and Housing Department provides a variety of housing programs to assist very low- to moderate-income residents. These programs are funded by two federal, one state and one county program. From the federal government, the City receives Community Development Block Grant (CDBG) and Home Investment Partnership (HOME) funds. From the state, the City receives State Housing Initiatives Partnership (SHIP) funds and from the County, the City utilizes Program Income from the Pinellas County Housing Trust Fund (PCHTF). These programs are made available to Clearwater residents directly from the City or through community non-profit partners, to which the City provides funds for specific projects. Loans are provided to homeowners for rehabilitation and down payment and closing cost assistance. Loans are also provided to developers, community housing development organizations and non-profit organizations for land acquisition, new construction and rehabilitation of affordable housing. Grants are available to social service agencies that provide services to the homeless and other low- to moderate-income individuals and families. “Missing Middle” Infill Housing OptionsThere is a large portion of the housing spectrum that is traditionally found in downtowns, but less prevalent in the existing Downtown Clearwater districts. With single-family detached dwelling units on one end of this range and large-scale apartment complexes on the other, the types of “missing” housing in the middle of this spectrum include multiplexes, courtyard apartments, townhouses, live/work units, and other variations of clustered single- and multi-family units, which are typically compatible in scale with single-family homes. Providing these housing options throughout the Downtown area will generate a gentle increase in density without altering the character of a neighborhood by utilizing underused spaces. “Missing middle” homes are an ideal redevelopment strategy to address changing demographics which include increasing numbers or households led by single persons, those without children and empty nesters.Because Clearwater has an assortment of family and income types, the City wants to ensure everyone has access to an array of quality housing they can afford, while maintaining neighborhood character and improving community relations. “Missing middle” homes create more diverse communities with a stronger sense of place, help meet the growing demand for walkable urban living and can help restore living standards for all family types. December, 2017 | 91 of 189Chapter 3. Land Use / Redevelopment PlanHomeless IssuesLike many downtowns, especially those located in warmer climates, the City of Clearwater faces an ongoing challenge with homeless persons. There are several thousand homeless persons in Pinellas County and the City relies on the results of an annual Point in Time count. In 2017, 20% of the 2,831 individuals self reported Clearwater as the place where they stayed. Agencies providing temporary shelter for this population, however, indicate there are not enough beds to accommodate the need. It is evident that the City’s responsibilities for the homeless will continue to grow. In 2017, the City received increasing complaints of aggressive homeless individuals in downtown. The Clearwater Police Department (CPD) identified a high concentration of Spice (a dangerous synthetic drug) users among the homeless community. The CPD was able to target these offenders and eliminate the Spice problem in a matter of weeks. Also in 2017, the City hired a consultant to evaluate homelessness in Clearwater and to provide direction for staff. There are several components of the homeless population. There are those homeless persons seeking to improve their status and seek assistance. These persons work every day but still need a place to live. There are also those homeless persons who elect not to seek public assistance and choose to live on the street. This group may include the mentally ill, addicted individuals or those who prefer no structured environment or those who may use feeding programs or no assistance at all. It is this latter group of homeless that is particularly visible in Downtown and surrounding areas creating concerns for those working, living and patronizing the area. Issues associated with this homeless group include intimidation, panhandling, crime, use of outdoor spaces for personal hygiene, and others. This homeless group is attracted to Downtown for many reasons including the location of the PSTA bus terminal, the Post Office, access to social services, day labor establishments, bars and inexpensive motels. Through the City Manager’s Homeless Initiative the City provides funding to the Homeless Leadership Board (HLB) and five Continuum of Care providers: Homeless Empowerment Program (HEP), Pinellas Hope, Pinellas Safe Harbor, Religious Community Services (RCS) and the Salvation Army of Upper Pinellas County.Other agencies and religious organizations located in Clearwater also provide assistance to the homeless: Pinellas County Social Services, St. Vincent de Paul soup kitchen, Peace Memorial Presbyterian Church, and The Refuge Outreach Church. The City of Clearwater in partnership with Directions for Living and with the assistance of the Clearwater Police Department Downtown Bike Team provides outreach and referral services to homeless individuals and families. Clearwater Downtown Redevelopment Plan92 of 189 | December, 2017The following policies support improving the condition of the existing Downtown housing stock, construction of new housing and strategies for improving the situation for the homeless. Policy 1:Support increased home ownership and improved housing maintenance by targeting low- to moderate-income areas including Downtown for the use of CDBG, HOME, SHIP and PCHTF programs. Policy 2:Continue and expand housing rehabilitation programs for very low- to moderate-income persons with relaxed underwriting guidelines to facilitate a comprehensive impact.Policy 3:Continue to increase down payment and closing cost assistance for very low- to moderate-income persons to encourage potential homeowners to purchase in Downtown.Policy 4:Provide assistance for the acquisition, development and rehabilitation of affordable and mixed-income multi-family properties. Policy 5: Target the Downtown Gateway and Old Bay Districts for housing rehabilitation, down payment assistance and new infill construction benefitting income qualifying homeowners. The desired outcome of this strategy is to create mixed-income neighborhoods.Policy 6:Provide funds to for-profit and non-profit housing developers to acquire vacant lots and/or construct single-family dwellings in the Old Bay and Downtown Gateway Districts.Policy 7:Target the existing single-family and two-family areas in the Prospect Lake District for housing rehabilitation and increased home ownership.Policy 8:Target the Downtown Core, South Gateway and Prospect Lake District for new multi-family owner and renter-occupied development. Policy 9:Encourage additional non-profit agencies to work in Downtown to provide additional housing. Policy 10:Support non-profit agencies that assist the Hispanic population, especially in the Downtown Gateway Character District.Policy 11:Support neighborhood outreach activities that teach property owners housing maintenance skills. Policy 12: Continue to support Paint Your Heart Out program and inclusion of properties in the Downtown.Policy 13:Continue to work with Pinellas County and other coordinating organizations to address the problem with the chronic homeless population.Housing Policies As described above, Downtown does not lack land devoted to residential purposes nor does the area have a housing shortage for existing residents. However, there are issues affecting Downtown’s desirability as a place to live including significantly high rental occupancies, absentee landlords, overcrowding in certain areas, a relatively old housing stock, deferred housing maintenance, and a disproportionate number of low- to moderate- income residents. Left in its current state, it is likely that the existing housing in Downtown will only continue to attract those who do not have other housing choices and these conditions continue to intensify. While the general economy has improved and market rate housing is strong, conditions for low- to moderate-income households have worsened.An important aspect of the People Goal established for Downtown (see Goals, Objectives, and Policies in Chapter 3) is to make Downtown a place that attracts people to live. In order to reach this goal, the Objectives support encouraging residential uses with a variety of densities, housing types and costs and making available incentives to gain more residential uses Downtown. Due to its location as the employment and government center, its base of potential redevelopment infill parcels, its views of Clearwater Harbor and close proximity to Clearwater Beach, and lack of significant crime, Downtown is an excellent location for new and rehabilitated housing. December, 2017 | 93 of 189Chapter 3. Land Use / Redevelopment PlanPolicy 14:Continue to support the Homeless Leadership Board, Continuum of Care providers and the City Manager’s Homeless Initiative to identify and implement short and long term solutions to the homeless issues. Policy 15:Increase lobbying efforts to obtain more appropriations for housing programs and to secure new sources of funding. Housing StrategiesIn order to implement the above policies, the following strategies should be pursued.Strategy 1:Continue to provide a “local contribution” to developers who are applying for low-income housing tax credits (LIHTC) and/or state or local multi-family bonds for projects in Downtown. Strategy 2: Continue to work with Community Housing Development Organizations to identify properties suitable for acquisition, construction, or rehabilitation of affordable housing. Strategy 3:Evaluate the feasibility of assisting potential low- to moderate-income homebuyers to purchase two-family dwellings so that they can occupy one unit and rent the other to assist in the mortgage payment. Strategy 4:Evaluate amending the Comprehensive Plan and Community Development Code to allow accessory dwelling units as well as specifically encouraging them for affordable housing. Strategy 5:Evaluate impediments to developing missing middle housing such as parking requirements, and develop necessary amendments to the Community Development Code. Neighborhood Impact Assessment According to Florida’s Community Redevelopment Act, Florida Statutes Chapter 163, Part III, a neighborhood impact assessment is required for a Redevelopment Plan if the Redevelopment Area contains low- and moderate-income housing. Clearwater’s original Community Redevelopment Area and Plan were approved in 1981; the statutory regulations at the time required a “neighborhood impact element” only if a project of the redevelopment plan contained and would affect low or moderate-income housing. Amendments to the Community Redevelopment Act in 1983 and again in 1984 revised the neighborhood impact element to be required if a redevelopment area contained low- or moderate-income housing and if the redevelopment would affect the residents in the redevelopment area. Clearwater Downtown Redevelopment Plan94 of 189 | December, 2017focus for those neighborhoods. Construction will begin in 2018 on the last phase of the Cleveland Streetscape project (Phase III) within the Downtown Gateway, from Missouri Avenue on the west to just west of San Remo Avenue on the east, in addition to Gulf to Bay Boulevard from Cleveland Street/Evergreen Avenue on the north to Court Street on the south. City plans call for a festival zone and/or Mercado to be incorporated at the intersection of Cleveland Street, Gulf to Bay Boulevard, and Evergreen Avenue, which will require a reconfiguring of the intersection. This will complete the transition of these roadways after the shift in Beach related traffic to Court and Chestnut Streets from former State roads with excess capacity to local roads that provide improved areas for people walking and biking east-west within Downtown. No changes in the secondary street pattern are planned and those streets will continue to serve as local streets for the Downtown Gateway. The planned traffic circulation changes described above will not negatively impact the Downtown Gateway (2004 expansion area). Environmental QualityThis impact assessment evaluated three areas of environmental quality: potable water, wastewater and stormwater management. The entirety of the Downtown Gateway has access to the City’s potable water system and is served by the City’s wastewater system. Capacity is available for each of these utilities to meet the anticipated redevelopment needs. Therefore, there is no expected negative impact to the 2004 expansion area with regard to potable water and wastewater Although not contemplated by the Plan, should relocation of existing residents be proposed using federal funds, the project shall comply with the federal Uniform Relocation Act of 1970, (Public Law 91 - 646). Traffic CirculationSince the incorporation of the Downtown Gateway (2004 expansion area) into the Community Redevelopment Area, one significant change in the traffic circulation pattern within the Downtown has occurred. The City and FDOT constructed a fixed-span bridge replacing the drawbridge that previously connected the mainland with the Beach. As part of the bridge replacement, access to and from the bridge was moved to Court and Chestnut Streets which are a one-way pair and are designated as State Road 60. Gulf to Bay Boulevard from Highland Street to Cleveland Street and the entire length of Cleveland Street have been reclaimed as local streets. The primary entry to Downtown from the eastern sections of the City is now Gulf to Bay Boulevard and Cleveland Street at their intersection with Highland Street (Five Points). The Master Streetscape Plan, incorporated into the Downtown Redevelopment Plan in 2004, envisioned improving the transition of Gulf to Bay Boulevard, Highland Avenue and Court Street as well as the length of Cleveland Street through Downtown. These improvements, several of which have been constructed, recognize the importance of the eastern gateway into Downtown. Gulf to Bay Boulevard and Cleveland Street serve as local streets for the adjacent residential neighborhoods incorporated into Downtown with the 2004 expansion as well as the neighborhood commercial The eastern portion of the Community Redevelopment Area, as expanded in 2004, does contain low- to moderate-income housing or residents. The following neighborhood impact assessment was conducted for the expansion area only, and has been updated to address current (2017) conditions and planned improvements. The statute establishes six elements that should be reviewed as part of the neighborhood impact assessment: xRelocationxTraffic circulationxEnvironmental qualityxAvailability of community facilities and servicesxEffect on school populationxOther matters affecting the physical and social quality of the neighborhood. RelocationIn the event that relocation of existing residents is proposed to implement this Plan, the City of Clearwater Community Redevelopment Agency (CRA) will comply with the Tenant Relocation Plan provisions of Pinellas County Code (Sec. 38 - 81 through 38 - 86, as amended). In accordance with Pinellas County regulations, the CRA will provide relocation assistance if the CRA sponsors or assists redevelopment involving the acquisition of land. The CRA staff will ensure consistency with the relocation and compensation program. At a minimum, the relocation assistance will include advance written notice to tenants, advisory services to assist tenants in finding appropriate replacement housing, and payment of relocation expenses. December, 2017 | 95 of 189Chapter 3. Land Use / Redevelopment Planservices. With regard to the stormwater management, several major projects have been completed that address stormwater within the 2004 expansion area and in the areas west and south. In 2003 the City constructed Prospect Lake Park, a regional stormwater management retention area located south of Cleveland Street and between Prospect and Ewing Avenues in the Prospect Lake District. For development within selected stormwater basins, stormwater is directed to Prospect Lake Park and treated in a wet retention pond. New development within the service area has the option of discharging their stormwater into this system rather than constructing an on-site stormwater retention pond. This regional stormwater pond is intended to improve water quality system-wide as well as reduce the number of unsightly and poorly maintained individual stormwater facilities. Map 14 in Chapter 4 identifies the Prospect Lake Regional Stormwater District. The 2006 Glen Oaks Stormwater project reduced flooding along Stevenson Creek while improving stormwater quality. Additionally, the City is currently upgrading stormwater, sanitary sewer, and potable water lines near the end of their design life within the Downtown Gateway District. The East Gateway Stormwater and Sanitary Sewer Capital Improvement Project provides water quality benefits of removal of over 7,200 pounds per year of suspended solids, 26 pounds per year of total phosphorus, and 69 pounds per year of total nitrogen. Water quantity benefits include reductions in flood depths at several locations. The project will be completed by late 2018. Availability of Community Facilities and ServicesWithin the greater Downtown, there are a variety of community facilities and services available to residents. Existing community facilities include a variety of parks and recreational facilities, governmental offices, social service agencies, churches and community clubs. The Plan recognizes the importance of these facilities in the life of residents and the Plan supports the retention of these facilities in the area. Effect on School PopulationThere are no public schools located in the 2004 expansion area. However, there are several elementary schools in close proximity to serve the existing and new school age children. St. Cecilia School is located on Court Street at Hillcrest Avenue and is the sole private, parochial school in the expansion area drawing students from throughout the City. The redevelopment plan will not have a detrimental effect on providing school facilities to the anticipated new students in the area. Clearwater Downtown Redevelopment Plan96 of 189 | December, 2017Other Matters Affecting the Physical and Social Quality of the NeighborhoodThe proposed redevelopment activities are intended to provide stability to both the residential area as well as the commercial uses within the expansion area. The planned infrastructure projects will enhance the image of the neighborhood and serve to attract new businesses including retail and office development. The improved maintenance of streets, sidewalks, and landscaping as well as housing rehabilitation will improve the quality of the neighborhood. Overall, the proposed redevelopment strategies will serve to increase the quality of life for all expansion area residents. In summary, the proposed strategies in this Community Redevelopment Plan are not expected to negatively impact the expanded Community Redevelopment Area. Clearwater Downtown Redevelopment Plan98 of 189 | December, 2017FUTURE PUBLIC RECREATION FACILITIES & OPEN SPACE The Downtown park system and location of the heart of Downtown overlooking Clearwater Harbor are major assets to Downtown Clearwater. Many of the previously identified enhancements are complete; however, continuing to enhance the park system elevates the quality of these facilities and contributes to making Downtown a destination attracting both residents and visitors. Additional projects are planned within Downtown and these improvements are described below and illustrated on Map 3.7. In addition to constructing physical improvements, programming and events are important for activation of public park space. Downtown Waterfront ParkCurrently the Downtown waterfront park is comprised of multiple parks, open spaces and recreation amenities. An enlarged and redesigned Downtown waterfront park will be comprised of five distinct areas - the Civic Gateway, Bluff Walk, the Green, Coachman Garden, and the Estuary - which, when complete, will increase the park and open space to 19 acres. These areas will provide a variety of spatial experiences with opportunities for active and passive use. This variety, along with additional programming, is intended to accommodate people of all ages and interests, which will help draw people to the park. The distinct zones are designed to provide more human scale and a variety of open space experiences. The Estuary will be a functional and aesthetic highlight of Florida’s coastal ecology with boardwalks and stormwater improvements, and the Coachman Garden will increase day-to-day activities with a state-of-the-art playground, children’s water feature, slides in the natural slope and access to the water. The Green will be a central gathering space offering a variety of passive and active uses, including a four-acre lawn designed to be flexible for a variety of activities, and a new bandshell. The Civic Gateway will connect the Downtown to Coachman Park at the corner of Osceola Avenue and Cleveland Street and is envisioned to include features like a shaded rain catcher pavilion and fountain, splash pad, and upper and lower plazas.Improved connectivity and access to the waterfront through a variety of modes is also central to the success of the Downtown waterfront/bluff area; therefore, the new park design also includes a variety of pedestrian routes and shared bicycle lanes, some of which are part of the Bluff Walk. South of Cleveland Street, the pedestrian and bicycle trails will traverse a more natural landscape, with scenic overlooks and a spiral access ramp connecting to the east-bound Memorial Causeway Bridge sidewalk. Headed north, a pedestrian bridge over Cleveland Street will connect to a more urban section of the park while still providing outlook opportunities and access to Drew Street. Clearwater Harbor MarinaFuture areas of improvement for the Clearwater Harbor Marina include construction of public restrooms, a new dock master building, and a Ferry Landing alongside the promenade and lighting of the bridge and enhanced security.Seminole Boat RampThe existing Seminole Boat Ramp has eight boat ramps and a small picnic area, and several improvements are planned to enhance this pubic amenity. In 2017 the City initiated design and permitting work for certain improvements, including reconfigured paved parking, additional overflow parking, and additional storwmater management utilizing low impact development methods. A pedestrian promenade, an elevated observation platform and new greenspace by the Francis Wilson Playhouse are also part of the design. Additionally a multi-use path providing connections between the surrounding neighborhood and the waterfront is also included and detailed below under Trails subsection. Stevenson Creek Linear GreenwayThe utilitarian and currently underutilized Stevenson Creek drainage canal that runs north/south through the center of the Downtown Gateway is proposed to be turned into a natural amenity for Gateway residents. Many residents use this area as a path on a regular basis and establishing a linear greenway will formalize those connections in a safe and responsive way. Additionally, the creation of a pedestrian trail and linear greenspace between Court Street and Pierce Street will provide needed open space in the District. December, 2017 | 99 of 189Chapter 3. Land Use / Redevelopment PlanMercadoA Mercado, a multi-cultural Market inspired by the Hispanic heritage of the community will create a “place” for community gathering and cultural significance, and will be constructed in the vicinity of Downtown Gateway’s (formerly East Gateway) “main & main” which occurs at the intersection of Cleveland Street and Gulf to Bay Boulevard. The Mercado will be a multi-use space suitable for open space with a runnel (channeled water feature), as well as events and markets with pop-up tents and also permanent building structures for small retail or restaurant. The final design and construction of the Mercado is anticipated to start in 2018. TrailsAn extension of the Fred E. Marquis Pinellas Trail is proposed through the redesigned Downtown waterfront park that will connect the Pinellas Trail with the waterfront and park. The additional route may include a pedestrian bridge over Cleveland Street and a spiral ramp onto the Memorial Causeway Bridge. Additional improvements to Pinellas Trail crossings could make the Trail more pedestrian/bicycle friendly and safe. The Trail crosses several high-volume roadways where people walking and biking the Trail do not have the support of lights to stop traffic for safe passage and must use their judgment to safely cross. Continuation of the City and Pinellas County partnership for Trail maintenance and improvements will enhance the Pinellas Trail. The recently completed Beach Connector portion of the Druid Trail provides a critical route for users traveling to the Beach. Additionally the east-west Druid Trail connects to the north-south Pinellas Trail in the South Gateway Character District. The remaining phases of the Druid Trail will connect to the Duke Energy Trail near US Highway 19. Though the final phases are outside of the Downtown Planning Area, by connecting these two important north-south Trails, the Druid Trail substantially increases the Trail network’s usefulness and enhances Trails within the Downtown. The Druid Trail is anticipated to be complete in 2018/19. Additional multi-use paths and the City’s first cycle tracks will enhance biking connectivity to neighborhoods and area attractions in the Downtown Planning Area. Multiuse paths are proposed on portions of Nicholson Street and North Osceola Avenue in the Old Bay Character District to connect the Pinellas Trail, the waterfront and neighborhoods. Two cycle tracks, which are wide bike lanes physically separated from traffic by a buffer of landscaping, are proposed on each side of the Cleveland Street from Missouri Avenue to Five Points. Cleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Bay BlvdHighland AveMartin Luther King, Jr AveTurner StClearwater CountryClubGlen Oaks ParkJack Russell StadiumClearwater HarborMarinaSeminole BoatRampNorth GreenwoodRecreation CenterDruid TrailPinellas TrailStationSquareStevenson CreekDowntownWaterfrontPinellas TrailExtensionProspect LakeParkMap 3.7Future Public Recreation Facilities & Open SpacesClearwater DowntownRedevelopment PlanSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 20171 inch = 1,000 feet®Future Public RecreationFacilities & Open SpacesTrailsDruid Trail - FutureDruid Trail - ExistingPinellas Trail - ExtensionPinellas Trail - ExistingParksExistingExisting - To Be ImprovedFuture ParksDowntown Plan AreaProposed Old Bay ExpansionMulti-Use Path December, 2017 | 101 of 189Chapter 3. Land Use / Redevelopment Plan Clearwater Downtown Redevelopment Plan102 of 189 | December, 2017FUTURE TRANSPORTATION & PARKING As discussed in Chapter 2, there are many users of the Downtown roadway network, all competing for a limited amount of right-of-way. Previous plans and infrastructure projects have concentrated on improving efficiencies for vehicles while starting to enhance the sidewalk system through streetscape projects and completing sidewalk networks. Future projects will continue “completing” the City’s streets for all modes and users, including transit, people riding bikes and walking. Several plans have been prepared by the City of Clearwater, Florida Department of Transportation (FDOT), and Forward Pinellas analyzing various aspects of the Downtown roadway system and making recommendations for mid-term and long-term roadway improvements to the existing roadway network to promote safe and sustainable pedestrian and bicycle mobility within the Downtown area. These studies include: xImagine Clearwater (City of Clearwater, 2017)xNorth Marina Area Master Plan (City of Clearwater, 2016) xSR 60 Preliminary Screening Corridor Study (FDOT, 2017)xSR 60 Corridor Multimodal Implementation Strategies (Forward Pinellas, 2017)xIntelligent Transportation Systems Advanced Traffic Management Systems (ITS ATMS) Master Plan (Pinellas County, 2009) and ImprovementsThe following projects’ support the Guiding Principle of being “primarily pedestrian” and address many of the Plan’s accessibility objectives. Pedestrian & Bicycle SystemProviding a network of safe and comfortable bicycle facilities for people of all ages and abilities is the first step toward encouraging people to walk and bike in Downtown. The future bicycle and pedestrian plan for the Downtown area focuses on two major principles: utilizing the existing facilities and removing barriers in the existing bicycle network system. There are opportunities to improve the bicycle and pedestrian system through other design features and non-capital improvement projects in addition to more substantial projects.Waterfront & Beach ConnectionsAn additional extension of the Pinellas Trail would connect the Trail to the waterfront via Drew Street. This extension would also provide a direct connection to the Clearwater Beach Connector Trail on the Memorial Causeway Bridge by providing paths through the waterfront park. The Druid Trail is part of the Clearwater Beach Connector Trail and connects to the Memorial Causeway Bridge from Court Street and will connect to the Progress Energy Trail when completed. Bikeway ConnectionsA number of local on-street bike facilities that would significantly increase bike accessibility are in the planning stages. Bike lanes, sharrows, and buffered bikeways would function to complete the system and provide even more options for connectivity.Sidewalk Network ImprovementsWhile Downtown’s sidewalk network is thorough, a few areas still lack consistent sidewalks. The construction of sidewalks in these remaining areas would complete the City’s network and provide continuous pedestrian access.Streetscape ProjectsSeveral corridors through the Downtown area are identified for potential streetscape and landscape projects. While the primary benefit of streetscapes may be beyond the scope of conventional transportation projects, these projects do have an important role in public works improvements for maturing neighborhoods, especially neighborhood commercial areas with a need for revitalization, and provide opportunities to improve the environment for pedestrians and bicyclists. See Streetscapes in Chapter 3 for more detail. Bike ParkingThe provision of secure bicycle parking facilities is a needed amenity which will support bicycling to and among Downtown businesses, employment, destinations, entertainment, and recreational areas. Urban Design FeaturesBicycle lanes should have unique signage and uniform striping throughout the City to signalize the alternative use of these pathways and the presence of non-vehicular traffic. This will also help to create a safe system for people biking within the Downtown area. December, 2017 | 103 of 189Chapter 3. Land Use / Redevelopment PlanPhoto Source: (Bottom) Lucas Cruse, City of St. Petersburg, Green Painted Bicycle CrossingIntegration of Bicycling with Transit ServicesBicycles can increase the effective service area of transit; similarly, transit with bicycle access can increase bicycles activities. There are various interventions that could contribute to greater integration of walking and cycling with public transport, including:xImprove bicycle facilities at Park Street Terminal and bus stops xProvide bicycle parking facilities at bus stops xProvision for secure bicycle parking at public transit nodes (e.g., bike racks, covered bike parking, and bike lockers) xProvide bicycle rental systems at the vicinity of transit centers Bicycle Sharing ProgramBicycle sharing programs allow someone wanting to ride a bike to pick up a bicycle at one hub station or public bike rack and drop it off at another for a small fee. The objective of such programs is to provide an affordable and convenient alternative to the motor vehicle for short trips. The improvement of Downtown’s bike facilities especially the Memorial Causeway Trail connection would facilitate the implementation of a successful bike share program. Jurisdictional CoordinationBecause of the multijurisdictional nature of the Downtown area street network, expansion of the on-street bike facility network will require coordination with FDOT and Pinellas County. On-street bicycle facilities such as bicycle lanes, sharrows and buffered bike ways that originate on a road segment under one jurisdiction should connect and be continued on road segments under other jurisdictions. Pedestrian SafetyVisual features to signify drivers of pedestrian activity should be implemented within the City. Options include special crosswalk treatments (e.g., special markings, alternative paving, raised crosswalks/speed tables), subtle flashing lights at key intersections that lack other traffic calming devices, pedestrian refuge islands in the median of wide intersections, and curb bump-outs on local streets. Several areas in Downtown would require pedestrian safety improvements including the Drew Street section between Myrtle Avenue and the waterfront. In this section traffic calming measures are recommended as traffic speed changes just before the Pinellas Trail intersection. Green Colored PavementIn 2011 Federal Highway Administration (FHWA) approved the use of green-colored pavement in bike lanes and in extensions of bike lanes through intersections to make bike lanes or potential bicycle/motor vehicle crossing points more visible. The green-colored pavement could be applied to entire segments of bike lanes or only to potential conflict areas such as intersections or the beginning of right-turn lanes. The use of this technique within Downtown roadway segments with high bicycle conflict is recommended (i.e., Pinellas and Druid Trails intersections). Clearwater Downtown Redevelopment Plan104 of 189 | December, 2017Trolley Services Since 2010, PSTA has partnered with the Jolley Trolley Group and local jurisdictions to provide trolley services between Clearwater Beach, Downtown Clearwater, and north coastal communities including Dunedin, Palm Harbor, and Tarpon Springs. Imagine Clearwater recommended an extension of the existing Jolley Trolley service to connect the waterfront and downtown destinations along Cleveland Street and Pierce Street. The plan also recommended improving coordination between trolley, ferry, and PSTA operators to synchronize service (i.e., minimize transfer time and integrate fare payment) and enhance coordination with parking facilities during events. Special Events Park-and-Ride Program The City partnered with PSTA and other community partners to implement a temporary Park-and-Ride program for the 2017 Spring Break season. The program provided free rides to/from Clearwater Beach from three locations in Downtown Clearwater. Based upon the success of the 2017 Park-and-Ride program, the City will continue supporting the program in future years. Future Regional Transit System The Tampa Bay Regional Transit Feasibility Plan is an effort to evaluate opportunities for premium transit within the urbanized areas of Pinellas, Hillsborough, and Pasco Counties and will identify projects that have the greatest potential to be funded by federal grants. The study has identified the transit corridor as one of the major corridors in the regional network. The final plan will also identify the best premium transit system to efficiently serve this corridor.Parking & Traffic Management SystemParking Management Imagine Clearwater recommended a parking strategy that focuses on providing sufficient onsite parking distributed in several locations to meet the daily needs of waterfront users (i.e., Marina, ferry, playground, Library, etc.). Because there is plentiful and underutilized parking offsite, Imagine Clearwater supports the use of offsite parking in Downtown to accommodate increases in parking caused by the park’s expansion and programming. The strategy would encourage visitors of large events to park their cars away from the waterfront and walk to their destinations. Park-and-walk signage should be implemented to lead visitors to the most appropriate parking facilities depending on their entry routes. Single-use parking lots and reserved spaces should be discouraged in the core area. Public and shared parking should be encouraged. Downtown Special Events Management PlanA traffic plan for special events should be developed to manage the distribution of inbound and outbound events’ traffic based on the available Downtown roadway network, access points, and parking facilities. The plan would focus on minimizing travel delays and detrimental impacts of traffic flows on pedestrian movements by applying the following: xManaging pedestrian and bicycle movements in traffic control, when possible;xOptimizing parking garages and lots entry and exit time delays;xMinimizing impacts to businesses and residents;Public Transportation System PSTA has several capital and transit service projects that will significantly impact the accessibility and mobility in the Downtown area. Clearwater Intermodal CenterThe Clearwater Intermodal Center will replace the currently over capacity Park Street Terminal in Downtown to accommodate local and regional bus services, trolleys, premium transit, and complementary transportation modes. PSTA has identified a preferred site on the northwest corner of Court Street and Myrtle Avenue. PSTA developed a scope of work in partnership with City of Clearwater staff to complete preliminary engineering. The site selection process will be followed by environmental analysis and design. Clearwater Beach to Tampa International Airport Express The Clearwater Beach to Tampa International Airport (TIA) Express bus service would provide regional connectivity between Pinellas County beaches and TIA, with stops in Downtown Clearwater, the Clearwater Mall area, and Rocky Point (Tampa), supporting both tourism and regional economic development. This express bus service will complement local service provided by the existing and highly successful Route 60, the most productive local route in the PSTA system. The Clearwater Beach to TIA Express is expected to attract new ridership with expedited, limited stop service seven days a week. Currently, the TIA Express project is on the PSTA legislative priority list to secure an ongoing source of funds. December, 2017 | 105 of 189Chapter 3. Land Use / Redevelopment PlanxMaintaining a positive experience for event goers; and xUtilizing available technologies to enhance plan efficiency (e.g., signs, information regarding events parking and routing during roadways closure).Additionally, as part of the process, impacts to PSTA service should be considered and evaluated as well as opportunities to support economic activities around the major venues.Railways NetworkThe railway’s “Quiet Zone” policy is expected to be implemented once two crossings are closed (i.e., Hendricks Street/Grove Street) according to Supplementary Safety Measures (SSM) recommendations. A quiet zone is a Federal Railroad Administration exemption to the rule requiring trains to sound their horns when approaching public crossings. The closure of these two road segments at East Avenue will result in two dead-end streets; however it was determined to be the most efficient way to achieve the desired “Quiet Zone” through Downtown. Capital Needs A number of the recommendations outlined would require local capital project funding sources in order to be implemented, including the connection or expansion of bicycle and pedestrian networks, roadway improvements, and the Clearwater Intermodal Center. Some recommendations could be potentially funded with state or federal money, but others, specifically related to City-owned streets, would require City funding. The City should prioritize capital needs specified in this section and integrate them into the next Capital Improvement Plan. The City should also seek other funding resources to actively advance the City projects into MPO’s priority list for State and Federal funds. Clearwater Downtown Redevelopment Plan106 of 189 | December, 2017MASTER STREETSCAPE PLANStreets comprise a large portion of land dedicated for public use. Streetscapes constitute the public realm everyone sees, shares and uses daily. The best streetscapes put people first, because people are key to a vibrant economy. Through great design, streets can meet the needs of people while also considering landscaping, stormwater management, utilities, vehicular circulation and parking. Beautiful streetscapes create places where people want to be and attract private investment, and are an essential part of the City’s revitalization strategy.The Master Streetscape Plan provides guidance for improvements within rights-of-way and sets standards for the quality of the public realm which also establishes a standard for private development. Objectives & Street TypesThrough continued investment in streetscapes in the Downtown Plan Area, the City will: xStrengthen the identity of Downtown through a visually attractive environmentxMake Downtown streets comfortable public spaces for social interaction and community lifexCreate memorable places that also reflect local context and characterxSupport local businesses by providing outdoor seating and spaces for dining xImprove pedestrian connections and linkages throughout DowntownxCreate a street environment that supports a high level of pedestrian safety and securityxIntegrate human scale, pedestrian, bicycle, and transit-oriented features into the DowntownxPromote healthy lifestyles by encouraging walking and biking to destinationsxEnhance people’s connections to the natural environment through landscaping and street treesxDesign neighborhood streets to provide opportunities for interactions with neighborsxEnsure Downtown is accessible for all populationsThe City has classified certain Downtown streets according to the following street types to provide additional guidance regarding their general function and preferred character within the Downtown network as shown on Map 3.8. Downtown Corridor This street type is applied to Cleveland Street, Fort Harrison Avenue, and portions of Osceola Avenue. The Plan specifies a significantly high level of streetscape treatment for these streets because of their function as the major pedestrian streets within the Downtown Plan Area. Improvements include a variety of paving materials, medians, palm and oak trees, decorative lighting fixtures that can support banners and hanging plants, a fountain plaza and street furnishings. Beach Access CorridorThis street type addresses the Court and Chestnut Streets one-way pair between Martin Luther King, Jr. Avenue and the Memorial Causeway Bridge. These highly visible corridors are the major link between the mainland and the Beach. The streetscape treatment along these streets will consist of sidewalks, palm trees, decorative lighting, benches and painted intersections. Commercial A This street type includes the remainder of Court Street, and Drew Street, and Myrtle and Missouri Avenues. Although these streets carry significant thru traffic, they also serve as key connectors to Downtown from the rest of the County. They are also critical for pedestrian linkages and crossings as they bifurcate the Downtown Planning Area. The Streetscape Plan specifies that date palms will line the streets with oaks located in landscape islands in the center of the street where right-of-way widths permit. Street furnishings, decorative lights and pavers are also included in this design. Commercial BThis street type is comprised of the secondary streets within the plan area including Prospect Avenue, South Garden Avenue, Laura Street, Pierce Street, etc. Design elements for this street type include large canopy trees with palms located at intersections, decorative lighting, sidewalks and benches. The City has completed additional work identifying several streetscape improvements to be completed on certain street or trail segments within the Old Bay Character District: December, 2017 | 107 of 189Chapter 3. Land Use / Redevelopment PlanNorth Fort Harrison AvenueThe wider sidewalks of South Fort Harrison Avenue should be continued along North Fort Harrison Avenue to accommodate the various streetscape amenities and people walking. Both a “road diet” where lanes are narrowed and a five-foot easement from properties on the east side of North Fort Harrison Avenue are needed to implement this. Additionally on-street parking, street trees and “sharrow” markings are recommended. Pinellas Trail Conditions of the trail segment within the Old Bay Character District connecting south to the Downtown Core should be improved with curbs, landscaping, and other aesthetic improvements in lieu of the existing guardrails which are in place to prevent entry from side streets. A gateway at Nicholson Street will create a “place” and provide connection from the Trail to the waterfront. Nicholson Street This street is identified to be a connector from the Pinellas Trail to the waterfront. To accomplish this a reduction in travel lane width and reconstruction of the curb is envisioned to provide for a multiuse path on the north side of the street and additional street trees and lighting added on thesouth side. North Osceola Avenue To better facilitate pedestrians and bicyclists, reduced travel lanes and constructed curbs for a multi-use path on the west side of the street is recommended. Additionally, on street parking south of the multi-use path is also encouraged.Gateways into Downtown will have a specialized treatment that includes a historic pillar that is rooted in similar pillars once located on Cleveland Street just west of Osceola Avenue. Additionally, gateways will include enhanced levels of landscaping and identification signage.Streetscape treatments are illustrated at the end of this section.Photo Source: (Center) Indianapolis Star, Indy Culture Trail, 2015 Clearwater Downtown Redevelopment Plan108 of 189 | December, 2017Evolution of Street TypesHistorically, the City’s Downtown Redevelopment Plan has established street typologies and included conceptual streetscape plans (e.g., cross sections, site furnishing details) for prototypical Downtown streets. Prior to 2004, the Downtown Redevelopment Plan included a street regulating plan with seven defined street typologies, from regional serving to alleyways. The 2004 Downtown Redevelopment Plan incorporated an updated Master Streetscape Plan, prepared by Bellomo-Herbert and Shaughnessy Hart, which reduced the hierarchy of streets to four types within Downtown.. The City has completed additional plans for areas outside of the CRA which also include cross sections for certain streetscape improvements (i.e., North Marina Area Master Plan), which have not been otherwise integrated into the Master Streetscape Plan. Future RefinementSince 2004, several streetscape projects have been constructed - most notably Phases I and II of the Cleveland Streetscape. Changes in community preferences and a desire to achieve more within the City’s limited rights-of-way, including supporting multimodal travel, providing shade for people through additional street trees, and capturing and treating stormwater using green streets techniques, have already resulted in streets being designed and constructed which differ from the original concepts in the 2004 Master Streetscape Plan (e.g., Cleveland Street Phase III, Gulf to Bay Boulevard to the Court Street/Highland Avenue intersection and the Five Points Gateway). Additionally, this update to the Plan sets forth the transition from design guidelines incorporated in the Plan to a form-based zoning code. As part of that process there is a need to consider rights-of-way typologies and future improvements throughout all of Downtown. For example, currently there is no street type established for streets within the Downtown’s residential neighborhoods, nor are street types assigned for more significant roads within the Old Bay and South Gateway Districts. To update and consolidate the various completed streetscapes and identify prototypical street types for the remaining streets throughout the Downtown Plan Area will be a significant project. Revised designs and drawings will be needed for any substantial update of this section. Column intentionally left blank Cleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Bay BlvdHighland AveMartin Luther King, Jr AveTurner StMap 3.8Street ClassificationsClearwater DowntownRedevelopment PlanSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 20171 inch = 1,000 feet®Street ClassificationsDowntown CorridorCommercial ACommercial BBeach Access CorrridorPinellas TrailDowntown CoreDowntown GatewayOld BayProspect ParkSouth GatewayProposed Old Bay Expansion Clearwater Downtown Redevelopment Plan110 of 189 | December, 2017Downtown Corridor (Implemented) December, 2017 | 111 of 189Chapter 3. Land Use / Redevelopment PlanDowntown Corridor (Implemented) Clearwater Downtown Redevelopment Plan112 of 189 | December, 2017Downtown Corridor (Implemented) December, 2017 | 113 of 189Chapter 3. Land Use / Redevelopment PlanDowntown Corridor Clearwater Downtown Redevelopment Plan114 of 189 | December, 2017Downtown Corridor December, 2017 | 115 of 189Chapter 3. Land Use / Redevelopment PlanBeach Access Corridor Clearwater Downtown Redevelopment Plan116 of 189 | December, 2017Beach Access Corridor December, 2017 | 117 of 189Chapter 3. Land Use / Redevelopment PlanCommercial A Clearwater Downtown Redevelopment Plan118 of 189 | December, 2017Commercial B December, 2017 | 119 of 189Chapter 3. Land Use / Redevelopment PlanCommercial B Clearwater Downtown Redevelopment Plan120 of 189 | December, 2017Standard Details December, 2017 | 121 of 189Chapter 3. Land Use / Redevelopment PlanStandard Details Clearwater Downtown Redevelopment Plan122 of 189 | December, 2017Restaurant/CaféBicycle Rental and Repair ShopMulti-Use Path to Waterfront and Trail Gateway FeatureTrail ImprovementsResidents’ Eyes on the Trailnt/MtoaGLID Stormwater TreatmentPINELLAS TRAILNICHOLSON STREETSEMINOLE STREETCross-SectionPlan ViewPinellas TrailNorth Marina Area Master Plan December, 2017 | 123 of 189Chapter 3. Land Use / Redevelopment Plan5’Sidewalk(Existing)2’10’ Automobile Lane40’ R.O.W.10’ Automobile Lane3’NICHOLSON STREET10’Multi-use PathBollardFenceFence40’R.O.W.5’Sidewalk5’Sidewalk10’Multi-use Path2’ 12’ Automobile Lane3’ 3’OSCEOLA AVENUE BETWEEN NICHOLSON STREET AND SEMINOLE STREETBollardNorth Marina Area Master PlanCross-SectionPlan ViewCross-SectionPlan View Clearwater Downtown Redevelopment Plan124 of 189 | December, 2017MASTER WAYFINDING PLAN Wayfinding is a wholistic system that helps people navigate the built environment. While most people associate wayfinding with signs, it also employs a variety of elements such as gateway features, banners, and public art, and technology such an interactive maps, website, mobile apps and visitor guides. A wayfinding system promotes an area’s identity and is also an invaluable tool for marketing, tourism and economic development efforts. The City adopted a new brand in 2015. In order to present an image more consistent with that brand, a new logo was developed for Downtown in 2016 that incorporates colors and the shape used in the new brand. During this same time a citywide wayfinding system was being developed to create a seamless system that would communicate a consistent identity throughout the city, while allowing for unique elements for the various identified districts in the City. Wayfinding for Downtown will reflect the design of the broader citywide system and incorporate the new Downtown logo.The following signs and streetscape features comprise the Downtown wayfinding system. xCity Gateways (Secondary Entry Points)(existing obelisks will remain)xVehicular Directional SignsxDistrict Identification / Landmark PylonsxDistrict Identification / BannersxPedestrian DirectionalxKiosksxOrientation Maps (for use on kiosk) December, 2017 | 125 of 189Chapter 3. Land Use / Redevelopment PlanMerje Design; Wayfinding and Signage; 2017 Plan ImplementationPublic Amenities Incentive Pool | Capital Improvement Plan | Incentives | TIF Projections Clearwater Downtown Redevelopment Plan128 of 189 | December, 2017Chapter 4: Plan ImplementationINTRODUCTIONThis Plan will be implemented in four major ways: through the application of Plan objectives, policies and design guidelines to specific redevelopment projects during the site plan review process, the use of the Public Amenities Incentive Pool, public strategies and capital improvements to the Downtown. Compliance with Plan objectives, policies and design guidelines will ensure that private development results in a development pattern consistent with the vision for Downtown. The Public Amenities Incentive Pool provides a powerful tool to assist the private sector and the public attain the Plan vision. The public strategies are actions to be taken to implement the goals, objectives and policies of the Downtown Plan. In some cases, the action is very specific, i.e., to amend the Community Development Code on a specific topic that implements a Downtown goal. In other cases, implementation of the Downtown Plan requires that the City study effective ways to address the issue. Through a study and/or comparison of innovative techniques used by other cities, Clearwater can learn from other examples and glean the most relevant actions for Clearwater. The majority of the strategies are applicable to the entire Downtown; there are a few strategies specific to character districts. In addition to the description of each strategy, the strategies are summarized in a table including the lead department and timing for the strategy. The Capital Improvement Plan (CIP) establishes the major improvements that are needed Downtown and is the most visible way that the Downtown Plan will be implemented. The Capital Improvement Plan includes five general types of improvements: xStreet Repaving/ResurfacingxUtilities and InfrastructurexStreetscape Improvements/LandscapingxParks and Recreation FacilitiesxPublic UsesThe CIP includes the project name, fiscal year of planned construction, the location, existing and potential funding sources, and estimated cost. It should be noted that the existing and potential funding sources identify that a project is eligible for funding through that source, not that funding is guaranteed or already obtained for the project. The CIP lists the project by funding priority in fiscal year order and, in a second table, organized by the five general types of construction. A description of each project is also included. The fifth section of the Implementation Chapter lists the existing Redevelopment Incentives currently available to development. Detailed information on each incentive is listed, including the program goal, eligibility of projects, funding source, award ranges, sample projects and a contact for more information. It is hoped that this section will be a resource for the private sector during the development of a project. The final section of the Implementation Chapter is the Tax Increment Revenue Projections. The City has estimated the revenues to be available through the tax increment in the Community Redevelopment Area. This estimate will assist the City in planning and budgeting for capital improvements and other expenditures of the Community Redevelopment Agency. RELATIONSHIP OF DOWNTOWN PLAN TO COMMUNITY DEVELOPMENT CODEIn addition to the Clearwater Comprehensive Plan, the Downtown Plan is the official statement of policy regarding the Downtown and in particular with regard to the use of land and public policies. All development of land, both public and private, undertaken within the Downtown shall be consistent with and further the goals of the Plan. All new or amended development regulations for Downtown shall be consistent with and further the goals of this Plan. The Plan establishes categories of permitted uses and prohibited uses; based on this Plan, the Community Development Code will enumerate the specific types of permitted and prohibited uses and their related development standards consistent with this Plan. The Plan establishes development potential and height for each character district that will govern all redevelopment activity. The tools identified in this Plan to consider additional development potential (Transfer of Development Rights and the Public Amenities Incentive Pool) may be used to increase the development potential in excess of that specified in the Character District upon a determination that the increase is consistent with and furthers the goals of this Plan. The Public Amenities Incentive Pool is the only tool identified to consider building height in excess of that set by the character districts. Other than those two tools specified above, the Plan’s statements regarding development potential, allowable and prohibited uses and, maximum height shall not be varied except through an amendment to this Plan. Although the maximum height established by the Plan cannot be varied, except as described above, December, 2017 | 129 of 189Chapter 4. Plan ImplementationColumn intentionally left blankthe process to reach maximum permitted heights within the allowable range is governed by the Community Development Code.Any development regulation not specifically addressed in the Plan objectives, policies, character districts and design guidelines shall be governed by the Community Development Code. However, should there be any discrepancy between this Plan and the Community Development Code, the goals and policies of this Plan shall govern. PUBLIC AMENITIES INCENTIVE POOLPurposeTo overcome the numerous constraints affecting redevelopment, the Downtown Plan establishes the Public Amenities Incentive Pool to provide an opportunity for the private sector to gain additional development potential while assisting the public to achieve its redevelopment goals for Downtown Clearwater. Eligible Amenities All property within the Downtown Plan boundaries will be eligible to use the Public Amenities Incentive Pool. Allocations from the Pool will be available to projects that provide one or more improvements and/or fees in-lieu of certain improvements that provide a direct benefit to Downtown revitalization. There shall be a correlation between the amount of the bonus and the incentive provided and the actual bonus amounts shall be set forth in the Community Development Code. The allocation of increased density or intensity through the Pool shall be at the discretion of the City as determined through the Community Development Code site plan review process. The types of amenities eligible for density/intensity bonuses may include, but are not limited to: xResidential uses in the Downtown Plan area;xGround floor retail in the Downtown Core Character District;xUses in particular locations and/or mixed use projects that further the Plan’s major redevelopment goals and character district vision; xDay care facility;xPortion of project reserved for Affordable Housing; xSignificant Public Space on site; xPublic Art on site;xPreservation of a historic building to the Secretary of Interior’s Standards;xConstruction of public parking on site;xCultural or Performing Arts Facility on site;xContributions to Master Streetscape and Wayfinding Plan;xContributions to Coachman Park or Station Square Master Plan;xContributions to Pinellas Trail or connector trails; xContributions to public parking facility; orxAs determined by the City Commission. Clearwater Downtown Redevelopment Plan130 of 189 | December, 2017reduction in all or parts of this Downtown Plan area to create development potential or an evaluation of available facility capacity which would facilitate increased development potential in all or parts of the Downtown Plan area. It is recognized that replenishing the Incentives Pool may require the review of the Pinellas Planning Council and the Board of County Commissioners in their capacity as the Countywide Planning Authority. Pool Allocation ProcessThe allocation of additional density/intensity shall be made in conjunction with a site plan application reviewed by the Community Development Board (CDB) through a process defined in the Community Development Code. The CDB will be responsible for ensuring that all projects utilizing the Pool meet the goals, objectives and policies of the Plan and is in keeping with the vision established for the character district in which the project is located. The CDB may consider granting an increase in the maximum building height specified in a character district if the developer of a site plan application provides a major public amenity as defined in the Community Development Code, and the increase in height does not exceed 20% of the maximum permitted height or a minimum of ten feet. Development potential obtained through the Pool shall not be transferred to any other site under any circumstance. DOWNTOWN STRATEGIES Strategy 1:Prepare a study evaluating effective incentives to encourage residential and commercial uses Downtown. Strategy 2:Prepare a zoning study to evaluate the appropriate zoning district boundaries for the following areas: xAreas with inconsistent zoning and land use plan designation. xEast Gateway District-evaluate expansion of the Commercial district in certain locations along Gulf to Bay Boulevard to facilitate consolidated redevelopment sites. xEvaluate Downtown (zoning) and Central Business District (land use) (D/CDB) area along both sides of Cleveland Street from Missouri Avenue to the existing eastern border at (approximately) Fredrica Avenue. The purpose of the evaluation is to determine whether D/CBD is appropriate at that location or if the more appropriate zoning is Commercial District and varied residential districts. Strategy 3:Amend the Community Development Code, Downtown District, to allow certain uses to be minimum standard development to streamline the development review process; amend the Downtown District to be consistent with this Plan. Strategy 4:Amend the Community Development Code to establish the Public Amenities Incentives Pool. Strategy 5:Amend the Community Development Code regarding Transfer of Development Rights to be consistent with this Plan, including removal of the 20 percent limit transferred to a receiving site for property located within the Central Business District Future Land Use category. Amount of Development Potential in PoolThe amount of floor area and dwelling units available in the Pool is created by the difference between the development potential allowed by the sum total of the potential prescribed by the 1995 Clearwater Downtown Redevelopment Plan, Downtown Clearwater Periphery Plan Update, and the underlying land use categories of areas not governed by one of these Plans as compared to the development potential permitted in this Plan. The methodology used to determine the amount of the Pool is contained in the Appendix 7. The amount of density/intensity available in the Pool is as follows:x2,326 dwelling units and x2,119,667 square feet of floor area for non-residential uses. In the event that either the total number of dwelling units or non-residential square feet available in the Pool is substantially or completely allocated, the City shall determine whether or not to allow a conversion of all or part of the remaining potential between dwelling units and non-residential floor area. In its sole discretion, the City shall establish the conversion methodology. When all of the development potential in the Pool has been allocated, the Pool will cease to exist. Upon the Pool’s termination, the only tool to increase density and intensity that will remain available is the use of Transfer of Development Rights. If the Pool is completely allocated during the valid term of this Plan, the City may elect to study alternatives to replenish the Pool. The alternatives studied may include, but are not limited to, a December, 2017 | 131 of 189Chapter 4. Plan ImplementationColumn intentionally left blankStrategy 6:Evaluate the potential and owner interest for a National Register or local historic district in these areas: Cleveland Street from Myrtle to Osceola Avenues; Old Bay character district; and Grove Street in the Town Lake Residential Character District. The study shall be based on the National Register of Historic Places standards and shall be conducted by a firm or individuals qualified in historic preservation, architectural history, architecture, or other qualified field. Strategy 7:Evaluate the implementation of incentives for preservation of historic resources, i.e., local ad valorem tax abatement pursuant to Florida Statutes, historic Building Code, etc. Strategy 8:Enhance existing or develop new programs to educate residents and business owners on the importance of building and property maintenance. Strategy 9:Increase the funds available for the façade grant program. Develop funding priorities for Cleveland Street in the Downtown Core, Cleveland Street Northeast in Town Lake Residential and Gulf-to-Bay Boulevard in the East Gateway. Within each target area, funding priorities may emphasize the local critical issues. Strategy 10:Review the existing transportation impact fee ordinance, open space and recreation impact fee ordinance, and payment in-lieu of providing parking ordinance to determine applicability in the expanded Downtown Plan area.Strategy 11:Amend the Clearwater Comprehensive Plan to designate Downtown as an urban redevelopment area, as described in Florida Statutes. Once approved by the Department of Community Affairs (DCA), work through the Metropolitan Planning Organization (MPO) to designate all or portions of Downtown as a Transportation Concurrency Exception Area (TCEA). Strategy 12:Prepare a traffic analysis to evaluate traffic operations and make intersection improvements subject to that evaluation, after the new bridge opens. Strategy 13:Prepare a traffic analysis to evaluate the ability to designate all or parts of Downtown as a No-Fee Transportation Zone after the new bridge opens. Strategy 14:Evaluate whether or not there are any active septic tanks within the Downtown. If active septic tanks exist, develop program to eliminate the tank and connect the property to City sewer system. The City shall prioritize the use of CDBG and any other available funds to accomplish eliminating the septic tanks. Strategy 15:Identify needed improvements to the sidewalk system within Downtown and incorporate those improvements into the Capital Improvement Budget beginning in Fiscal Year 2004/2005. Clearwater Downtown Redevelopment Plan132 of 189 | December, 2017East Gateway Character District StrategiesStrategy 26:Evaluate the ability to amortize problematic uses, develop and implement an amortization schedule within the legal framework. Strategy 27:Evaluate the potential public/open space use of the triangular property bounded by Gulf to Bay Boulevard, Cleveland Street and Hillcrest Avenue. The site’s prime location could serve as both a gateway for the East Gateway District and as a significant component of the Cleveland Street Streetscape Improvements. The City may consider vacation of Hillcrest Avenue to consolidate the site. Strategy 28:Explore creative solutions to provide a playground to serve the area generally located south of Cleveland Street and southwest of Gulf to Bay Boulevard. Strategy 29:Continue to assist the Clearwater Homeless Intervention Project (CHIP) in its mission to serve the homeless population in Downtown. Strategy 30:Assist the business owners in creating a Merchants Association to work with the City on marketing and neighborhood employment issues which would improve communications between the City and business owners. Strategy 22:Continue to implement the agreement with the Florida Department of Transportation (FDOT) to redesignate Alternate U.S. Highway 19 from Fort Harrison Avenue to Myrtle Avenue. The City shall also continue to implement the agreement with the FDOT to redesignate State Road 60 from the existing Cleveland Street to the Court/Chestnut Streets pair. Strategy 23:Amend the Community Development Code to revise the payment in-lieu of parking provision. The amendment shall define the applicable geographic area, establish the fee amount by type of use, establish uses that shall not be eligible for the payment in-lieu of fee and establish the allowable uses of the collected fees. Old Bay Character District Strategies Strategy 24:Coordinate with the Salvation Army to ensure that the future redevelopment of the site is compatible with the surrounding areas and at an appropriate scale. Town Lake Residential Character District Strategies Strategy 25:Evaluate engineering alternatives to the stormwater system to effect the elimination of the existing stormwater pond located on the south side of Gould Street midway between Missouri and Madison Avenues. Strategy 16:Continue to market redevelopment sites and develop targeted markets or sites within each character district to encourage their redevelopment. Strategy 17:Evaluate and develop a flexible Building Code that addresses the special challenges of redeveloping/retrofitting old structures while maintaining the goals of health, safety and welfare. Strategy 18:Evaluate implementation of the State legislation establishing a Nuisance Abatement Board to address serious and recurring Code violations and criminal activity.Strategy 19:Continue to implement the Downtown-Gateway Strategic Action program and update on a yearly basis. Strategy 20:Support the location of a movie theater and/or performing arts theater in Downtown and provide assistance, as needed, with land acquisition, land assembly, building rehabilitation and parking facilities development to support the use. Downtown Core Character District StrategiesStrategy 21:Continue to support community policing innovations in the CRA. December, 2017 | 133 of 189Chapter 4. Plan ImplementationColumn intentionally left blankStrategy 31:Assist the residents of the East Gateway in creating a Neighborhood Association to serve as the neighborhood’s voice, improve communications between the neighborhood and the City and help foster neighborhood-based solutions to local problems. Strategy 32: Assist the residents of the East Gateway residential areas in the formation of one or more neighborhood crime watch associations. Strategy 33: Provide a more visible community policing presence within the East Gateway neighborhood. Strategy 34:Continue to support the Police Department’s Hispanic Outreach Program and Apoyo Center. The Apoyo Center addresses many of the service needs of the neighborhood through partnering with other organizations and businesses. Programs of the Apoyo Center include interpretation services, recruitment of bilingual officers, a victim advocacy outreach program, a domestic violence program, crime prevention and drug and alcohol education. Strategy 35:Continue to support the YWCA/City of Clearwater Hispanic Outreach Center and emphasize continuing and enhanced partnerships with social service agencies to assist East Gateway residents. Programs include childcare, diplomatic intervention, adult education, English classes, GED instruction, computer and job training and other related services as the need arises. Strategy 36: Research implementing a low-interest loan program to assist businesses with a variety of activities including the acquisition of buildings and/or properties and the rehabilitation or new construction of new office or commercial space.Strategy 37:Work with the Clearwater Regional Chamber of Commerce to target small business needs.Strategy 38:Establish partnerships with local banks to facilitate conventional loans to businesses in the area. Clearwater Downtown Redevelopment Plan134 of 189 | December, 2017# Strategy Lead Department Timing1a1bResidential Incentives StudyCommercial Incentives StudyPlanning/Economic DevelopmentEconomic DevelopmentWithin one year of Plan adoptionWithin one year of Plan adoption2 Zoning Study Planning/Economic Development FY 04/053 Code Amendment on Minimum Standard Uses and Plan ConsistencyPlanning Within one year of Plan adoption4 Code Amendment on Public Amenities Incentives PoolPlanning Within one year of Plan Adoption5 Code Amendment on TDRs Planning Within one year of Plan Adoption6 Evaluation of Historic District Potential Planning FY 03/047 Historic Preservation Incentives Study Planning FY 03/048 Educational Program for Owners Neighborhood Services Division Within one year of Plan Adoption9 Facade Grant Program Expansion Economic Development FY 03/0410 Impact Fee Ordinances & Payment In-Lieu of Providing Parking ReviewPlanning FY 03/0411 Designate Downtown as Urban Redevelopment AreaPlanning FY 03/0412 Traffic Analysis on Intersection Improvements Public Works/Engineering FY 03/0413 Traffic Analysis on Concurrency Management AreaPublic Works/Engineering FY 03/0414 Septic Tank Study Public Works/Utilities FY 03/0415 Sidewalk Improvements Study Public Works/Engineering FY 03/04 StudyFY 04/05 Begin Incorporation into Capital Improvement Budget16 Market Redevelopment Sites Economic Development FY 03/0417 Evaluate Flexible Building Code for Old Buildings Development Services/Planning/Economic DevelopmentFY 03/0418 Evaluate Established of Nuisance Abatement BoardDevelopment Services/Police/LegalFY 03/0419 Downtown-Gateway Strategic Action Program Economic Development Ongoing Strategy20 Movie Theater/Performing Arta Theater Support Economic Development Ongoing Strategy21 Community Policing Innovations Police Department Ongoing Strategy22 Redesignations of Alternate U.S. Highway 19 (Downtown Core)Public Works/Engineering By Mid-2004Table 7. Summary of Public StrategiesColumn intentionally left blank December, 2017 | 135 of 189Chapter 4. Plan Implementation# Strategy Lead Department Timing23 Code Amendment on Payment in lieu of Parking (Downtown Core)Planning Within one year of Plan adoption24 Coordinate with Salvation Army (Old Bay)Planning/Economic Development Ongoing25 Stormwater Pond Evaluation (Town Lake Residential)Public Works/Engineering FY 03/0426 Amortization of Problematic Uses Study (East Gateway)Economic Development/Legal FY 03/0427 Gateway/Public Use Site Study (East Gateway)Economic Development/Planning FY 04/0528 Playground Evaluation (East Gateway)Parks FY 03/0429 Assist CHIP (East Gateway)Economic Development Ongoing Strategy30 Merchants Association Creation (East Gateway)Neighborhood Services/Economic DevelopmentMonitor and assist upon critical mass of business activity31 Neighborhood Association Creation (East Gateway)Neighborhood Services/Economic DevelopmentWithin one year of Plan adoption32 Neighborhood Crime Watch Association Creation (East Gateway)Neighborhood Services/Police Within one year of Plan adoption33 Continue Community Policing (East Gateway)Police Begin within six month of Plan adoption; Ongoing Strategy34 Hispanic Outreach Program and Apoyo Center (East Gateway)Police Ongoing Strategy35 YWCA/City of Clearwater Hispanic Outreach Center (East Gateway)YWCA, Social Service Agencies Ongoing Strategy36 Loan Interest Loan Study (East Gateway)Economic Development and HousingFY 04/0537 Small Business Parnership (East Gateway)Economic Development and HousingOngoing Strategy38 Local Bank Partnerships (East Gateway)Economic Development and HousingOngoing StrategyTable 7. Summary of Public Strategies, cont’dColumn intentionally left blank Clearwater Downtown Redevelopment Plan136 of 189 | December, 2017Project Name FY Location Existing/Potential Funding SourceCostWayfinding Sign Package 2003/2004 S.R. 60 & Highland Avenue intersection directing traffic to Downtown; Court & Chestnut Streets at their intersections with Missouri, Myrtle, Osceola & Fort Harrison Avenues; Drew Street at its intersection with Missouri, Fort Harrison, Osceola & Myrtle AvenuesCDBG*, TIF**, General Fund$750,000Fort Harrison Avenue/Alternative U.S. Highway 19 Resurfacing2003/2004 The entire length of Fort Harrison Avenue within ClearwaterFDOT*** $8.6MPump Station #16 2003/2004 Southside of the west end of Pierce Street Water and Sewer Bond$698,500Pump station #12 2003/2004 900 North Osceola Avenue (in front of Clearwater Bay Marina)Water and Sewer Bond$186,000Cleveland Street Streetscape2004-2006 Between Osceola and Myrtle Avenues Penny for Pinellas, TIF and Private$3.7MMyrtle Avenue Reconstruction and Streetscape2004/2005 Myrtle Avenue between North Fort Harrison & Lakeview Road (including all stormwater outfall from Prospect Lake Park to Clearwater Harbor)Stormwater UtilityTIF$12M$1MStation Square Park Redevelopment2005/2006 The north side of Cleveland Street between East & Garden AvenuesPrivate and TIF$1MClearwater Beach Connector Spur (Pinellas Trail)2004/2005 Turner Street to Oak Avenue to beach (2,000 feet within Downtown)Pinellas County, Penny for Pinellas, CMAQ****$1.2M (includes entire project)Gulf to Bay Boulevard and Highland Avenue Gateway Intersection Improvement2004-2006 Gulf to Bay Boulveard & Highland Avenue IntersectionFDOT (for paving only), TIF and CDBG, Penny for Pinellas$1.5MFort Harrison Avenue Streetscape2004-2006 Nicholson Street to Court/Chestnut Streets Private, Pinellas County, Grants and TIF$4.7MGlen Oaks Park Stormwater Retention Facility2004/2005 Immediately south of the Downtown area at the intersection of Court Street & Betty LaneStormwater Utility, SWFWMD$4.3MTable 8. Redevelopment Projects/CIPCAPITAL IMPROVEMENT PLAN (CIP)To implement the Downtown Plan, the City is committed to investing in the Downtown. Below are a variety of significant Capital Improvement Projects, short- to long-term in nature, addressing streetscape, road improvements, public uses, utilities and parks (Map 12, page 157). The costs of projects identified range between $158 million to $162 million. This Capital Improvement Plan was based on several assumptions: the cost for each capital project is based on the best estimate available during development of this plan; all costs are shown in 2003 dollars; project scope and funding sources may vary as determined during specific project budget and planning phase; Penny for Pinellas funding is assumed to be extended and will be based on the City’s priorities as determined at time of extension. Revisions to the Downtown Capital Improvement Plan may be made by the City Commission during their annual budget process and all changes shall be reflected in the City’s adopted Annual Operating and Capital Improvement Budget. All changes shall be consistent with the goals, objectives and policies of this Plan. December, 2017 | 137 of 189Chapter 4. Plan ImplementationProject Name FY Location Existing/Potential Funding SourceCostMemorial Causeway Bridge Landscaping2004-2006 Chestnut Street to the east end of the Memorial Causeway BridgeFDOT, Grant and Special Development Fund$500,000Cleveland Street and Gulf to Bay Boulevard Repaving2005 Between Fredrica & Highland Avenues FDOT $870,000Cleveland Street & Memorial Causeway Repaving2005 Between Island Way & Fort Harrison Avenue FDOT $960,000Main Fire Station 2005/2006 Originally planned to rebuild on existing site. Currently reviewing available property on the S. Fort Harrison Avenue corridor between Court Street & Lakeview RoadPenny for Pinellas$4.6MOsceola Avenue Parking Garage (app. 375-500 spaces)*****2005-2007 East side of North Osceola Avenue between Drew & Cleveland StreetsParking fund, Private, TIF and Bonds$5.5-7.5MRedevelopment Garage (app. 375-500 spaces)*****2005-2010 To be determined based on location of major entertainment and/or restaurant/retail usesParking fund, Private, TIF and Bonds$5.5-7.5MReuse of Existing Main Fire Station2006/2007 Current site of Downtown Main Fire Station Penny for Pinellas, TIF and GrantTBDCoachman Park Redevelopment ($7.5M) and 450 space Garage ($7)2005-2008 Coachman Park - expanded to include the existing park site and the area on the south side of Cleveland StreetPark portion: General Fund, Private, Penny for Pinellas and TIFGarage Portion: Private, Parking System and TIF$14.5MDowntown Marina 2006/2007 Coachman Park on the north and south sides of the bridgeRevenue Bond, Private and TIF$5MTable 8. Redevelopment Projects/CIP, cont’dColumn intentionally left blank Clearwater Downtown Redevelopment Plan138 of 189 | December, 2017Project Name FY Location Existing/Potential Funding SourceCostPinellas Trail and East Avenue widening2006/2007 East Avenue between Drew Street & Druid Road Grants and Penny for Pinellas$3MNew City Hall and associated parking2006/2007 Vacant site to the south of the MSB along Pierces Street between South Myrtle & East AvenuesSale revenue from existing site and Bonds$13.5MOsceola Avenue Streetscape 2005-2010 Osceola between Drew & Court Private, Pinellas County and TIF$3MCleveland Street and Gulf to Bay Boulevard Streetscape2007-2015 Between Highland & Myrtle Avenues TIF, Private and CDBG$8.6MCommercial Streets “A” and “B”2010+ Per Master Streetscape Plan TIF, Bond, Private and Penny for Pinellas$5MCourt/Chestnut Beach Corridors Streetscape2010+ Per Master Streetscape Plan (from bridge to SR 60 & Highland Avenue intersectionTIF, Private Bond and Penny for Pinellas$5MBeach to Bluff Guideway 2010+ Along the Memorial Bridge between the Downtown and the Marina area of the BeachFederal Grant, Private, FDOT, Federal Transit Authority$40MNew PSTA Multi-modal transportation center2010+ Existing PSTA Site at the SW corner of Pierce Street and Garden AvenuePSTA, Penny for Pinellas, Pinellas County, Parking Fund, TIF$3M, City Share* Community Development Block Grant;** Tax Increment Financing;*** Florida Department of Transportation;**** Congestion Mitigation and Air Quality Improvement.***** The specific size of the two garages will be determined at the time of project planning based on redevelopment activity and intensities; the sizes of the two garages may vary from sizes stated to accommodate the parking demand up to a maximum of $15 million combined cost for the two garages.Table 8. Redevelopment Projects/CIP, cont’dColumn intentionally left blank December, 2017 | 139 of 189Chapter 4. Plan ImplementationProject NameFY CostStreet Repaving/Resurfacing (total $24.43 M)Fort Harrison Avenue/Alt. U.S. Highway 19 Resurfacing (FDOT) * 2003/2004 $8.6MMyrtle Avenue Reconstruction * and Streetscape 2005 $13MCleveland Street and Gulf to Bay Boulevard Repaving (FDOT) * 2005 $870,000Cleveland Street & Memorial Causeway Repaving (FDOT) * 2005 $960,000Intersection Improvements* 2004/2005 $1MUtilities and Infrastructure (total $16.184M - $20.184 M)Osceola Avenue Parking Garage (375 - 500 spaces) 2005-2007 $5.5 - $7.5MRedevelopment Garages (375 - 500 spaces) 2005-2010 $5.5 - $7.5MPump Station #16* 2003/2004 $698,500Pump Station #12* 2003/2004 $186,000Glen Oaks Park Stormwater Retention Facility* 2004/2005 $4.3MStreetscape Improvements/Landscaping (total $32.75 M **)Wayfinding Sign Package 2003/2004 $750,000Gulf to Bay Boulevard and Highland Avenue Gateway Intersection Improvement 2004-2006 $1.5MFort Harrison Avenue Streetscape 2004-2006 $3.7MMemorial Causeway Bridge Landscaping 2004-2006 $500,000Cleveland Street Streetscape Funding available upon approval of revised Penny for Pinellas list during FY 03/04 Budget approval process2004-2006 $3.7MOsceola Avenue Streetscape 2005-2010 $3MCleveland Street and Gulf to Bay Boulevard Streetscape 2007-2015 $8.6MCommercial Streets “A” and “B”* 2010+ $5**Court/Chestnut Streets Beach Corridors Streetscape* 2010+ $5**Parks and Recreation Facilities (total $24.7 M)Clearwater Beach Connector Spur (Pinellas Trail)* 2004/2005 $1.2M (includes entire project)Coachman Park Redevelopment ($7.5M) and 450 space Garage ($7M) 2005-2008 $14.5MDowntown Marina 2006/2007 $5MStation Square Park Redevelopment 2005/2006 $1MPinellas Trail and East Avenue widening 2006/2007 $3MPublic Uses (total $61.1 M**)New City Hall and Associated Parking 2006/2007 $13.5MTable 9. Redevelopment Projects/CIP Arranged by Type of ProjectColumn intentionally left blank Clearwater Downtown Redevelopment Plan140 of 189 | December, 2017Project NameFY CostMain Fire Station* 2005/2006 $4.6MReuse of Existing Main Fire Station 2006/2007 TBD**Beach to Bluff Guideway 2010+ $40MNew PSTA Multi-modal transportation center 2010+ $3M* Funding approved in adopted CIP or awarded grant** Total does not include those projects the costs of which are to be determined at a future dateTable 9. Redevelopment Projects/CIP Arranged by Type of Project, cont’dCapital Project DescriptionsWayfinding Sign Package:In anticipation of the 2004 opening of the Memorial Causeway Bridge, the City is pursuing the preparation of construction drawings and specifications for the Wayfinding Signage component of the overall Downtown streetscape package. It is anticipated that these new directional and informational signs would be in place by February 2004.Fort Harrison Avenue/Alt. U.S. Highway 19 Resurfacing:A FDOT resurfacing project is currently underway on Fort Harrison Avenue from Drew Street south to the City of Largo and will be completed by late 2003. This will be followed by a FDOT Fort Harrison Avenue resurfacing project from Drew Street north to the City of Dunedin to be completed by mid-2004. At that time, the northern phase of the Fort Harrison Avenue resurfacing project and the Myrtle Avenue project will have been completed and the State Road 595 (Alternate U.S. Highway 19) designation will be reassigned from Fort Harrison Avenue to Missouri Avenue, Court Street and Myrtle Avenue. Concurrently, the western terminus of the S.R. 590 designation on Drew Street will move from Fort Harrison Avenue east to Myrtle Avenue. Intersection Improvements:Various improvements to Downtown intersections, primarily signal timing modifications and/or turn lanes are proposed. The location of the actual intersections will be determined following a traffic analyses to be conducted subsequent to the opening of the new Memorial Causeway Bridge and transference of the State Road 595 (Alternate U.S. Highway 19) designation from Fort Harrison Avenue to Missouri Avenue, Court Street and Myrtle Avenue.Pump Station #16:The City will replace and relocate the sanitary pump station currently located on the Bluff behind City Hall. The City is currently evaluating the final location of the pump, which will most likely be on the south side of the west end of Pierce Street. The project is scheduled to go to construction in August 2003 and be completed in August 2004. Pump Station #12:The City will replace and relocate the sanitary pump station currently located at 900 North Osceola Avenue (on the east side of Clearwater Bay Marina). The City is currently finalizing the new location in coordination with Clearwater Bay Marina development (under review). Construction estimated to take place in late 2003 to be completed four months later.Cleveland Street Streetscape:As the primary “Main Street” within our Downtown, the City intends to implement the construction of the Downtown streetscape for Cleveland Street from Myrtle to Osceola Avenues as soon as possible. To that end, the City will be initiating the preparation of construction drawings, specifications, and the partial construction of this segment in 2004 - 2006. Myrtle Avenue Reconstruction:The City is finalizing plans to reconstruct and resurface Myrtle Avenue throughout the Downtown area. Construction is scheduled to be complete in mid-2004 at which time the State Road 595 (Alternate U.S. Highway 19) designation will be reassigned from Fort Harrison Avenue to Missouri Avenue, Court Street and Myrtle Avenue. In addition, the western terminus of the S.R. 590 designation on Drew Street will move from Fort Harrison Avenue east to Myrtle Avenue. Station Square Park Redevelopment:As part of the Cleveland Street streetscape and wayfinding signage improvements, it is the intention of the City to encourage the redevelopment of this important Downtown urban space. It may be possible to initiate this project concurrent with the proposed redevelopment of the Station Square parking lot as part of a significant, mixed land use project. December, 2017 | 141 of 189Chapter 4. Plan Implementation Clearwater Downtown Redevelopment Plan142 of 189 | December, 2017Clearwater Beach Connector Spur (Pinellas Trail):The Clearwater Beach Connector Spur will provide a multi-use trail facility connecting Clearwater Beach, Downtown and the Pinellas Trail. Approximately 2,000 feet of the Connector Spur is located within the Downtown area between the intersection of Turner Street and East Avenue (part of the proposed Pinellas Trail and East Avenue Widening project) and the new Memorial Causeway Bridge (presently under construction).Gulf to Bay Boulevard and Highland Avenue Gateway Intersection Improvement:Once the Memorial Causeway Bridge is open in 2004, a substantial portion of existing traffic utilizing Cleveland Street will move onto Court Street resulting in a significant reduction in traffic Downtown. This reduction may result in certain negative impacts on Downtown businesses. In addition, future traffic might mistakenly utilize Cleveland Street, which will terminate at Osceola Avenue, as a route to the beach.Therefore, the City, acknowledging the level of importance of this “Gateway” intersection, will implement this portion of the Downtown streetscape indicating the correct routes to either the Downtown or Beach to motorists.Fort Harrison Avenue Streetscape:As a major “Gateway” thoroughfare within the Downtown, the City intends to implement this portion of the Downtown streetscape as soon as possible. To that end, the City will initiate the preparation of construction drawings, specifications, and partial construction of this segment in 2004 - 2006. Glen Oaks Park Stormwater Detention Facility:Located immediately south of the Downtown area at the intersection of Court Street and Betty Lane, the Glen Oaks Park Stormwater Detention Facility is a 20-acre flood control and water quality project, which will remove 78 residences from the 100-year floodplain. Approximately one-half of these residences are located within the Downtown area. In addition, 100-year flood levels will be reduced on streets within this area. The project will also include amenities including two multi-purpose ball fields, restrooms, playground, walking trails and associated parking.Memorial Causeway Bridge (landscaping):In early 2004, when construction is complete on the new Memorial Causeway Bridge, the S.R. 60 designation will be reassigned from Cleveland Street to Court and Chestnut Streets. Extensive landscaping will be located along Court Street up to the waterfront and will continue on the west end of the bridge along the causeway to the beach. The landscaping will be coordinated with existing landscaping along the sides of and within islands on Court Street and the beach roundabout.Cleveland Street and Gulf to Bay Boulevard Repaving:FDOT is currently preparing plans to resurface Cleveland Street between Frederica Avenue and Highland Avenue. The construction date is in Fiscal Year (FY) 2005.Cleveland Street and Memorial Causeway Repaving: FDOT is currently preparing plans to resurface Cleveland Street between Fort Harrison Avenue and its western terminus.Main Fire Station:Funded by Penny for Pinellas, this project encompasses the renovation and modernization of the main fire station located Downtown. The improved and expanded facility will meet current standards and better provide for the needs of a diverse population. In addition, a review of possible alternate locations farther to the south is being considered in order to provide a consistent standard of coverage for the entire Clearwater community. Funding for the project will be partially reimbursed by Pinellas County since these resources will also serve the unincorporated areas of the Clearwater Fire District. Osceola Avenue Parking Garage (375 - 500 spaces):Due to the strategic location of this prime redevelopment site “Superblock”, a public/private partnership may enable the construction of a major Downtown parking garage to service the block’s redevelopment potential, and the redevelopment activities which might occur on the parcels lying west of Osceola Avenue. This parking garage will also provide additional parking for the new Main Library, currently under construction.Redevelopment Garage (375 – 500 spaces):As major redevelopment occurs, it is anticipated that one or more major entertainment and restaurant mixed use project(s) will be developed Downtown. Due to the high parking demand of these types of uses, this garage would be sited and constructed to support the entertainment activity. The specific location of the garage will be determined based on the location of the entertainment project(s) and will provide parking for it and other planned/approved downtown redevelopment projects. December, 2017 | 143 of 189Chapter 4. Plan ImplementationColumn intentionally left blankReuse of Existing Main Fire Station: Should the existing Fire Station facility be relocated to an alternative site, the existing Fire Station may be reused to store a variety of Police Department or Parks and Recreation Department equipment and vehicles.Coachman Park Redevelopment and Garage:As part of the future redevelopment of the prime Downtown parcels lying adjacent to Osceola Avenue, the City is planning to construct a park which will act as a significant Downtown waterfront destination. The Coachman Park Amphitheater will be enlarged and relocated on site and Drew Street will terminate at the water providing for a pedestrian promenade along the waters edge and waterfront restaurant which could be leased to a private operator. A unique interactive fountain would be built as a major focal point. Cleveland Street, west of Osceola Avenue, would be closed and converted into a meandering pedestrian pathway between Downtown and the water. As part of this project, the City may construct or enter into a public-private partnership to construct a garage in the less appealing southern portion of this 18-acre site near the start of the new bridge. In addition, the current surface parking would be removed in favor of a large “great lawn.” Downtown Marina:The City has awarded a consulting contract for the purpose of analyzing the regulatory process for permitting the future construction of a 150 - 200 slip waterfront marina. The marina would be publicly-owned and operated accommodating both power and sail crafts with a mix of permanent and transient slips. A limited number of tourist related ferries and pleasure crafts would be allowed, however, commercial fishing operations would be prohibited.Pinellas Trail and East Avenue Widening:The portion of the Fred E. Marquis Pinellas Trail along East Avenue constitutes the last remaining unimproved segment of the trail. The project provides for the addition of a multi-use trail facility and roadway improvements for approximately 0.7 miles within the East Avenue right-of-way between Drew Street and Druid Road. This includes the replacement of the southbound lane of East Avenue and the sidewalk on the west side of East Avenue with a landscaped, asphalt surface consistent with the Pinellas Trail standards in 2006/2007. Between Turner and Drew Streets the southbound traffic lane of East Avenue and the sidewalk on the west side of East Avenue will be removed. The Pinellas Trail will be reconstructed in the center of this area with landscaping on either side. New City Hall and associated parking:Recently the City Commission has made the decision to make available the City Hall site for redevelopment if it is made part of a larger site in concert with the two adjoining properties owned by the Calvary Baptist Church. Making the City Hall site available for private development would require a referendum. At this time, it is anticipated that a new City Hall would be largely funded from the proceeds of a future sale. Clearwater Downtown Redevelopment Plan144 of 189 | December, 2017Osceola Avenue Streetscape:Due to the array of prime redevelopment parcels along Osceola Avenue (Calvary Baptist Church, City Hall, Harborview, and the Superblock), it is expected that this streetscape segment would be implemented as projects come on line.Cleveland Street and Gulf to Bay Boulevard Streetscape:This segment of Cleveland Street from Myrtle Avenue east to Gulf to Bay Boulevard will be improved in future years as new developments are implemented.Commercial Streets “A” and “B”:These constitute secondary local streets, which will be improved subsequent to new infill redevelopment projects built adjacent to them.Court/Chestnut Streets Beach Corridors Streetscape:With the opening of the Memorial Causeway Bridge, these east-west major arterials will become the primary route to and from the beaches. It is anticipated that, as new infill projects are developed on the parcels adjacent to these streets, the City and potential developers of these properties would participate in the implementation of a new streetscape. Beach to Bluff Guideway:An elevated, light rail system is proposed to run along the Memorial Bridge (currently under construction and scheduled for completion in mid-2003) and Causeway between the Bluff on the western edge of Downtown and the Marina area on the Beach.New PSTA Multi-modal transportation center:The redevelopment of the existing PSTA site may include a new PSTA transfer station, public parking for the Downtown and a possible light rail station.REDEVELOPMENT INCENTIVESThe City of Clearwater and Community Redevelopment Agency offer numerous incentives to businesses located, or interested in locating, in the Downtown. Much of the area contained in the overall boundaries of the Downtown is part of several programs including the City’s Brownfields Area, Enterprise Zone and Clearwater Main Street. These programs provide qualified business and property owners located within the specified boundaries with numerous financial incentives that make doing business in Clearwater prosperous for the community as a whole. Additionally, the City offers incentives that are applicable to certain impact fees, allows the use of transfer of development rights and designates Downtown as a Regional Activity Center. The following is a list of the significant incentive programs that are available to qualified property owners, businesses and developers within the Community Redevelopment Area (CRA) and Downtown. For more information on a specific incentive, please contact the City department indicated. Incentive: Brownfields ProgramProgram Goal/Brief Description:To assist businesses and development projects in assessing and safely cleaning a tract of land that may have the presence or potential presence of an environmentally unsafe substance remaining from a previous use. The primary grant program offered by the City is a Phase I assessment grant for a non-intrusive evaluation of a particular property, and associated regulatory records to determine the existence of potential environmental impacts and liabilities. If the environmental assessment identifies potential problematic conditions, a 50/50 grant match can be awarded to assist in the actual “testing” of a particular property and to determine the proper mitigation strategy and the associated costs involved in future abatement and remediation. Other incentives that may be available for properties located within the Brownfields area are: the Brownfields Redevelopment Bonus Refund; the Brownfields Property Ownership Clearance Assistance Trust Fund; a Property Clearance Loan; the Brownfields Area Loan Guarantee Program; Brownfields Revolving Loan; Brownfields Site Rehabilitation Agreement; and Voluntary Cleanup Tax Credit.Eligibility: Projects located within the Downtown Plan area, between Missouri Avenue and Fort Harrison Avenue (See Map 13, page 165).Funding Source:U.S. Environmental Protection Agency, Florida Department of Environmental Protection and Florida Office of Tourism, Trade and Economic Development, City of Clearwater and Pinellas County Economic Development.Award Ranges:Grants range from up to $5,000 for a Phase I assessment and match up to $10,000 for Phase II assessment. December, 2017 | 145 of 189Chapter 4. Plan ImplementationColumn intentionally left blankSample Projects:EEI ModTech; Harbor Oaks, LLC; Jiffy Reprographics; Mediterranean Village; Prospect Lake Park; Postcardmania.Contact:Economic Development & Housing Department - (727) 562-4054.Incentive: Clearwater Downtown Stormwater Service District (Prospect Lake Park Regional Stormwater District)Program Goal/Brief Description:The program allows projects within the specified district to pay into a general fund in place of providing the required stormwater treatment controls. Projects that occur within the service district are able to use the Town Pond for stormwater treatment instead of on-site controls. Projects that utilize this development incentive will be required to pay a one-time fee to the City that will be used for water quality treatment purposes. Eligibility: All potential projects located within the Stormwater Service District boundaries (See Map 14, page 169).Funding Source:Not Applicable.Award Ranges:For projects smaller than 1.5 acres, the fee is $18,595.00 per acre of project land; and for projects larger than 1.5 acres, the fee is $75,000 + $25,000 per acre of project land.Sample Project:Mediterranean Village.Contact:Public Works Administration, Environmental and Stormwater Management - (727) 562-4742. Clearwater Downtown Redevelopment Plan146 of 189 | December, 2017BROWNELLSTHIBISCUS STFMETTOSTHILLCRESTDRSANTAROSASTPRESCOTT AVEJEFFERSONAVEBOOTHAVEHILLTOP AVECHESTER DRFOREST RDAVESANJUANCTNICHOLSON ST PALM A V EJURGENS STAVEERGREENAVELEE STCRESTVIEW STWESTAVEPALMTERRACEDRPALM BLUFF STWATTERSON AVES A L LYLNWAVERLY WAY ERMANMCVEIGH DRGEORGIA STINDIANA AVEKENWOOD AVEMARIVA AVEFRANKLINCIRFERN AVEPINEROSEOAKALDEN AVESPRING CTJACARANDACIRHAMILTONCRESOAKWOODAVEMARKLEYSTLEMBOCIRJASMINECTBROWNS CTPIERCESTLIME STCEDAR STEVERGREENAVEEVERGREENAVEAVEBETTYLNHOLT STHIGHLAND AVEFREDRICA AVELAURA STMADISON AVEJEFFERSON AVEFRANKLIN STGROVE STHARTSTNICHOLSON STMARIVA AVEJASMINE WAYBETTYLNPENNSYLVANIA AVEMISSOURIAVEROGERSSTELDRIDGE STNICHOLSON STPINE STJASMINEWAYPROSPECT AVEWASHINGTONAVEPROSPECT AVEBAYAVEHARTSTMADISON AVMETTO STJASMINEWAYWASHINGTONAVEHIBISCUS STLCREST AVEHIBISCUS STPINE STHILLCREST AVEPARK STPALMETTO STLAURA STPINESTROGERSSTMAGNOLIA DRROGERSSTBROOK DR MISSOURIAVSANREMOAVEFRANKLIN STPIERCESTROSEMERE RDTURNER STMADISONAVEMISSOURIAVELINCOLN AVEOSCEOLAAVEGARDENAVEPARK STMAPLE STJEFFERSON AVEGROVE STBETTYLNPIERCE STMAGNOLIA DRHENDRICKSSTHAROLD CTAVANDA CTPEACH STMARGO AVEGOULD STGROVE STMAPLE STBLANCHEBLITTLEJOHN TRLJACARANDACIRCEDAR STGROVE STGROVE STDREW STDREW STDREW STMYRTLEAVEMYRTLEAVEMYRTLE AVEJONES STJONES STLAURA STCLEVELAND ST NELINCOLN AVELINCOLN AVEJACKSON RDMADISONAVEPENNSYLVANIA AVEJONES STHARTSTPLAZA STMAPLE STMAPLE STBETTYLNLADY MARY DRLADY MARY DRFREDRICA AVEPIERCESTPIERCESTBETTYLNEVERGREEN AVEFRANKLINSTMISSOURIAVEMISSOURIAVEMARTINLUTHERKING,JR.AVEMARTIN LUTHER KING, JR. AVEMARTIN LUTHERKING,JR. AVEMISSOURI AVECLEVELANDSTCLEVELANDSTPROSPECT AVELINCOLN AVECOURTSTCOURT STCOURTSTEWING AVEMEMORIALCAUSEWAYPARK STPARK STVINE AVEVINEAVEGARDEN AVEGARDENAVEGARDENAOSCEOLA AVEOSEMINOLESTELDRIDGE STELDRIDGESTELDRIDGESTPALMETTO STPALMETTO STFORTHARRISON AVEFORT HARRISON AVGARDEN AVESEMINOLESTSEMINOLESTSEMINOLESTOSCEOLAAVEMYRTLEAVEFORTHARRISON AVEFORTHARRISON AVECLEVELANDSTPIERCE BLVDDREW STPIERCESTCOURT STOAK AVEOAK AVEBAYAVETURNER STTURNER STTURNERSTJASMINE WAYDRUID RDDRUIDRDORANGE AVEDRUIDRDDRUIDRDPINESTCHESTNUT STCHESTNUTSTEWING AVEPARK ST GUL FTO B AY BL VD HILLCREST AVEMARK PATHDRUIDRDLAND AVEHIGHLANDAVEHIGHLAND AVEPARK STSANREMOAVETURNER STROGERS STDE LEONSTDE LEONSTFRANKLIN STCLEVELANDSTGLENWOODAVEGLENWOOD AVEGLENWOOD AVELAURA STLAURASTHIGHLAND AVEORANGEVIEWSTMAPLE STMDREWSPALMETTOGLENWOODAVEClearwaterHarborPinellas TrailTownLakeLegend0800400FeetSource: City of Clearwater Economic Development DepartmentPrepared by: City of Clearwater Planning Department, January 2003Map 13Brownfields BoundaryDowntown PlanAreaBrownfields Boundary December, 2017 | 147 of 189Chapter 4. Plan ImplementationBROWNELLSTHIBISCUS STFAMETTOSTHILLCREST DRSANTAROSASTPRESCOTTAVEJEFFERSON AVEBOOTH AVEHILLTOPAVEHESTERDRFOREST RDVESAN JUANCTNICHOLSON ST PALM A VEJURGENS STVERGREEN AVELEE STCRESTVIEW STWEST AVEPALMTERRACEDRPALM BLUFF STWATTERSON AVE S A L LYLNW A V E R LY WAY RMAN MCVEIGH DRGEORGIA STINDIANA AVEKENWOOD AVEMARIVA AVEFRANKLINCIRFERN AVEALDEN AVESPRING CTJACARANDACIRHAMILTONCRESOAKWOOD AVEMARKLEYSTLEMBOCIRJASMINECTBROWNS CTPIERCE STLIME STCEDAR STEVERGREEN AVEEVERGREENAVEVEBETTY LNHOLTSTHIGHLAND AVEFREDRICA AVELAURA STMADISONAVEJEFFERSON AVEFRANKLIN STGROVE STHARTSTNICHOLSON STMARIVA AVEJASMINE WAYBETTY LNPENNSYLVANIA AVEMISSOURI AVEROGERSSTELDRIDGE STNICHOLSON STPINESTJASMINEWAYPROSPECT AVEWASHINGTON AVEPROSPECT AVEBAYAVEHARTSTMADISONAVEMETTO STJASMINEWAYWASHINGTON AVEHIBISCUS STCRESTAVEHIBISCUS STPINE STHILLCRESTAVEPARK STPALMETTO STLAURA STPINE STROGERSSTMAGNOLIADRROGERSSTBR OOKDR MISSOURI AVESAN REMO AVEFRANKLIN STPIERCE STROSEMERTURNER STMADISONAVEMISSOURI AVELINCOLNAVEOSCEOLA AVEGARDEN AVEPARK STMAPLE STJEFFERSON AVEGROVE STBETTY LNPIERCE STMAGNOLIA DRHENDRICKSSTHAROLD CTAVANDA CTPEACH STMARGO AVEGOULD STGROVE STMAPLE STBLANCHE B LITTLEJOHN TRLJACARANDACIRCEDAR STGROVE STGROVE STDREW STDREW STDREW STMYRTLE AVEMYRTLEAVEMYRTLE AVEJONES STJONES STLAURA STCLEVELAND ST NELINCOLNAVELINCOLN AVEJACKSON RDMADISONAVEPENNSYLVANIAAVEJONES STHARTSTPLAZA STMAPLE STMAPLE STBETTY LNLADY MARY DRLADY MARY DRFREDRICA AVEPIERCE STPIERCESTBETTY LNEVERGREEN AVEFRANKLIN STMISSOURI AVEMISSOURIAVEMARTIN LUTHER KING,JR.AVEMARTINLUTHERKING,JR.AVEMARTINLUTHER KING,JR.AVEMISSOURIAVECLEVELANDSTCLEVELANDSTPROSPECT AVELINCOLNAVECOURT STCOURT STCOURT STEWING AVEMEMORIALCAUSEWAYPARK STPARK STVINE AVEVINE AVEGARDEN AVEGARDEN AVEGARDENAOSCEOLA AVEOSEMINOLESTELDRIDGE STELDRIDGE STELDRIDGESTPALMETTO STPALMETTO STFORTHARRISON AVEFORT HARRISON AVEGARDENAVESEMINOLESTSEMINOLESTSEMINOLESTOSCEOLA AVEMYRTLE AVEFORT HARRISONAVEFORTHARRISON AVECLEVELANDSTPIERCEBLVDDREWSTPIERCE STCOURTSTOAK AVEOAK AVEBAYAVETURNER STTURNERSTTURNERSTJASMINE WAYDRUID RDDRUIDRDORANGEAVEDRUIDRDDRUIDRDPINESTCHESTNUTSTCHESTNUTSTEWING AVEPARK ST GULF T OB AY B L V D HILLCRESTAVEARK PATHDRUIDRDAND AVEHIGHLAND AVEHIGHLAND AVEPARK STSAN REMO AVETURNER STROGERS STDE LEONSTDE LEON STFRANKLIN STCLEVELANDSTLAURASTLAHIGHLAND AVEORANGEVIEWSTMAPLE STPALClearwaterHarborPinellas TrailTownLakeLegendDistrict Boundary0800400FeetSource: City of Clearwater Engineering Department Prepared by City of Clearwater Planning Department, April 2003Map 14Town Lake Regional Stormwater DistrictDowntown Plan Character DistrictsDowntown CoreEast GatewayOld BaySouth GatewayTown Lake Business ParkTown Lake Residential Clearwater Downtown Redevelopment Plan148 of 189 | December, 2017Funding Source:U.S. Department of Housing and Urban Development.Award Ranges:Dependent on project size and type.Sample Project:Greenwood Apartments.Contact:Economic Development & Housing Department - (727) 562-4031.Incentive: Community Redevelopment Agency (CRA) IncentivesProgram Goal/Brief Description:The CRA is a tax increment financed district. The agency works closely with developers and coordinates projects that impact the Downtown. It also combines efforts and resources with the Brownfields and Enterprise Zone projects in order to spur catalytic development with the CRA district. The CRA can offer a variety of incentives depending on the project size and type. The CRA can participate in land acquisition, the payment of impact/permit fees, façade improvement grants, and other public infrastructure projects such as streetscape improvements and parking garages. Eligibility:Projects and businesses within the CRA district.Funding Source:Tax Increment Financing.Incentive: Community Development Block Grants (CDBG)Program Goal/Brief Description:CDBG funds are provided to the City by the federal government to help revitalize neighborhoods, expand affordable housing and economic opportunities and improve community facilities and services, primarily for the benefit of low- and moderate-income persons. Activities that can benefit from this type of funding include:xAcquiring land for public purposes;xReconstructing/rehabilitating housing and other property; xBuilding public facilities and improvements such as streets, sidewalks, sewers, water systems, community and senior citizen centers and recreational facilities; xAssisting people in preparing for and obtaining employment through education and job training, welfare-to-work activities, and other services; xProviding public services for youths, seniors, and/or the disabled; andxAssisting low-income homebuyers directly through, for example, down payment assistance, subsidizing interest rates or helping with closing costs for first-time buyers. Eligibility:Eligible residents must be in the low- to moderate-income category (generally defined as members of a family earning no more than 80 percent of the area median income) and projects must be located within a low to moderate-income census tract as defined by HUD.Award Ranges:Dependent on project size and type.Sample Projects:IMR/CGI; Mediterranean Village; Cleveland Street Streetscape.Contact:Economic Development & Housing Department - (727) 562-4220.Incentive: Enterprise Zone (EZ)Program Goal/Brief Description:Newly expanded or redeveloped businesses located in the Enterprise Zone (Map 15, page 173), who collect or pay Florida sales and use tax and Florida Corporate Income Tax, may be eligible for tax incentives for promoting private sector investments and providing job opportunities for Enterprise Zone residents. The following are incentives available for businesses: Property tax credit (corporate income tax); jobs tax credit (corporate income tax); jobs tax credit (sales and use tax); sales tax refund for building materials used in rehabilitation of real property; sales tax refund for business machinery and equipment.Eligibility:The zone encompasses the current and expanded Community Redevelopment Area; it has the same boundaries as the Brownfields program. Funding Source:Department of Revenue.Award Ranges:Varies according to incentive. December, 2017 | 149 of 189Chapter 4. Plan ImplementationColumn intentionally left blankSample Projects:Harbor Oaks, LLC; Walgreens; Publix.Contact:Economic Development & Housing Department - (727) 562-4054.Incentive: Regional Activity Center (RAC)Program Goal/Brief Description:The RAC designation increases the thresholds for hotel and office uses that would trigger Development of Regional Impact review. Eligibility:The RAC encompasses the boundaries of the Central Business District plan category as indicated in the Downtown Redevelopment Plan 1995. Funding Source:Not applicable.Award Ranges:Hotel threshold increases from 350 rooms to 750 rooms; office threshold increases from 300,000 square feet of floor area to 600,000 square feet. Sample Projects:None.Contact:Planning Department - (727) 562-4579.Incentive: Exemption of Open Space, Recreation Land and Recreation Facility Impact FeesProgram Goal/Brief Description:Redevelopment or the expansion of currently developed properties located within the Community Redevelopment Area are exempt from the required Open Space impact fee and the Recreation Land and Recreation Facility impact fees. In addition, City park projects that have been deemed to provide Citywide service and are located within the CRA are eligible to receive funding that has been collected as Open Space, Recreation Land and Recreation Facility Impact Fees from projects outside of the CRA.Eligibility:All projects located within the CRA boundaries.Funding Source:City of Clearwater.Award Ranges:Dependent on project type and size.Sample Projects:Laura Street Townhomes; Mediterranean Village; Church of Scientology Ministerial Training & Pastoral Counseling Center.Contact:Parks and Recreation Department - (727) 562-4823. Clearwater Downtown Redevelopment Plan150 of 189 | December, 2017Award Ranges:Dependent on business and contract request.Sample Projects:EEI ModTech.Contact:Economic Development & Housing Department - (727) 562-4054.Incentive: Florida Main Street Community ProgramProgram Goal/Brief Description:In 1998, Clearwater was named a Main Street community to help in the revitalization of the Downtown area. The program assists in the recruitment of retail businesses to the Downtown corridor and provides funding for Downtown promotions, special events and Downtown building façade rehabilitation, through the CRA façade grant program. Four committees have been created to support the public–private partnerships within the Downtown. The Joint Venture is the organizational committee and develops strategies for the program. The Design Committee provides advice and assistance to preserve the historical character of buildings along Cleveland Street. The Economic Development Committee concentrates on a business recruitment, retention, and expansion campaign within the CRA, while the Promotions Committee capitalizes on major events to bring economic benefit to the Downtown commercial district.Eligibility:Projects must be located within the CRA boundaries.Funding Source:Community Redevelopment Agency, Downtown Development Board.Award Ranges:Dependent on project type and size.Sample Projects:Gaslight Alley; Park Jewelers; Downtown Clearwater Arts Stroll; Main Street Update - Quarterly Newsletter; Post Office Landscaping. Contact:Economic Development & Housing Department - (727) 562-4044.Incentive: HUBZoneProgram Goal/Brief Description:The Small Business Administration HUBZone Empowerment Contracting Program provides federal contracting assistance by setting aside a specified number of federal contracts for small businesses located in census tract 259.02 or 262.00, which are historically underutilized business zones. Fostering the growth of these federal contractors as viable businesses, for the long term, helps to empower communities, create jobs and attract private investment. The program benefits are available for eligible HUBZone businesses: Federal contract assistance, including Competitive, Sole-Source, Full and Open and Subcontracting contracts and specialized assistance including SBA-guaranteed surety bonds and employer tax credits, tax-free facility bonds, and investment tax deductions.Eligibility:Businesses must be located in census tract 259.02 or 262.00 (see Appendix Map 4A), be owned and controlled by one or more U.S. citizens and have at least 35 percent of its employees residing in a HUBZone.Source:U.S. Small Business Administration (SBA). December, 2017 | 151 of 189Chapter 4. Plan ImplementationBROWNELLSTHIBISCUS STMETTOSTHILLCRESTDRSANTAROSASTPRESCOTT AVEJEFFERSONAVEBOOTHAVEHILLTOP AVESTER DRFOREST RDSANJUAN CTNICHOLSON ST PALM A V EJURGENS STEENAVELEE STCRESTVIEW STWESTAVPALMTERRACEDWATTERSON AVES A L LYLNWAVE R LY WAYROS NMCVEIGH DRGEORGIA STINDIANA AVEKENWOOD AVEMARIVA AVEFRANKLINCIRFERN AVEPINEWROSEWOAKWALDEN AVESPRING CTJACARANDACIRHAMILTONCRESOAKWOODAVEMARKLEY STLEMBOCIRJASMINECTBROWNS CTPIERCESTLIME STCEDAR STEVERGREENAVEEVERGREEN AVEBETTY LNHOLT STHIGHLAND AVEFREDRICA AVELAURA STMADISON AVEJEFFERSON AVEFRANKLIN STGROVE STHARTSTNICHOLSON STMARIVA AVEJASMINE WAYBETTYLNPENNSYLVANIA AVEMISSOURIAVEROGERSSTELDRIDGE STNICHOLSON STPINESTJASMINEWAYPROSPECT AVEWASHINGTONAVEPROSPECT AVEBAYAVEHARTSTMADISONAMETTO STJASMINEWAYWASHINGTONAVEHIBISCUS STEST AVEHIBISCUS STPINE STHILLCREST AVEPARK STPALMETTO STLAURA STPINESTROGERSSTROGERSSTROOK DR MISSOURIASANREMOAVEFRANKLINSTPIERCESTROSEMERE RDTURNER STMADISONAVEMISSOURIAVELINCOLN AVEOSCEOLAAVEGARDENAVEPARK STMAPLE STJEFFERSON AVEGROVE STBETTYLNPIERCE STHENDRICKSSTHAROLD CTAVANDA CTPEACH STMARGO AVEGOULD STGROVE STMAPLE STBLANCHEBLITTLEJOHN TRLJACARANDA CIRCEDAR STGROVE STGROVE STDREW STDREW STDREW STMYRTLEAVEMYRTLEAVEMYRTLEAVEJONES STJONES STLAURA STCLEVELAND ST NELINCOLN AVELINCOLN AVEJACKSON RDMADISONAVEPENNSYLVANIA AVEJONES STHARTSTPLAZA STMAPLE STMAPLE STBETTYLNLADY MARY DRLADY MARY DRFREDRICA AVEPIERCESTPIERCESTBETTYLNEVERGREENAVEFRANKLINSTMISSOURIAVEMISSOURI AVEMARTIN LUTHER KING, JR. AVEMARTINLUTHER KING,JR.AVEMARTIN LUTHER KING,JR.AVEMISSOURIAVECLEVELANDSTCLEVELANDSTPROSPECT AVELINCOLN AVECOURT STCOURTSTCOURT STEWING AVEMEMORIALCAUSEWAYPARK STPARK STVINE AVEVINE AVEGARDENAVEGARDENAVEGARDEOSCEOLA AVESEMINOLESTELDRIDGESTELDRIDGESTELDRIDGE STPALMETTO STPALMETTO STFORTHARRISON AVEFORT HARRISONAGARDEN AVESEMINOLESTSEMINOLESTSEMINOLESTOSCEOLAAVEMYRTLEAVEFORTHARRISON AVEFORT HARRISON AVECLEVELANDSTPIERCEBLVDDREW STPIERCESTCOURT STOAK AVEOAKAVEBAYAVETURNER STTURNERSTTURNERSTJASMINE WAYDRUID RDDRUID RDORANGE AVEDRUIDRDDRUIDRDPINESTCHESTNUT STCHESTNUT STEWING AVEPARK ST GUL FTO B AY BL VD HILLCREST AVEPATHDRUIDRDAVEHIGHLANDAVEHIGHLAND AVEPARK STSANREMOAVETURNER STROGERS STDE LEONSTDE LEONSTFRANKLIN STCLEVELANDSTGLENWOODAVEGLENWOOD AVEGGLENWOODAVELAURA STLAURA STHIGHLAND AVEORANGEVIEWSTMAPLE STMADREW STPALMETTOSGLENWOODAVEClearwaterHarborPinellas TrailTownLakeLegend0800400FeetSource: City of Clearwater Economic Development DepartmentPrepared by: City of Clearwater Planning Department, January 2003DowntownPlan AreaEnterprise ZoneMap 15Enterprise Zone Boundary Clearwater Downtown Redevelopment Plan152 of 189 | December, 2017Incentive: Payment-in-Lieu of ParkingProgram Goal/Brief Description:To address the need for flexible parking standards within the City’s Downtown, the City Commission made available a payment in-lieu of required off-street parking program. The program permits a project owner to pay a $4,500 per space fee into an established account that is used to fund parking improvement projects that add to the supply of public parking in the identified district. This incentive allows a project to utilize the space required to accommodate parking for building, landscaping or open space.Eligibility:Any property located within the original CRA boundary.Funding Source:Not Applicable.Award Ranges:Not Applicable.Sample Projects:Church of Scientology Ministerial Training & Pastoral Counseling Center.Contact:Public Works Administration, Traffic Operations - (727) 562-4750.Incentive: Traffic Impact Fee (TIF) ReductionProgram Goal/Brief Description:To assist in the promotion of revitalization, the program designates all residential and non-residential development that locates within the boundaries of the CRA as eligible for a Transportation Impact Fee reduction. The 1990 Pinellas County Transportation Impact Fee Study indicated that projects developed within the CRA would generate significantly fewer new vehicle trips per each unit of development, making them eligible for a reduced Traffic Impact Fee. Eligibility:All business located within the original CRA boundary. Funding Source:Not Applicable.Award Ranges:Dependent on project type and size.Sample Projects:CGI/IMR; Harbor Oaks LLC; Mediterranean Village; Valone’s Vacuum.Contact:Public Works Administration, Traffic Operations - (727) 562-4750. Incentive: Transfer of Development Rights (TDR)Program Goal/Brief Description:Property owners having extra density units or floor area ratio (FAR) available from a project within the Downtown Plan area may be permitted to convey the development rights of that non-used development potential by deed, easement, or other legal instrument authorized by the City of Clearwater to another project within the Downtown Plan area that requests an increase above the maximum permitted development potential. Eligibility:Projects located within the Downtown Plan area may be used as “sending sites” and “receiving sites”.Funding Source:Not Applicable.Award Ranges:Not Applicable.Sample Projects:New incentive program made available at the inception of this Plan.Contact:Planning Department - (727) 562-4579.Incentive: Qualified Target Industry (QTI) Tax Refund ProgramProgram Goal/Brief Description:The main tool of this program is to encourage quality job growth in targeted high value-added businesses, and more specifically within an Enterprise Zone or Brownfields Area. The program provides tax refunds to pre-approved applicants for $3,000 per new job created and $6,000 in an Enterprise Zone, $2,500 bonus in a designated Brownfields; plus, there is an increased award per job for extremely high paying wages. A company has to prove that they would have considered other locations but chose Florida, among other reasons, because of this incentive program. December, 2017 | 153 of 189Chapter 4. Plan ImplementationColumn intentionally left blankEligibility:Only businesses serving multi-state and international markets are targeted. Business must be able to locate to other states. Retail activities, utilities, mining and other extraction or processing businesses and activities regulated by the Division of Hotel and Restaurants of the Department of Business and Professional Regulation are statutorily excluded from consideration. Average annual wage of all new hires, as of March 1, 2003 must be at least $36,049. Please check for updated wage information as these requirements are revised annually. Funding Source:State of Florida, City of Clearwater and Pinellas County Economic Development.Award Ranges:$3,000 to $10,500 per new job created, depending on the location and average annual wage. Sample Projects:CGI/IMR; Lincare Holdings; NexTrade Holdings, Inc.Contact:Economic Development & Housing Department - (727) 562-4054.TAX INCREMENT REVENUE PROJECTIONSIntroductionChapter 163, Part III, Florida Statutes, authorizes the County to approve the use of tax increment revenues for community redevelopment. According to the statute, the assessed valuation of the parcels noted on a certified tax roll within the CRA is “frozen” as of a specified date; after this base year, all future increase in tax revenues may be used by the CRA for approved redevelopment projects. These revenues may be used to purchase property, improve property, or used as security for bonds.In the case of the City of Clearwater’s recently approved expanded CRA, the County must first approve the CRA’s Redevelopment Plan, and upon adoption of this Plan by the City and County, a request can be made to the County by the CRA for the creation of a Redevelopment Trust Fund.Prior to establishing a Redevelopment Trust Fund, the CRA must (according to Florida State Statute 163.386) submit a list of each parcel, by parcel I.D. number that lies within the CRA district to the Pinellas County Appraiser’s office. The Appraiser’s office will certify the list and prepare to code each parcel for the base year to be established when a trust fund is approved. Clearwater Downtown Redevelopment Plan154 of 189 | December, 2017Historical OverviewIn its 20-year history, the CRA has been a critically effective tool in positioning downtown for redevelopment. In the 1980s, the tool was heavily used to purchase key real estate properties and conduct multiple capital projects. A slowing real estate market in the 1990s combined with the loss of several properties from the tax roll due to institutional investment produced a dramatic drop in the tax increment affecting the CRA’s ability to implement major projects. However, during this time, the CRA continued to facilitate projects downtown concentrating on parking alternatives and beautification projects. The CRA is currently seeing visible signs of improvement with increases in property values in each of the last three years. Planned and future redevelopment projects coupled with the City’s infrastructure improvements will serve to develop the tax base further.The City of Clearwater’s CRA was established in 1981, with the taxable property value totaling $84,658,490 frozen in 1982. Tax Increment Financing (TIF) revenues commenced in 1983 with approximately $56,000. The CRA increment increased quite rapidly through 1989 with revenue at approximately $801,000. The tax increment peaked during the period 1989 through 1991 and fell quite dramatically through to 1998 with revenue down to $251,000. Since 1999, the increment has continued to rise. Most recently, tax increment in 2003 rose to $840,549. Between its peak in 1989 and its low in 1998, the tax roll lost roughly $54 million in value. This period of decline may be explained by the fact that multiple buildings within the CRA were taken off the tax roll, including the original Mass Brothers Department Store (now the Harborview Center), the Fortune Federal Savings and Loan Building purchased by Pinellas County, and the Oaks of Clearwater Retirement Center and Nursing Facility. These transactions alone accounted for over $22 million dollars of valuation. Additionally, in 1993, many Church of Scientology properties totaling roughly $24 million were taken off the tax roll. Overall, throughout the last 20 years, the tax roll experienced an average annual increase of 3.21 percent. The benefits of having TIF in place during these years cannot be overlooked, as it allowed the CRA to spend the ensuing years stabilizing the Downtown area in preparation for a major redevelopment program which is now underway. The CRA has collected a cumulative total of $9.9 million in increment revenues since its inception in 1982. The majority of these funds ($7.9 million) were used for capital projects and improvements including land acquisitions. Administration costs have totaled $1.6 million (16% of revenues) with revenues from the sale of properties funding parking, beautification, and other incentive programs. Many of the CRA’s capital projects occurred in the 1980s. During these years, the CRA concentrated on acquiring properties to eliminate slum and blight conditions downtown as well as finding viable uses for properties that became vacant. The CRA was instrumental in acquiring key parcels such as the City’s Municipal Services Building and Harborview Center sites. In addition, the CRA played a major role in advancing parking alternatives including the Station Square parking lot and Park Street Garage. Table 10 below identifies the CRA’s Capital Improvement Projects over the first twenty years of its history.In the 1990s, the CRA focused its efforts on investments that spurred private development especially by providing parking solutions for downtown. The CRA has reimbursed the City parking system so that free parking in two city lots and on weekends was provided. The CRA has also offered parking incentives that have been successful in retaining high profile companies with over 100 employees. Furthermore, the CRA has subsidized the Jolley Trolley, a non-profit trolley system, to provide reduced rate service between the downtown and the beach.The CRA has also been actively involved in the beautification of downtown. The CRA has coordinated a Façade Improvement Grant Program that has provided over $100,000 worth of exterior improvements to 36 buildings in the Downtown. Additionally, the CRA provided funding for the Cleveland Street Streetscape in past years as well as the renovation and beautification of downtown parks.In the last four years, the CRA has paved the way for significant private investment. Two examples include the CGI complex and Mediterranean Village Towhomes. The construction of the 50,907 square foot CGI (formerly IMR) office building with a 77,889 research and development facility reflects a $50 million investment. Similarly, with the Mediterranean Village in the Park Townhomes, the CRA purchased the land and is paying impact fees, permit fees, utility connections fees and December, 2017 | 155 of 189Chapter 4. Plan ImplementationProjectTime Period CostEnhancement and beautification of downtown parks including parking area west of City Hall, Bayfront Tennis Complex, and Coachman Park FY 1984-1986 $9,989Acquisition of property for JK Financial project, Clearwater Square complex, S.E. Corner of Garden Ave. and Cleveland Street (Atrium) FY 1985 $1,083,362Construction of Park Street parking garage with 195 public parking spacesFY 1985-1986 $1,241,057Revision of dowtown redevelopment planFY 1986 $5,825Landscaping of Park Street parking garageFY 1986 $23,375Acquisition of Bilgore property bounded by East Aenue, Pierce Street, Myrtle Avenue, and Park Street (Locatin of new MSB Building) FY 1986 $691,852Coachman Park Improvements - extensive renovation including terrain modification, brick walkways, landscape materials, and irrigation. FY 1987 $100,011Cleveland Street streetscape project - oak trees, decorative brick, tree gates and guards for the 500, 600, and 700 street blocks, Phase 1 FY 1987 $27,000Coachman Park bandshell project - CRA portion of entire projectFY 1987 $12,061Acquisition of CETA building site - 1180 ClevelandFY 1988 $450,000Downtown sidewalk project - antique lamp pole lighting fixturesFY 1988 $17,647Cleveland Street streetscape project - decorative brick, planters, trees - the 400 through 700 street blocks, Phase 2 FY 1988-1990 $342,555Downtown electrical improvementsFY 1988 $7,500Acquisition of Clearwater Towers MAS1 project site (Station Sq. Park)FY 1989 $229,278Development of Cleveland Street minipark adjacent to new Clearwater Towers Building (Station Square Park) FY 1989-1990 $230,000Purchase of Maas Brother property (Harborview/Steinmart)FY 1992 $1,926,710Purchase of Kravis property (Station Square Parking Lot)FY 1992 $357,058Parking lot expansion - Kravis property (Station Square Parking Lot)FY 1993 $67,518Dimmitt property purchase (Mediterranean Village Townhomes)FY 2000 $1,171,328$7,994,126Table 10. Community Redevelopment Agency Schedule of Capital Outlay and Improvements Fiscal Years 1982 - 2001stormwater fees for this 100-unit residential project worth $18 million next to the City’s Prospect Lake Park. These are examples of CRA funds strategically used to eliminate slum and blight conditions and redevelop these sites into viable properties.The redevelopment of downtown Clearwater is at a critical point in its history. In order to revitalize downtown, additional housing units and infrastructure improvements are needed. CRA tax increment revenues are crucial to entice private investment and provide incentives that make a project feasible. A example is the City’s recent selection of a developer for an infill condominium and retail project adjacent to Station Square Park. The CRA plans to use TIF funds to assist this project. In conjunction with the City’s capital improvement program, these investments will encourage private development and pave the way for continued downtown redevelopment. TIF will be one of the tools that will make these projects successful Clearwater Downtown Redevelopment Plan156 of 189 | December, 2017feet or over 208 housing units. Additional square footage of retail uses and residential units may be available through the Public Amenities Incentive Pool. Sale of the City Hall site will require approval of a referendum by Clearwater voters.xArnold/Brown Parcel at Drew Street/Fort Harrison and Osceola Avenues - An announced redevelopment site containing 70,131 square feet or 1.61 acres. According to published reports, the developer envisions a high-rise condominium, a boutique hotel and ground floor retail uses. Potential for development on this site is over 280,000 square feet, 112 units, or 152 hotel rooms. xAmSouth Block between Osceola Avenue, Fort Harrison Avenue, Cleveland Street and Drew Street or “Superblock” Parcel - Contains one large parcel, along with a few smaller properties. In total, the greater parcel could ultimately contain approximately 178,000 square feet or 4.1 acres. Development potential at this site could be over 712,000 square feet or 287 units.xHarborview Parcel at Cleveland Street and Osceola Avenue - This City-owned 77,000 square foot or 1.8-acre parcel, currently houses a 54,000 square foot Stein Mart Department Store, the City’s civic and conference center space, the Pickles Plus Restaurant along with an adjoining small parking lot. It is envisioned that some time in the future, Stein Mart would be relocated to another Downtown site, and the structure demolished for redevelopment as a major mixed-use development with a combination of retail, entertainment, hotel, and conference destination space. The Commission has interest in redeveloping the Redevelopment ObjectivesOn a very conservative basis, the original and expanded CRA district is projected to increase in value substantially over the next 20 to 30 years. This is driven primarily by the accelerating demand for new urban housing within the Downtown and adjacent beaches, and the strategic economic development goals and objectives of the City Commission. The Commission envisions a “destination” Downtown to be enjoyed by both residents in the region and tourists to our beaches.This redevelopment strategy was implemented by the City in 2002, and details the investment opportunities now available on several key redevelopment parcels and a large array of prime infill parcels. Several potential projects are described below:xCalvary Baptist Church “Bluff” Parcels on Osceola Avenue - Accounts for 137,510 square feet or 3.16 acres, this parcel is designated in the Downtown Core District for a FAR of 4.0 or 70 units per acre, which would generate up to 550,040 square feet of redevelopment or over 220 residential units. Additional square footage of retail uses and residential units may be available through the Public Amenities Incentive Pool. xCity Hall on Osceola Avenue - Contains approximately 130,000 square feet or 2.98 acres, this parcel currently houses City Hall, but the Commission has indicated that it would be made available for redevelopment if it were a key component of a quality redevelopment proposal with the adjacent parcels. This parcel could be developed with up to 520,000 square parcel if a quality developer can be identified who would meet the stringent requirements for redevelopment on this critical parcel. Sale of the Harborview site will require approval of a referendum by Clearwater voters.xStation Square Parking Lot Infill Parcel on Cleveland Street - Currently used as a City surface parking lot, this prime redevelopment parcel is owned by the CRA and has been offered to the public for redevelopment. The parcel contains 42,124 square feet or 0.97 acres, and is envisioned as a site for a garage structure (including public parking), retail, restaurant, and residential units. Development potential at this site could be over 168,000 square feet or 67 units.xProspect Lake Park Area between Myrtle and Missouri Avenues - This Downtown area surrounds the new urban Prospect Lake Park that has recently been completed by the City. The initial private redevelopment project in the area under construction is the 100-unit Mediterranean Village in the Park townhouse project. This area has been identified by developers as a prime location for future infill townhouse and apartment projects due to its proximity to the beaches, regional employment centers, and the fact that a housing product can still be developed at a $150,000 to $300,000 price range, which accommodates the needs of many young professionals, young families and empty nesters. xIt is also envisioned that the adjacent Town Lake Business Park District might attract additional professional office users to expand the campus office setting now in place at the CGI office complex. December, 2017 | 157 of 189Chapter 4. Plan ImplementationCRA Programs and Initiatives Timing Estimated CostCRA Area Brownfields Environmental Cleanup *Ongoing $5,000,000CRA Building Facade Improvement Program*Ongoing $1,000,000Downtown Land Acquisition * Ongoing $21,000,000CRA Redevelopment Incentive FundingOngoing $10,000,000Retail Lease/Location IncentivesOngoing $5,000,000CRA Affordable and Transitional Housing Projects*Ongoing $5,000,000CRA Revolving Loan Fund Ongoing $1,000,000CRA Community Policing InnovationsOngoing $1,000,000Total$49,000,000Summary Table of CRA Programs and Initiatives, Timing, and Estimated CostsColumn intentionally left blankxEast Gateway - Between Missouri and Highland Avenues and lying within the recently expanded CRA district are multiple infill parcels that over time will become attractive for redevelopment. Tax Increment Revenue ProjectionsBased on this overview, it is evident that the CRA has the potential for developing several million square feet of development over the next two decades, including the attraction of up to 1,000 new urban housing units in the next five to ten years in the downtown core which will act as a catalyst for a substantial amount of new office use, retail and entertainment establishments. If all of these projects described above are realized, the increase in the tax roll could be upwards of $390 million.However, while opportunities are outstanding, it is the intent of the CRA to proceed forward cautiously with our TIF projections. The TIF projections are calculated separately for the original CRA and the expanded CRA because the base years for the property values are different. The CRA envisions continuing to use both the City’s and the County’s share of Tax Increment Financing dollars for capital projects in the original and expanded CRA. TIF is identified as one of the funding sources for several capital and infrastructure improvement projects outlined in the Capital Improvement Projects (CIP) section of this plan. These projects include the Cleveland Street, Fort Harrison, and Gulf to Bay Streetscapes and the Gulf to Bay Boulevard and Highland Avenue Gateway Intersection. In addition, TIF will be used for paying impact fees, “buying in” of public parking in private projects, assembling redevelopment sites, purchasing land and/or buildings, affordable and transitional housing projects, façade improvement grants and providing additional community policing presence above and beyond current activity levels. Below is a summary of the programs and initiatives that will use TIF as well as the estimated costs associated with each. The County’s share of TIF shall only be used for the capital projects included in the table below. The City’s share of TIF may be used for any initiative listed in the table.* Capital projects and initiatives - County TIF shall only be used for these programs Clearwater Downtown Redevelopment Plan158 of 189 | December, 2017CRA Area Brownfields Environmental Cleanup ProjectsDue to the limited availability of state and federal environmental cleanup funds, TIF dollars will be required for environmental remediation for multiple projects, particularly those that have a history of petroleum contamination. A case in point is the Clearwater Auto Salvage Yard that is being acquired by the City, as well as a number of sites lying adjacent to the CGI (formerly IMRglobal) Campus west of Missouri.Project Cost: $5.0 millionTime Frame: OngoingCRA Building Façade Improvement ProgramThis is an ongoing program funded by the CRA in concert with our Main Street Program. The Façade Improvement Program provides grants and loans to eligible business property owners and tenants who wish to upgrade their exterior building facades.Project Cost: $1.0 millionTime Frame: OngoingDowntown Land Acquisition A critical function of the CRA is to assemble property for resale and redevelopment by the private sector. The principal purpose of property assembly is to assist in eliminating the slum and blight conditions that exist within the CRA by facilitating private redevelopment of these under-performing sites. This program enables the CRA to assemble, purchase and option property and structures within the CRA for redevelopment purposes consistent with this Plan. Examples of property acquisitions anticipated by this program include but are not limited to: acquiring property in the Town Lake Business Park Character District to facilitate the development of a suburban office campus; acquiring property in the East Gateway Character District to eliminate the problematic uses and/or contaminated sites, to improve the substandard housing conditions and to consolidate obsolescent and/or sites undersized as compared to current zoning requirements to allow commercial redevelopment; acquiring property within the Downtown to assist in the development of a major entertainment attraction including a movie theater, entertainment, retail and/or restaurant uses. Other property acquisitions that implement the goals, objectives and policies of this Plan may be achieved through the use of this CRA program. Total Cost: $21.0 millionTime Frame: OngoingCRA Redevelopment Incentive FundingHistorically, the CRA has utilized TIF revenues to assist redevelopment efforts in a variety of ways, such as: landscape and streetscape improvements, property acquisition, construction of public parking garages, payment of project permit and impact fees, payment of project utility connection and stormwater fees, parking incentives to retain downtown businesses, subsidy to the Jolley Trolley operations and the façade improvement program. Downtown redevelopment is generally considered to be more expensive and risky in an unproven market than development in other areas of a city and especially when compared to development in greenfields. This situation currently exists in Downtown Clearwater as demonstrated by the lack of substantial new private redevelopment with few exceptions. The lack of investment in Downtown has resulted in the poor economic health of Downtown to which the City is responding with this Plan. This program will provide financial incentives to developers to offset the high land, development and construction costs within the Downtown and to encourage investment in Downtown that will revitalize the center city with people, employees, businesses and activities. The types of incentives contemplated by this program include, but are not limited to: payment of project permit and impact fees; payment of project utility connection and stormwater fees; parking and other financial incentives to retain and attract downtown businesses; and contributions for parking facilities. Total Cost: $10.0 millionTime Frame: Ongoing December, 2017 | 159 of 189Chapter 4. Plan ImplementationColumn intentionally left blankRetail Lease/Location IncentivesIn order to achieve the concentration and/or location of the desired retail market in the Downtown, it may be necessary to negotiate with existing tenants in regard to existing leases or terms for relocation. This consideration may require significant cost to achieve a desired mix and physical orientation/location for these businesses. Total Cost: $5.0 millionTime Frame: Ongoing CRA Affordable and Transitional Housing ProjectsThe development of one or more mixed-income housing projects within the CRA has been identified as a necessary strategy due to the need to retain affordable housing options in this environment. Typically, the CRA would leverage its position in a public-private partnership by contributing funds to effectuate the lower income criteria in a new project.A major component of the rehabilitation of the CRA Expansion Area and the need for affordable housing is the redevelopment of the Clearwater Homeless Intervention Project (CHIP) site into a “transitional” and “permanent” housing campus. The campus concept for CHIP would entail assembling property between Park Street, the Stevenson Creek channel, Evergreen Avenue, and Cleveland Street into a self-contained and secure campus.TIF funding would be used to assist in the purchase of properties, while other state and federal funds would be used for housing construction and operations.Total Cost: $5.0 millionTime Frame: OngoingCRA Revolving Loan FundA key component of our future redevelopment strategy for the downtown is the implementation of a public-private revolving loan program with local financial institutions. Modeled after successful programs in other cities, a joint pool would be established and loans provided for expanding businesses, building improvements, relocation costs, etc. The CRA would provide seed capital to the pool, along with private capital from the banks.Total Cost: $1.0 millionTime Frame: Ongoing Clearwater Downtown Redevelopment Plan160 of 189 | December, 2017the quality of life of residents, businesses and visitors. In order to achieve this goal, additional community policing presence is needed. Through the use of TIF funds an enhanced level of community policing can be achieved. Total Cost: $1 millionTime Frame: OngoingTax Increment Revenue Projections for the Original CRA DistrictThe tax increment projections for the original CRA district are based on a yearly variable percentage increase of the tax roll valuation over a 30-year period. Increases in annual percentages reflect estimates of when major projects, described above, come on line. For the purposes of these projections, the city and county millage rates remain constant. The base year for calculating this increment is 1982.An estimate from 2004 through 2033 projects that property values will rise and that new projects will come on line resulting in $195 million in property value added to the tax roll. This corresponds to a cumulative tax increment of over $64 million over 30 years. Again, millage increases, additional new development, and increases in assessed property values may result in greater returns.A summary table of the tax increment financing projections follows detailing the city and county portions of the revenues. CRA Community Policing InnovationsThe City of Clearwater Police Department has employed a community policing philosophy for over 20 years. Its first focused efforts in the Downtown area came in 1998 when a police substation was co-located in the Clearwater Homeless Intervention Program (CHIP) shelter in the East Gateway Character District in response to resident concerns about the crime potential associated with the shelter. Another community policing team, the Downtown Bicycle Team, was established for the Downtown Core of the CRA in 2005 in anticipation of additional demands on the Police Department as a result of redevelopment. Additionally AmeriCorps Clearwater members have supplemented the activities of the Downtown Bicycle Team by acting as ambassadors of the City by assisting visitors and businesses. The intent of the community policing innovations in Downtown is for police officers to be a visible deterrent of crime as well as an approachable source of assistance and information. The officers act as liaisons to downtown visitors, businesses, employees and residents and work to build partnerships through daily visibility and community involvement and organization. They also help solve neighborhood problems and work to foster a sense of safety and security in public as well as private spaces.Community policing innovations focus on a variety of issues including those that are unique to the CRA such as homelessness, prostitution, drugs and street crimes, and a large immigrant population. A key component of the City’s redevelopment strategy is to reduce crime in the CRA and improve Tax Increment Revenue Projections for the Expanded CRA DistrictSimilar to the original CRA district, the expanded CRA district TIF estimate is based on a yearly variable percentage increase of the tax roll valuation over a 30-year period. Given that this area is predominantly residential, it is not expected that the values in the area will rise significantly. In fact, the estimated annual average increase of the tax roll is 1.42 percent. Property values are expected to rise and new projects will come on line resulting in a $37.9 million in property value added to the tax roll. This corresponds to a cumulative tax increment of over $7 million over 30 years. The key to successfully redeveloping and stabilizing the new CRA Expansion District is to maintain the city’s and county’s TIF allocation at the 100% level. The CRA anticipates needing to allocate TIF dollars from the original district to “leverage” redevelopment in the expansion area. Any reduction in county TIF allocation would negatively impact the success of downtown Clearwater.A summary table of the tax increment financing projections follows detailing the city and county portions of the revenues (pages 188 - 186). December, 2017 | 161 of 189Chapter 4. Plan ImplementationYear Tax Roll Valuation City Taxes at 100% County Taxes at 100% DDB Taxes Total Tax Increment (95% of Taxes)2003 $153,278,680 $394,772 $421,397 $68,620 $840,5492004 $157,877,040 $421,226 $449,635 $73,219 $896,8762005 $163,402,737 $453,016 $483,568 $78,744 $964,5622006 $169,938,846 $490,618 $523,707 $85,280 $1,044,6252007 $177,586,094 $534,613 $570,668 $92,928 $1,138,2982008 $186,465,399 $585,695 $625,196 $101,807 $1,247,0632009 $196,720,996 $644,696 $688,176 $112,063 $1,372,6872010 $208,524,256 $712,600 $760,660 $123,866 $1,517,2692011 $218,950,469 $772,582 $824,687 $134,292, $1,644,9832012 $227,708,487 $822,967 $878,470 $143,050 $1,752,2622013 $234,539,742 $862,267 $920,421 $149,881 $1,835,9402014 $239,230,537 $889,253 $949,227 $154,572 $1,893,3992015 $244,015,148 $916,779 $978,609 $159,357 $1,952,0082016 $248,895,450 $944,855 $1,008,579 $164,237 $20,11,7882017 $253,873,359 $973,493 $1,039,149 $169,215 $2,072,7642018 $258,950,827 $1,002,704 $1,070,329 $174,292 $2,134,9592019 $264,129,843 $1,032,499 $1,102,134 $179,471 $2,198,3982020 $269,412,440 $1,062,889 $1,134,574 $184,754 $2,263,1072021 $274,800,689 $1,093,888 $1,167,663 $190,142 $2,329,1092022 $280,296,703 $1,125,507 $1,201,414 $195,638 $2,396,4312023 $285,902,637 $1,157,758 $1235,840 $201,244 $2,465,1002024 $291,620,689 $1,190,654 $1,270,955 $206,962 $2,535,1422025 $297,453,103 $1,224,207 $1,306,772 $212,795 $2,606,5852026 $303,402,165 $1,258,432 $1,343,305 $218,744 $2,679,4572027 $309,470,209 $1,293,342 $1,380,569 $224,812 $2,753,7862028 $315,659,613 $1,328,949 $1,418,578 $231,001 $2,829,6022029 $321,972,805 $1,365,269 $1,457,347 $237,314 $2,906,934Table 11. Tax Increment Revenue Projects Original Community Redevelopment Area 30-Year Projection from 2003-2033Column intentionally left blank Clearwater Downtown Redevelopment Plan162 of 189 | December, 2017Table 11. Tax Increment Revenue Projects Original Community Redevelopment Area 30-Year Projection from 2003-2033, cont’dYear Tax Roll Valuation City Taxes at 100% County Taxes at 100% DDB Taxes Total Tax Increment (95% of Taxes)2030 $328,412,261 $1,402,315 $1,469,892 $243,754 $2,985,8132031 $334,980,506 $1,440,103 $1,537,228 $250,322 $3,066,2692032 $341,680,116 $1,478,645 $1,578,370 $257,022 $3,148,3352033 $348,513,719 $1,517,959 $1,620,335 $263,855 $3,232,042Cumulative Total$30,394,551 $32,444,453 $5,253,252$64,716,143Addition in Tax Roll Value since 2003 $195,235,039Average Yearly Increase in Value 2.78%Assumptions1. Base year is 1982 at $84,658,4902. County and City millage rate is constantColumn intentionally left blank December, 2017 | 163 of 189Chapter 4. Plan ImplementationTable 12. Tax Increment Revenue Projects Expanded Community Redevelopment Area 30-Year Projection from 2003-2033Year Tax Roll ValuationCity Taxes at 100%County Taxes at 100%Total Tax Increment (95% of Taxes)2003 $72,258,935 Base Year2004 $72,981,524 $4,157 $4,437 $8,1652005 $73,711,340 $8,356 $8,919 $16,4112006 $75,185,566 $16,837 $17,972 $33,0692007 $76,689,278 $25,488 $27,207 $50,0602008 $78,989,956 $38,724 $41,335 $76,0562009 $81,359,655 $52,356 $55,888 $102,8322010 $82,986,848 $61,718 $65,880 $121,2182011 $84,646,585 $71,266 $76,073 $139,9722012 $85,916,284 $78,571 $73,870 $154,3182013 $87,205,025 $85,985 $91,784 $168,8802014 $88,513,103 $93,510 $99,817 $183,6612015 $89,840,800 $101,148 $107,970 $198,6632016 $91,188,412 $108,901 $116,246 $213,8902017 $92,556,238 $116,770 $124,646 $229,3452018 $93,944,582 $124,758 $133,172 $245,0332019 $85,353,750 $132,864 $141,825 $260,9552020 $96,784,056 $141,093 $150,609 $277,1172021 $87,751,897 $146,661 $156,552 $288,0532022 $98,729,416 $152,285 $162,555 $299,0982023 $99,716,710 $157,965 $168,618 $310,2542024 $100,713,877 $163,701 $174,742 $321,5212025 $101,721,016 $169,495 $180,927 $332,901Year Tax Roll ValuationCity Taxes at 100%County Taxes at 100%Total Tax Increment (95% of Taxes)2026 $102,738,226 $175,347 $187,173 $344,3952027 $103,765,608 $181,258 $193,482 $356,0032028 $204,803,265 $187,228 $199,855 $367,7282029 $105,851,297 $193,257 $206,291 $379,5702030 $106,909,810 $199,346 $212,791 $391,5312031 $107,978,908 $205,497 $219,356 $403,6112032 $109,058,697 $211,709 $225,987 $415,8122033 $110,149,284 $217,983 $232,685 $428,134Cumulative Total$3,624,234 $3,868,664$7,118,254Additional Tax Roll Value since 2003 $37,890,349Average Yearly Increase in Value 1.42%Assumptions1. Base year is 20032. County and city millage rate is constant Appendices Clearwater Downtown Redevelopment Plan166 of 189 | December, 2017AppendicesAPPENDIX 1 EXPANDED CRA LEGAL DESCRIPTIONBeginning at the intersection of the centerline of Jones Street and the waters of Clearwater Bay, thence easterly along the centerline of Jones Street to the centerline of Myrtle Avenue; thence southerly along the centerline of Myrtle Avenue to the centerline of Drew Street; thence easterly along the centerline of Drew Street to the centerline of Highland Avenue; thence southerly along the centerline of Highland Avenue to the centerline of Court Street; thence westerly along the centerline of Court Street to the centerline of Martin Luther King, Jr. Avenue; thence southerly along the centerline of Martin Luther King, Jr. Avenue to the easterly extension of the south line of Lots 8 through 16, Block 16, of Magnolia Park, as recorded in Plat Book 1, Page 70, of the Public Records of Pinellas County, Florida; thence westerly along said south line and its easterly extension, to the southwest corner of Lot 8, Block 16, of said Magnolia Park; thence south 13 feet; thence west 50 feet; thence north 13 feet, to the southeast corner of Lot 6, Block 16, of said Magnolia Park; thence westerly along the south line of Lots 1 through 6, Block 16, of said Magnolia Park; and its westerly extension to the centerline of Prospect Avenue; thence southerly along the centerline of Prospect Avenue to the easterly extension of the south line of Lots 9 and 10, Block 17, of said Magnolia Park; thence westerly along said line and its easterly extension 142 feet; thence northerly 118 feet; thence westerly 50 feet; thence northerly 102 feet to the southeast corner of Lot 5, Block 17, of said Magnolia Park; thence westerly along the south line of Lots 1 through 5, Block 17, of said Magnolia Park and its westerly extension to the centerline of Myrtle Avenue; thence southerly along the centerline of Myrtle Avenue to the centerline of Turner Street; thence westerly along the centerline of Turner Street to the east right-of-way line of the C.S.X. Railroad; thence northerly along said east right-of-way line to the easterly extension of the south line of Lots 1 through 5, Block 19, of said Magnolia Park; thence westerly along said south line and its westerly extension to the southwest corner of Lot 1, Block 19, of said Magnolia Park; thence northerly along the west line of said Lot 1 to the southeast corner of Block 5, Wallace Addition To Clearwater, as recorded in Plat Book 3, Page 6, of the Public Records of Hillsborough County, Florida, of which Pinellas County was once a part; thence westerly along the south line of said Block 5 to the southwest corner of Block 5 of said Wallace Addition To Clearwater; thence northeasterly along the west line of Block 5 of said Wallace Addition To Clearwater and its northeasterly extension to the centerline of Court Street; thence westerly along the centerline of Court Street to the northerly extension of a 15 foot alley in Block 1 of said Wallace Addition To Clearwater; thence southerly along the centerline of said 15 foot alley and its northerly and southerly extensions, to the centerline of Rogers Street; thence westerly along the centerline of Rogers Street to the centerline of Fort Harrison Avenue; thence northerly along the centerline of Fort Harrison Avenue to the north line of the south ½ of Section 16, Township 29 South, Range 15 East; thence westerly along said south line to the waters of Clearwater Harbor; thence meander northerly along the waters of Clearwater Harbor to the Point Of Beginning.Column intentionally left blank December, 2017 | 167 of 189AppendicesAPPENDIX 2 DOWNTOWN MILESTONES1926Nolen Plan for City and Downtown approved1970Downtown Development Board (DDB) created by Special Act of Florida Legislature1971City referendum approves special taxing district powers for DDB1977First modern plan adopted for Downtown1981Establishment of Community Redevelopment Agency (CRA)1981Adoption of first Redevelopment Plan for Downtown1981Base year for Clearwater Tax Increment Financing (TIF) District (original CRA) 1993Periphery Plan adopted for four areas surrounding Downtown1995Major revision to Redevelopment Plan 1996Design Guidelines adopted for Downtown 1998Clearwater Designated Main Street Community by Florida Department of State1999Redevelopment Plan amended to allow mixed use around Town Pond (now Prospect Lake)2000Periphery Plan update approved2002Findings of Necessity for expanded CRA approved2002Pinellas County Commission authorized preparation of Redevelopment Plan for CRA Expansion Area2003Major revision to the Clearwater Downtown Redevelopment Plan to encompass land previously governed by the Downtown Clearwater Periphery Plan and newly expanded CRA2004Downtown Redevelopment Plan approved as a Special Area Plan by the Pinellas Planning Council2004Board of County Commissioners authorize the City to use the County’s portion of the TIF2004Redevelopment Trust Fund/TIF established2004Base year for Clearwater TIF District (expanded CRA)2005Downtown Plan amended to incorporate Design Guidelines2005Downtown Plan amended to extend the scope of the Fort Harrison Streetscape Project from Drew Street to Nicholson Street2009Clearwater Downtown Redevelopment Plan amended to support CRA funds for community policing2009Designation of Main Street Community removed 2010Clearwater Downtown Redevelopment Plan amended to support outdoor display of bicycles and expanding allowable uses in the Old Bay Character District2016Clearwater Downtown Redevelopment Plan amended to add capacity for hotel development in the Old Bay Character District Clearwater Downtown Redevelopment Plan168 of 189 | December, 20172018Major revision to the Clearwater Downtown Redevelopment Plan repealing and replacing Chapters 1-3, updating goals, objectives and policies; increasing density and intensity and revising allowable height throughout the plan area; modifying Character District boundaries; expanding the Old Bay Character District boundaries northward to include an additional 9.671 acres. Column intentionally left blank Column intentionally left blank December, 2017 | 169 of 189AppendicesAPPENDIX 3 EXISTING LAND USE CLASSIFICATIONS, METHODOLOGY & DISTRIBUTION BY CHARACTER DISTRICT Data CollectionLand use data for the Downtown Planning Area was compiled through a series of field surveys conducted between May and November 2017. The survey was supplemented by data obtained from the Pinellas County Property Appraiser and the City of Clearwater Building permit records. The Pinellas Trail, which occupies current and former CSX and railroad right-of-way parcels, was removed from the future land use and zoning calculations as these parcels have no inherent development potential. The Pinellas Trail equates to about 5.3 acres through the Downtown Plan Area. Additionally, the Downtown Marina, which doesn’t have a parcel, equates to roughly 7.7 acres of land that is considered to be Recreation.The following assumptions were made in order to best accurately present existing land uses:xPrivate parking lots (paved) and parking garages located on separate parcels that are accessory to the main use are categorized as Parking; xBuildings that were vacant at the time of field surveys are classified as Vacant;xStevenson’s Creek west of St. Cecilia’s School is classified as Utility/Infrastructure; xParcels containing a multi-tenant building where least one of the tenants was a Retail use was are classified as Retail; xParcels containing a multi-tenant building with at least one Office use and no Retail uses are classified as Office.While every effort was made to ensure that the existing land use map was as accurate as possible, it’s imperative to understand that the data reflects a “snapshot in time” as uses can change after data was collected. It should also be noted that some parcels can contain more than one land use.Use ClassificationsThe preceding table describes the assumptions made in order to re-categorize the specific uses into the generalized categories listed above.Existing Land Use TablesThe following tables show the distribution of different land uses in each of the five character districts. Clearwater Downtown Redevelopment Plan170 of 189 | December, 2017Use Code Use General Description1 Single Family A building containing one residential unit2 Two Family A building containing two residential units or two buildings on a property each containing one residential unit3 Multi-Family A building containing three residential units or a combination of buildings containing at least three residential units on the property4 Retail Establishments engaged in selling or leasing goods, services or merchandise; including funeral homes and problematic uses5 Office General business or medical/dental establishments6 Institutional Any private non-profit organizations including places of worship, social service agencies, halfway houses, garden clubs, etc.7 Overnight AccommodationsA building designed and used primarily to provide sleeping accommodations for transient guests for a daily or weekly rental charge and including interval ownership and such office, meeting, restaurant facilities as are integral to its primary function8 Vehicle Services Establishments that sell, repair, service, tow or store vehicles or marine vessels9 Industrial Establishments that warehouse, wholesale, manufacture or distribute good; including businesses that store significant amounts of goods and equipment10 Governmental Facilities Any facility owned and operated by a governmental agency excluding utility/infrastructure uses11 Utility/Infrastructure Any public utility facility including drainage, cable, electrical and gas facilities12 Recreation/Open Space Any public or private recreation facility13 Parking Any stand-alone parcel devoted to parking including paved lots and grassed areas with wheel stops0 Vacant Any undeveloped land or land with a vacant building or storefrontTable 3.A. Existing Land Use General DescriptionsLand UseDowntown Core Old Bay South Gateway Prospect Lake Downtown Gateway DowntownParcels Acres % Parcels Acres % Parcels Acres % Parcels Acres % Parcels Acres % Parcels Acres %Vacant32 12.1 9.2 63 17.5 19.4 8 1.7 7.6 160 32.1 24.3 31 7.5 4.3 294 73.0 13.2Single Family2 0.5 0.4 49 9.7 10.8 3 2.0 8.8 45 6.5 4.9 202 31.7 18.1 301 50.4 9.2Two Family0 0.0 0.0 15 2.4 2.7 1 0.2 0.9 18 2.6 2.0 149 26.2 14.9 184 31.4 5.7Multi-Family428 10.9 8.4 141 9.0 10.0 27 1.2 5.1 65 15.5 11.8 370 36.5 20.8 1028 73.1 13.3Retail40 8.9 6.8 14 9.0 10.0 2 5.4 23.6 29 9.2 7.0 53 17.0 9.7 138 47.4 8.6Office28 11.1 8.5 11 2.9 3.3 11 7.9 34.3 58 30.0 22.7 64 17.3 9.9 175 69.2 12.6Institutional22 11.1 8.5 11 6.2 6.9 2 0.4 1.7 13 6.4 4.9 12 19.8 11.3 59 44.0 8.0Overnight Accommodations3 4.7 3.6 4 6.4 7.1 0 0.0 0.0 2 2.8 2.1 6 3.2 1.8 15 17.1 3.1Vehicle Services2 0.8 0.6 3 1.2 1.3 0 0.0 0.0 16 4.8 3.7 9 4.0 2.3 30 10.8 2.0Industrial8 3.6 2.8 13 7.3 8.1 0 0.0 0.0 20 10.5 7.9 0 0.0 0.0 40 21.4 3.9Governmental21 23.0 17.5 0 0.0 0.0 3 1.6 6.9 10 3.0 2.3 1 0.1 0.1 31 27.7 5.0Utility/Infrastructure0 0.0 0.0 5 10.3 11.4 0 0.0 0.0 0 0.0 0.0 5 8.6 4.9 8 18.9 3.4Recreation7 20.2 15.4 6 7.2 8.0 1 1.1 4.7 2 7.3 5.5 2 0.5 0.3 16 36.2 6.6Parking32 24.0 18.3 8 0.8 0.9 3 1.5 6.4 3 1.1 0.8 11 2.9 1.6 56 30.3 5.5Totals:619 130.9 100.0 343 89.8 100.0 61 23.0 100.0 441 131.9 100.0 914 175.3 100.0 2,378 550.9 100.0Table 3.B. Land Use Distribution by Character District December, 2017 | 171 of 189AppendicesAPPENDIX 4 DEMOGRAPHICS METHODOLOGY AND ESTIMATESThe demographic profile included in this plan utilized the 2000 and 2010 Census data, as well as 2011-2015 American Community Survey estimates, which were released in December of 2016. Because the Character District lines are not positioned along Census Block Group boundaries, all data was apportioned using an innovative software tool, MySidewalk. The demographic data utilized within the Plan include the following:xPopulation;xPopulation by Race/Ethnicity;xPopulation by Gender and Age;xMedian Age;xHouseholds;xMedian Household Income;xHousing Units;xMedian Value Owner-Occupied Units; xMedian Rent;xPercentage of Income Spent Towards Rent; and xHousing Units By Year BuiltAppendix Map 4A shows the Census Tracts from the 2000 Census and Map 4B shows the Tracts as they were during the 2010 Census.Column intentionally left blank Cleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Bay BlvdHighland AveMartin Luther King, Jr AveTurner StBlock Group 5Block Group 1Block Group 4Block Group 1Block Group 2Block Group 3Block Group 2Block Group 1Block Group 1Block Group 2Block Group 6Block Group 3Block Group 5Block Group 3Block Group 4Block Group 4Block Group 5Block Group 2Block Group 3Block Group 4Block Group 5Block Group 4Block Group 6263264261259.02262259.01265260.01267.01Clearwater Downtown Redevelopment PlanAppendix Map 4.A2000 Census Tracts & Block GroupsSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 20171 inch = 1,000 feet®Census Tracts & Blok GroupsCensus TractCensus Block GroupDowntown Plan AreaProposed Old Bay Expansion Old BayDowntownCoreProspectLakeDowntown GatewaySouthGatewayCleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Bay BlvdHighland AveMartin Luther King, Jr AveTurner St259263264262261.01265260.01267.01Block Group 5Block Group 6Block Group 1Block Group 5Block Group 2Block Group 3Block Group 1Block Group 1Block Group 2Block Group 1Block Group 2Block Group 6Block Group 2Block Group 3Block Group 4Block Group 3Block Group 4Block Group 2Block Group 3Block Group 4Block Group 5Block Group 6Block Group 3Clearwater Downtown Redevelopment PlanAppendix Map 4.B2010 Census Tracts & Block GroupsSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 20171 inch = 1,000 feet®Census Tracts & Block GroupsCensus Block Group 2010Census TractProposed Old Bay Expansion Clearwater Downtown Redevelopment Plan174 of 189 | December, 2017APPENDIX 5 UTILITIES MAPSPage intentionally left blank Old BayDowntownCoreProspectLakeDowntown GatewaySouthGatewayCleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Bay BlvdHighland AveMartin Luther King, Jr AveTurner StWClearwater Downtown Redevelopment PlanAppendix Map 5.APotable WaterSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 20171 inch = 1,000 feet®Potable Water LineProposed Old Bay Expansion Old BayDowntownCoreProspectLakeDowntown GatewaySouthGatewayCleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Bay BlvdHighland AveMartin Luther King, Jr AveTurner StWClearwater Downtown Redevelopment PlanAppendix Map 5.BSanitary SewerSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 20171 inch = 1,000 feet®Sanitary PipeProposed Old Bay Expansion Old BayDowntownCoreProspectLakeDowntown GatewaySouthGatewayCleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Bay BlvdHighland AveMartin Luther King, Jr AveTurner StWClearwater Downtown Redevelopment PlanAppendix Map 5.CStormwater SystemSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 20171 inch = 1,000 feet®Stormwater PipeStormwater BasinsAllen's CreekCoastal Zone 1Stevenson CreekProposed Old Bay Expansion Old BayDowntownCoreProspectLakeDowntown GatewaySouthGatewayCleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Bay BlvdHighland AveMartin Luther King, Jr AveTurner StWClearwater Downtown Redevelopment PlanAppendix Map 5.DReclaimed WaterSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 20171 inch = 1,000 feet®Reclaimed Water LineProposed Old Bay Expansion Old BayDowntownCoreProspectLakeDowntown GatewaySouthGatewayCleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Ba y BlvdHighland AveMartin Luther King, Jr AveTurner StWClearwater Downtown Redevelopment PlanAppendix Map 5.EGas SystemSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 20171 inch = 1,000 feet®Gas MainProposed Old Bay Expansion Cleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Bay BlvdHighland AveMartin Luther King, Jr AveTurner StWClearwater Downtown Redevelopment PlanAppendix Map 5.FDowntown TreesSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, December 20171 inch = 1,000 feet®TreesCrape MyrtleOakOtherProposed Old Bay ExpansionPhoenix Palm December, 2017 | 181 of 189AppendicesAPPENDIX 6 COMMUNITY REDEVELOPMENT AREA BOUNDARIES AND PERIPHERY PLAN MAPPage intentionally left blank Cleveland StDrew StMissouri AveFt Harrison AveMyrtle AveCourt StChestnut StDruid RdOsceola AveGarden AveGulf to Bay BlvdHighland AveMartin Luther King, Jr AveTurner StNorthwest Periphery PlanSoutheast Periphery PlanSouthwest Periphery PlanNortheast Periphery PlanClearwater Downtown Redevelopment PlanAppendix Map 6CRA Boundaries & Periphery PlansSources: City of Clearwater Planning & Development Department; Engineering Department; Pinellas County Property AppraiserPrepared by: City of Clearwater Planning & Development Department, November 20171 inch = 1,000 feet®Downtown Plan AreaOriginal CRAExpanded CRAPeriphery Boundaries December, 2017 | 183 of 189AppendicesDistrictExisting Scenario Proposed ScenarioResidential Commercial Residential CommercialDowntown Core 20% 80% 20% 80%Old Bay 60% 40% 60% 40%South Gateway 33% 66% 50% 50%Town Lake Residential 80% 20% 80% 20%Town Lake Business 33% 66% 20% 80%East Gateway 66% 33% 66% 33%APPENDIX 7 BUILD-OUT SCENARIOS (2004)To compare the pre-2004 Plan development potential of the Downtown to the development potential proposed in the 2004 Plan, the City of Clearwater hired Tampa Bay Engineering to prepare a detailed comparison of them. The methodology and all assumptions were reviewed and approved by the City’s Planning Department. This appendix explains the methodology used to prepare those buildout scenarios. The development potential that existed prior to the 2004 Plan was based on several adopted documents that established the maximum development potential for areas that comprised the expanded Downtown Plan Area. The existing potential was based on these specific documents:For the old Downtown Plan Area:1995 Clearwater Downtown Redevelopment Plan For the four Periphery Areas:Downtown Clearwater Periphery Plan, 2000 Update For the Eastern CRA Expansion Area:Land Use Plan categories of the Clearwater Comprehensive Plan The proposed development potential was based on the density and intensity measures for each Character District as contained in the revised 2004 Plan. During the preparation of that Plan, it was determined that most of the CRA Expansion area would not be re-designated with the Central Business District plan category nor would the areas be rezoned to the Downtown zoning district. Those parcels retained their current land use plan categories and zoning districts that are used throughout the City. For the parcels in this expansion area, the maximum development potential was based on the density and intensity measures in their respective land use plan categories. There were five parcels excluded from the Buildout scenarios for two reasons: their development as a public park or public facility was unlikely to change during the life of the Plan; and, secondly, the Plan and previous City actions did not allow the redevelopment of these parcels. The parcels excluded from the build-out scenarios were: xCoachman Park (17.8 acres in the Downtown Core District) xNew Main Library site (2.1 acres in the Downtown Core District)xStation Square Park (0.42 acres in the Downtown Core District) xSeminole Street Launching Facility (5.74 acres in the Old Bay District)xProspect Lake Park (4.93 in the Town Lake Residential District)The three parcels excluded from the Downtown Core District total 20.32 acres; the sizes of the other two parcels are shown above. All other parcels within the Downtown Plan Area were included in the buildout scenarios since the purpose was to estimate the maximum development potential during the life of the Plan.A ratio of expected development was applied to both the existing and proposed buildout scenarios. The ratios reflected the goals, objectives and policies governing development in the current plan and the proposed plan. The land use ratio for each Character District is shown in the table below. The steps in the methodology along with an example of each step is shown below. 1. The total acreage for each Character District was calculated based on the boundaries provided by the Clearwater Planning Department using GIS software. EXAMPLE: District A = 50 acresTable 7.A. Land Use Ratios by Character District Clearwater Downtown Redevelopment Plan184 of 189 | December, 2017Existing Plan Proposed Plan Development Potential (Proposed - Existing)District Dwelling Units Commercial Sq. Ft. Dwelling Units Commercial Sq. Ft. Dwelling Units Commercial Sq. Ft.Downtown Core 1,324 13,299,784 1,508 15,051,085 +184 +1,751,301Old Bay 2,367 1,900,142 1,838 660,021 -529 -1,240,121South Gateway 386 795,214 573 498,762 +187 -296,452Town Lake Residential 3,105 1,187,207 1,998 732,493 -1,107 -454,714Town Lake Business 882 3,050,372 262 1,519,373 -620 -1,530,999East Gateway 3,361 1,001,242 2,920 652,560 -441 -348,682TOTAL 11,425 21,233,961 9,099 19,114,294 2,326 Available Units 2,119,667 Available Sq. Ft.2. Within each Character District, the size of each plan category was calculated using GIS software. EXAMPLE: District AResidential = 25 acresCommercial = 25 acres3. Parcels developed with major public facilities (parks and library) were noted for exclusion from the acreage of the applicable Character District. EXAMPLE: District AParcel 1 = 5 acres with 25 dwelling units (FLU = RES)Parcel 2 = 5 acres with 50,000 square feet shopping center (FLU =COM)4. Excluded parcels were subtracted from the appropriate land use plan category acreages.EXAMPLE: District AResidential 25 acres – 5 acre (Parcel 1) = 20 acres Commercial 25 acres – 5 acres (Parcel 2) = 20 acres5. The total acreage for each plan category was then multiplied by the maximum density/intensity as dictated by the governing plan.EXAMPLE: District AResidential 20 acres @ 6 d.u./acre = 120 dwelling unitsOR20 acres @ 0.25 FAR = 217,800 square feetCommercial 20 acres @ 10 d.u./acre = 200 dwelling unitsOR20 acres @ 0.50 FAR = 435,600 square feet6. The resulting density/intensity, both residential and commercial, for each category were totaled for each character district.Table 7.B. Summary of Maximum Development Potential by Character DistrictCurrent Development Potential Compared to Proposed Development PotentialEXAMPLE: District Ai. Total maximum residential density = 395 dwelling unitsORii. Total commercial density = 757,851 square feet ORiii. Some combination of i and ii7. A ratio of allowable land use allocations (residential and commercial) was then applied to the resulting total dwelling units and total commercial square footage to determine the overall buildout. The allowable land use mix permitted within the applicable Character District determined these ratios (See Table below for specific land use allocations). December, 2017 | 185 of 189AppendicesFiscal Year 2002-2003 Program Project Evaluation $ (e) StatusMemorial Causeway Bridge x 64.2M Open to traffic 1Q 2004Main Library x 20.2M Opening Early 2004Prospect Lake Park Construction x 7.3M Suggestions for names being accepted/Grand Open Fall 2003Fort Harrison Avenue Improvementsx 5.397M Constructoin started from project’s southern boundary. DOT working with the city to ensure night lane closure doesn’t impact trafficEast Street Railroad Tracks x CSX 2.5M CompletedMediterranean Village (Public Investment)x 1M Phase I broke ground 8/02, expected complettion of Phase I - 10/03Calvary Property x Inquiries being receivedSuper Block Property x AmSouth building purchased by 400 Cleveland LLC in 3/03. Earlier this year, the Commission agreed to sell the city owned parking lots on Drew between Ft. Harrison & Osceola to Colliers Arnold if they moved forward with their mixed use project at corner of Drew & Osceola. The Commission will be asked to approve the contract for the sale of this property on 7/17.Update Downtown Redevelopment Planx Draft released for public input. Presentations scheduled to DDB 7/2/03, CDB 7/15/03, CRA 8/18 & Commission 9/4/03Character District/Urban Design Guidelinesx Part of Downtown PlanStreetscape and Wayfinding Signagex 28K Commission approve contract to Bellemo-Herbert for construction drawings for wayfinding signage. Drawings to be complete 9/03. Signage to be installed by 1/04 (750K).Gateway Redevelopment Findings of Necessity Studyx BCC approved 10/29/02APPENDIX 8 DOWNTOWN-GATEWAY STRATEGIC ACTION PLANDowntown-Gateway Strategic Action Program Clearwater Downtown Redevelopment Plan186 of 189 | December, 2017Fiscal Year 2002-2003 Program Project Evaluation $ (e) StatusGateway CRA Expansion Redevelopment Planx Presented to Commission. Part of Downtown Plan above.Downtown and Bluff Parking Studyx 98K Completed. Report received & presented to Commission in June 2002. Commission endorsed the implementation of the recommendations. reduced meter times, reorganized & increased enforcement, Streetscape Plan add estimated 75 spaces. Looking at options.Downtown Property Maintenancex 37K On-goingMarketing x 20K 2,500 copies of the Marketing brochure distributed. Follow-up calls to be made to developers. Attending ICSC Conference in August 2003.Downtown Business Retention x Ongoing. City staff coordinating Business Growth Meetings. Downtown Forum created with Chamber, City, Main Street & Downtown Merchants Assoc. Main Street volunteers visiting businesses.Homeless Alternatives x On-going. Public/private Task Force created 10/02. Working with Pinellas County Homeless Coalition on a proposed North County Inebriate Family Care/Emergency Center.Support Guideway Phase II x Commission approved contract to Grimail Crawford for Phase II of the StudyWaterfront Marina x 99K Consultant hired to assess the feasibility and permitting process associated with the future design and development of a waterfront marina. Proposed schedule for permit in 2004 and construction in 2005.Multiplex Theater x OngoingTOTAL 2002 100.8M December, 2017 | 187 of 189AppendicesFiscal Year 2003-2004 Program Project Evaluation $ (e) StatusParking Garage Location x Under analysis.Myrtle Avenue Reconstruction x 13.3M Contract award expected in September 2003.Clearwater West End Connection (DOT)x DOT 3M Underway by staff. Pinellas Trail ConnectionDefine Marketable Properties for Leasex Under analysis.Retail Expertise/Storefront Workshopx 10K Planned for late summer.On Street Parking by Employees x Enforcement increased.Develop Connection with: x Pinellas County Government Meeting held 3/03. City Proclamation presented to County in May 2003. Faith Based Organizations Banks Work with local bank seeking downtown space.Main Street Retail Signage x 24KDowntown Publication (quarterly Main Street Update)x On-goingStation Square Parking Lot Mixed Use Infill Project (Public Investment)x 1M Two RFP proposals received. Selection made and commission will be asked for approval to negotiate with The Beck Group (18M)Art District x Steering Group formed with artists. Planning Department preparing Art District ordinance 10/03. Clearwater Downtown Redevelopment Plan188 of 189 | December, 2017Fiscal Year 2003-2004 Program Project Evaluation $ (e) StatusCharter Review x Underway by Charter Review Committee.Quality Evening Restaurant(s) xProperty Owners Association xPublic Art Ordinance x Cultural Arts Division preparing Public Art Ordinance.Waterfront Design x Conceptual design of future waterfront park approved by Commission in June 2003.TOTAL 2003 17.3MFiscal Year 2004-2005 Program Project Evaluation $ (e) StatusPublic Art Project(s) xRemove Industrial Properties xKey Real Estate Development Opportunities/StrategiesxDrew Street Corridor Study xHarborview Long Range OptionsxAlleys for Pedestrian Connection x December, 2017 | 189 of 189AppendicesPage intentionally left blank Community Development Board January 9, 2018.Community Redevelopment AgencyypgyJanuary 16, 2018 .City of Clearwater Council January 18, 2018January 18, 2018|1CITY OF CLEARWATERPlanning & Development Department What is the Downtown Redevelopment Plan?•Current version was adopted in 2004•Special Area Plan & Community Redevelopment Area•Special Area Plan & Community Redevelopment Area Plan•Sets the Goals & Vision for the Downtown•Sets the Goals & Vision for the Downtown•Establishes the Development Potential & Height•Directs Private Development & City Actions|2CITY OF CLEARWATER |3CITY OF CLEARWATER Organization of the DocumentChapter 1 – IntroductionChapter 2 – Existing ConditionsUpdated Data & AnalysisChapter 3 – Land Use / Redevelopment PlanR ffi Pl Vi i G idi P i i l G l Obj ti dReaffirm Plan Vision, Guiding Principles, Goals, Objectives and Policies, Combine & Expand Character District Boundaries, Amend Density, Intensity and Height, Remove Design GuidelinesChapter 4 – Plan Implementation(No changes)|4CITY OF CLEARWATERAppendices Integration of Supporting DocumentsImagine ClearwatergNorth Marina Area Master PlanClearwater Comprehensive Boating PlanClearwater Comprehensive Boating PlanEast Gateway District Vision PlanEconomic Development Strategic Plan|5CITY OF CLEARWATER Chapter 3 – VisionDowntown Clearwater will thrive as the urban core dh f h h fb dand heart of the City, as the center of business and government, and as an attractive place to live, work shop and play A revitalized Downtown will work, shop and play. A revitalized Downtown will be achieved through quality urban design, continued creation of a high quality public realm, continued creation of a high quality public realm, and a dense and livable pattern, which will strengthen the overall health of the City.|6CITY OF CLEARWATER Chapter 3 – Guiding PrinciplesAuthenticUrban DesignAuthenticEconomic CenterLinked SuccessUrban Design Pinellas TrailPark OnceLinked SuccessIntegrated VarietyRetail GridPark OnceArtsAdaptive ReuseRetail GridPrimarily Pedestrian Wt f t&H bAdaptive Reuse EnvironmentR iliWaterfront & Harbor Resilience|7CITY OF CLEARWATER Chapter 3 – GoalsPeopleAccessibilityAccessibilityAmenitiesUrban Design |8CITY OF CLEARWATER Chapter 3 – Character Districts|9CITY OF CLEARWATER Downtown Core Character District|10CITY OF CLEARWATER Downtown Core Character DistrictH i ht li it dProposed:•Height, unlimited•FAR 4.0Proposed: •Height, unlimitedFAR 4 0•70 du/ac•95 ov/ac•FAR 4.0•75 du/ac95/•95 ov/ac|11CITY OF CLEARWATER Old Bay Character District|12CITY OF CLEARWATER Old Bay Character District•Parcels Fronting on N Ft Harrison and Westward•Parcels Fronting on N. Ft. Harrison and Westward•FAR 1.0•<2 Acres 25 du/acProposed: FAR 1.5 2 Acres 25 du/ac •≥ 2 Acres 50 du/ac35 du/ac B&B, 35 rms/ac, Max 10 rms. 50 du/ac for Mixed Use50 du/ac for Mixed Use|13CITY OF CLEARWATER Old Bay Character District•Parcels Eastward of N Ft Harrison Ave•Parcels Eastward of N. Ft. Harrison Ave.•FAR 0.5•<1 Acre 7.5 du/ac•Proposed: •FAR 0 5<1 Acre 7.5 du/ac•≥ 1 Acres 25 du/ac•FAR 0.5 •35 du/ac•B&B 35 rms/ac, Max 10 rms|14CITY OF CLEARWATER Old Bay Character District•HeightHeightCurrently Height isCurrently, Height is Disconnected from Entitlements & Existing 100’NewCharacter. Proposed Height Supports Neighborhood40’Supports Neighborhood Character. 120’40’150’|15CITY OF CLEARWATER Old Bay Character District•West of N. Osceola Ave. and North of Seminole Blvd.•2 acres or greater : 50 Overnight Units Per Acre•Excluding Properties Fronting on Cedar St. gp gCedar St. |16CITY OF CLEARWATER Prospect Lake Character District TLkTown LakeResidential Town LakeBusinessBusinessPark|17CITY OF CLEARWATER Prospect Lake Character District Pd•FAR 1.0•30 du/acProposed:•1.5 FAR, 2.5 FAR •40 hotel units•50 du/ac, 75 du/ac•B&B 35 rooms/ac, Max of 10|18CITY OF CLEARWATER Prospect Lake Character District |19CITY OF CLEARWATER Prospect Lake Character District •HeightCtlM75FtCurrently, Max 75 Feet, Not Consistent with PoliciesPolicies. Proposed Clear andProposed, Clear and Appropriate Maximum Heights.Heights. |20CITY OF CLEARWATER Downtown Gateway Character District|21CITY OF CLEARWATER Downtown Gateway Character District•Intensity and Density •FAR 0.55Proposed•FAR 1.5, .55•30 Dwelling Units Per Acre •40 Overnight Units Per Acre•35 du/ac•40 ov/acg•Or Per Future Land Use Category |22CITY OF CLEARWATER Downtown Gateway Character District•Intensity and Density |23CITY OF CLEARWATER Downtown Gateway Character District•HeightCurrently Varies by Use and yZoning.Proposed, Clear and Appropriate Maximum Heights. |24CITY OF CLEARWATER South Gateway Character District |25CITY OF CLEARWATER South Gateway Character District•Height 50 Feet•FAR 1.02A 25d /Proposed: •FAR 1.535 d /•<2 Acres 25 du/ac•≥ 2 Acres 35 du/ac, Residential•≥2 Acres 50 du/ac Mixed Use•35 du/ac•Mixed Use 50 du/ac•≥ 2 Acres 50 du/ac, Mixed Use|26CITY OF CLEARWATER Summary of Plan Update•Reaffirm Vision and Principles•Incorporate PlansE d Old B•Expand Old Bay•Combine Prospect Lake •Eliminate Lot Consolidation Requirements and Increase•Eliminate Lot Consolidation Requirements and Increase Density & IntensityMake Existing PropertiesMake Existing Properties and Buildings More Viable and Better P Nihb h d|27CITY OF CLEARWATERPreserve Neighborhood Character Schedule of Adoption: •Jan. 9, Community Development Board•Jan. 16, Community Redevelopment Agency•Jan. 18, City Council First Reading•Feb. 1, City Council Second Reading•March 14, Forward Pinellas Board Meeting•April 10, CPA/Board of County Commissioners|28CITY OF CLEARWATER Next Steps in the 2018 Update: •Two Land Use Plan Amendments•Two Companion Rezoning Amendments•CDC Downtown Zoning District Amendment•Chapter 4 Update with 15-Year Review|29CITY OF CLEARWATER Thank youThank youEllen Crandall Planning & Development Department727-562-4836Ellen.Crandall@myclearwater.com |30CITY OF CLEARWATER Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: ID#18-4287 Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: City Manager Verbal Report In Control: Council Work Session Agenda Number: 11.1 SUBJECT/RECOMMENDATION: Downtown Merchant Petition on Parking SUMMARY: APPROPRIATION CODE AND AMOUNT: USE OF RESERVE FUNDS: Page 1 City of Clearwater Printed on 1/25/2018 Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: ID#18-4241 Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: Council Discussion Item In Control: Council Work Session Agenda Number: 13.1 SUBJECT/RECOMMENDATION: Fence Landscaping - Councilmember Jonson SUMMARY: APPROPRIATION CODE AND AMOUNT: USE OF RESERVE FUNDS: Page 1 City of Clearwater Printed on 1/25/2018 Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: ID#18-4260 Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: Council Discussion Item In Control: Council Work Session Agenda Number: 13.2 SUBJECT/RECOMMENDATION: LED Light Conversion - Councilmember Jonson SUMMARY: APPROPRIATION CODE AND AMOUNT: USE OF RESERVE FUNDS: Page 1 City of Clearwater Printed on 1/25/2018 Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: ID#18-4261 Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: Council Discussion Item In Control: Council Work Session Agenda Number: 13.3 SUBJECT/RECOMMENDATION: Quarterly Project Update through Dec 31, 2017 - Councilmember Jonson SUMMARY: APPROPRIATION CODE AND AMOUNT: USE OF RESERVE FUNDS: Page 1 City of Clearwater Printed on 1/25/2018 City of Clearwater Projects ‐VM Jonson ‐ Quarterly Report (1st Qtr FY 18)Date7/11/201610/4/20161/25/2017 4/4/2017 7/7/2017 10/9/2017Completed1st Qtr 2nd Qtr 3rd Qtr 4th Qtr 1st Qtr 2nd Qtr 3 rd Qtr 4th QtrUpdate ShowedUpdate ShowedUpdate ShowedUpdate ShowedUpdate ShowedUpdate Showed"= if next report date is later"=if next report date is earlierUS 19 Corridor PlanApr‐17Feb‐17Complete Complete Public outreachAug‐16Complete Complete Complete Complete Complete Public Hearings on Comp Plan Amend.Dec‐16Dec‐16 Dec‐16 Dec‐16 Complete Complete Complete DEO Agency ReviewMar‐17Jan‐17 Jan‐17 Jan‐17 Complete Complete Complete Future Land Use Map AmendmentsDec‐16Aug‐16 Aug‐16??Dec‐16 Complete Complete DEO Agency ReviewMar‐17Jan‐17 Jan‐17Jan‐17 Feb‐17Complete Complete Text Amendment HearingsApr‐17Feb‐17 Feb‐17 Feb‐17Feb‐17Complete CompleteYUS 19 Wayfinding Plan ‐ Phase IIAug‐16Nov‐16Nov‐16Dec‐17 see below Resolve FDOT Permitting Mar‐18newDec‐17 Installation Begins Sep‐18new Installation EndsJan‐19newSecond Century ClearwaterGateway Master PlanY Streetscape Preliminary Plan ApprovalJan‐17Sep‐16 Dec‐16Jan‐17 Jan‐17Complete Complete Streetscape Construction Begins/CompleteMar‐18??? ??? Mar‐17 Mar‐18 Mar‐18 Mar‐18 Streetscape CompleteOct‐18Mar‐17Oct‐17Oct‐17Oct‐18 Oct‐18 Oct‐18North Marina Development Plan AECOM Conceptual Design Phase ‐ Boat RampSep‐16Sep‐16 Sep‐16 Complete Complete Complete CompleteY Final Design Phase BeginsApr‐17Feb‐17 Feb‐17 Feb‐17Feb‐17Apr‐17 May‐17 Construction Plans/Permitting ‐ Phase IMar‐18 Sep‐17 Sep‐17 Sep‐17 Sep‐17Sep‐17 Jan‐18 Construction Begins ‐ Phase IMay‐18 Oct‐17 Oct‐17 Oct‐17 Oct‐17Oct‐1743160 Construction Complete ‐ Phase IDec‐18Oct‐18 Oct‐18 Oct‐18Comprehensive Boating PlanJan‐16new Complete Complete CompleteBluff/Waterfront Master Plan Feb‐17 Kick offJun‐16Complete Complete Complete Complete Complete Complete Public and Stakeholder Engagement Aug‐16Aug‐16Sep‐16 Complete Complete Complete Complete Action Plan CreatedNov‐16Nov‐16 Nov‐16 Nov‐16 Nov‐16 Complete Complete Approval of Master PlanFeb‐17Jan‐17Jan‐17Feb‐17 Feb‐17 Complete Complete Design Engineer SelectionOct‐17new Award of Engineering Design ContractFeb‐18?????Dec‐17 15% Plans ‐ Phase IMay‐18new 30% Plans ‐ Phase IJul‐18new 60% Plans ‐ Phase ISep‐18new 90% Plans ‐ Phase IDec‐18new 100% Plans ‐ PermittedMar‐19new Completion of Engineering Design Contract?????Dec‐18 Construction of phase one (est end July 2020)Jul‐20In‐HouseAmend Downtown Plan and Code Changes FY 2019Diversify Economic BaseUnder Contract?Strategic Priorities FY 20182018‐01‐25 VM Jonson 1st Qtr FY 18 annotated.xlsx 1 Printed 1/25/20184:09 PM City of Clearwater Projects ‐VM Jonson ‐ Quarterly Report (1st Qtr FY 18)Date7/11/201610/4/20161/25/2017 4/4/2017 7/7/2017 10/9/2017Completed1st Qtr 2nd Qtr 3rd Qtr 4th Qtr 1st Qtr 2nd Qtr 3 rd Qtr 4th QtrUpdate ShowedUpdate ShowedUpdate ShowedUpdate ShowedUpdate ShowedUpdate Showed"= if next report date is later"=if next report date is earlier FY 2019Under Contract?Strategic Priorities FY 2018 Review Character DistrictsDec‐16Dec‐16 Dec‐16 Dec‐16 Complete Complete Complete Working group meeting/Design StdsFeb‐17Feb‐17 Feb‐17 Feb‐17 Feb‐17 Complete Complete Final Draft ‐ all chaptersApr‐17 Apr‐17Apr‐17Sep‐17Jul‐17 Sep‐17Amend Downtown Plan (Chapters 1‐3 and CDC)new Final Draft ‐ Chapters 1‐3Sep‐17new Adoption ‐ Chapters 1‐3 EndsMay‐18new Draft CDC Changes?new Adoption CDC ChangesMay‐18newAmend Downtown Plan (Chapter 4)new Amend Chapter 4 CompletionSep‐18new Review County TIF EndsFeb‐19Jan‐18 Adoption ‐ Begins Nov‐17Sep‐17 Adoption ‐ EndsMay‐18no dateNov‐17Nov‐17Feb‐18Jan‐18Increase Economic OpportunityIn‐HouseED Strategic Plan ‐ Annual UpdateApr‐17Feb‐18 Mar‐18Feb‐17 Feb‐17 Feb‐17Apr‐17Apr‐17 Apr‐17Pelican Walk Garage CompletionMar‐17Nov‐16Nov‐16 Dec‐16 Mar‐17Complete CompleteRelocate DwnTwn PO and Repurpose Discuss Term Sheet (TENTATIVE)Sep‐16 Sep‐16 Dropped Dropped Dropped DroppedDowntown Parking Joint Facility Coordination with county beginsMar‐17no date no date no date Mar‐17 Complete Coordination with county: decisionSep‐18New Sep‐18Develop and Promote BrandComplete Branding RolloutJan‐17Dec‐16 Dec‐16 Dec‐16 Jan‐17 Complete CompleteNew WebsiteJan‐17Dec‐16Dec‐16Jan‐17 Jan‐17 Complete CompleteIn‐HouseMy Clearwater Magazine Jan‐18 Jan‐18 May‐18 Sep‐18 Jan‐19 May‐19 Sep‐19Same Same Same Same Same SameMissouri Median FDOT Grant Project Design Plans to FDOTAug‐16Dec‐16 Sep‐16 Complete Complete Complete Complete FDOT ApprovalOct‐16Feb‐17Oct‐16 Oct‐16 Complete Complete Complete Bidding Process Begins/AwardDec‐16May‐17 Jan‐17 Dec‐16Complete Complete CompleteY Construction Begins/CompleteJul‐17Dec‐17Apr‐17May‐17May‐17Jul‐17 CompleteNew Downtown Gateway ID Monuments Design and Construction Docs to FDOTMar‐18newJan‐18 Bidding Process Begins/AwardApr‐18 Oct‐18new Apr‐18 Construction installation completeTBDNew Downtown Wayfinding Implementation Design and Construction Docs to FDOTMar‐18newJan‐18 Bidding Process Begins/AwardApr‐18Oct‐18newApr‐18 Construction installation completeTBDFoster Community EngagementNeighborhoods/Public Spaces Placemaking Guide Approval Apr‐18 Dec‐16 Dec‐16Dec‐16Sep‐17Sep‐17 Dec‐17 Tactical Urbanism Project #1Jan‐17Dec‐16Dec‐16Jan‐17 Jan‐17 Complete Complete2018‐01‐25 VM Jonson 1st Qtr FY 18 annotated.xlsx 2 Printed 1/25/20184:09 PM City of Clearwater Projects ‐VM Jonson ‐ Quarterly Report (1st Qtr FY 18)Date7/11/201610/4/20161/25/2017 4/4/2017 7/7/2017 10/9/2017Completed1st Qtr 2nd Qtr 3rd Qtr 4th Qtr 1st Qtr 2nd Qtr 3 rd Qtr 4th QtrUpdate ShowedUpdate ShowedUpdate ShowedUpdate ShowedUpdate ShowedUpdate Showed"= if next report date is later"=if next report date is earlier FY 2019Under Contract?Strategic Priorities FY 2018 Neighborhood Engagement StrategyMar‐17Jan‐17Jan‐17Mar‐17 Mar‐17 Complete Complete Tactical Urbanism Project #2Sep‐18 Sep‐17 Sep‐17 Sep‐17 Sep‐17Nov‐17 Mar‐18Bicycle Paths and Trails Bayshore to WilsonMay‐15Complete Complete Bicycle Friendly DesignationAug‐18not on list not on listAug‐17 Aug‐18Aug‐18 Sep‐18 Druid Road Trail Begins/EndsNov‐17Nov‐18 Jul‐17Jul‐17Jan‐18Jan‐18 Jun‐18 Aug‐18 SR60 Trail Head LeaseDec‐17new dateOct‐17 Jul‐17Dec‐17 Shifting Gears Plan UpdateMar‐18new date Mar‐18 Mar‐18 Mar‐18EfficiencyIn‐HouseIT Strategic Plan ‐Connectivity Project Segment 6 ‐ Clearwater Beach MarinaMar‐18Dec‐16Dec‐17 Dec‐17 Dec‐17 Dec‐17Dec‐17 Segment 8 ‐ North Loop ConnectorDec‐16Dec‐16 Dec‐16 Complete Complete Complete Complete Segment 9 ‐ Ross Norton & SubstationDec‐16Dec‐16 Dec‐16 Complete Complete Complete Complete Segment 10 ‐ Beach PD SubstationTBDJun‐17Dec‐17 Dec‐17Dec‐17Feb‐18 Feb‐18 Segment 11 ‐ Fire #46 & Beach Rec.TBDJun‐17Dec‐17 Dec‐17Dec‐17TBD TBD Segment 15 ‐ Fire #44 & Sailing CenterTBDDec‐17 Dec‐17 Dec‐17Dec‐17TBD TBD Segment 16 ‐ Clearwater East LibraryDec‐16Dec‐16 Dec‐16 Complete Complete Complete Complete Segment 17 ‐ Joe DiMaggio ComplexDec‐16Dec‐16 Dec‐16 Complete Complete Complete Complete Segment 18 ‐ SR 60 Loop ConnectorTBDDec‐17 Dec‐17 Dec‐17Dec‐17Jan‐18Jan‐18 Segment 19 ‐ Belcher Road LoopDec‐16Dec‐16 Dec‐16 Complete Complete Complete Complete Segment 21 ‐ SW Transfer StationSep‐17 Sep‐17Sep‐17 Sep‐17 Sep‐17 Sep‐17 Sep‐17 Complete Segment 23 ‐ Morningside & McMullenMar‐18Dec‐17 Dec‐17 Dec‐17 Dec‐17 Dec‐17Dec‐17Gas Pasco OfficeY Award of Design Services Contract????Jan‐17 not on list not on list not on list not on list not on listGas Pinellas CampusY Award of Design Services ContractJan‐17Sep‐16 Complete Complete Complete Complete Selection of CM at RiskApr‐17not on list not on list not on list Apr‐17 Apr‐17 Complete Construction Documents & PermitsDec‐17Dec‐17 not on list Mar‐17Mar‐17Sep‐17Sep‐17Dec‐17 Contract Award for Construction Phase IMar‐18not on list Jun‐17Jun‐17Dec‐17 Dec‐17Dec‐17Joint use Library SPC Y Construction Start/CompletionDec‐17Dec‐17 Dec‐17 Dec‐17 Dec‐17 Dec‐17 Dec‐17NEW City Moves to New LibraryMar‐18New Mar‐18Groundwater Replenishment Complete Public Outreach SurveySep‐16Sep‐16 Sep‐16 Complete Complete Complete Complete Third Party Review ‐ SWFWMD ApprovalSep‐16Sep‐16 Sep‐16 Complete Complete Complete CompleteY Complete DesignOct‐17May‐17May‐17Aug‐17 Aug‐17Aug‐17Oct‐17New State Permit Applications ApprovalOct‐17new Oct‐17 Construction ‐ Wells CompleteMar‐19no date no date Sep‐18 Sep‐18 Sep‐18Sep‐18 Construction ‐ Plant CompleteJun‐19no date no date no date no date no dateMar‐192018‐01‐25 VM Jonson 1st Qtr FY 18 annotated.xlsx 3 Printed 1/25/20184:09 PM City of Clearwater Projects ‐VM Jonson ‐ Quarterly Report (1st Qtr FY 18)Date7/11/201610/4/20161/25/2017 4/4/2017 7/7/2017 10/9/2017Completed1st Qtr 2nd Qtr 3rd Qtr 4th Qtr 1st Qtr 2nd Qtr 3 rd Qtr 4th QtrUpdate ShowedUpdate ShowedUpdate ShowedUpdate ShowedUpdate ShowedUpdate Showed"= if next report date is later"=if next report date is earlier FY 2019Under Contract?Strategic Priorities FY 2018 Implementation Test PhaseAug‐19no date no date no date no date no dateMay‐19NEWRO #2 Renovation for Targeted Capacity 3rd Party Engineering EvaluationJan‐18newNov‐17 Deisgn of Solution ProjedtsJul‐18newNov‐18 Construction Start ‐ Phase IMar‐19newNov‐18NEWMarshall Street IPS Project (completion)Dec‐17Dec‐17new Dec‐17QualityPerformance Measurement City Platform CompletionApr‐18Dec‐16Dec‐16 Jan‐17 Sep‐17Apr‐18 Apr‐18Morningside Rec CenterY Design CompleteMar‐17Sep‐16Sep‐16 Mar‐17Mar‐17 Complete Complete Council Award of ContractJun‐17Feb‐17Feb‐17 Apr‐17 May‐17Jun‐17 Complete Construction CompleteMay‐18 Feb‐18Feb‐18 Mar‐18Mar‐18 Mar‐18Mar‐18Island Estates BridgesY Harbor Passage East ‐ CompleteJun‐17Nov‐16 Dec‐16 Apr‐17 Apr‐17Jun‐17 completeY Harbor Passage West ‐ CompleteJun‐17Mar‐17Apr‐17Apr‐17Apr‐17Jun‐17 completeY Northbound Island Way ‐ CompleteJun‐17Sep‐16Apr‐17Apr‐17Apr‐17Jun‐17 completeY Southbound Island Way ‐ CompleteJun‐17Mar‐17Feb‐17Apr‐17 Apr‐17Jun‐17 completeCrest Lake Veterans MemorialMay‐16complete completeCrest Lake Park Master Plan Public WorkshopsApr‐17not specifieJan‐17 Jan‐17 Apr‐17 Apr‐17 completeY Plan Presented to CouncilJun‐17May‐17 May‐17 May‐17 Jul‐17Jul‐17complete Award Design Contract Feb‐18no date no date no date no date Oct‐17Oct‐17 Award Construction ContractNov‐18 Dec‐17 Dec‐17 Dec‐17Dec‐17Jun‐18Jun‐18 Complete ConstructionJun‐19no date no date no date no date no date Jun‐19FinancialFinancial System Replacement MUNISSep‐16 Sep‐16 see below Council ApprovalFeb‐17Dec‐16Dec‐16Feb‐17 Feb‐17 Complete CompleteY Project KickoffFeb‐17Feb‐17 Feb‐17 Feb‐17 Feb‐17 Complete Complete Completion DateMay‐18Oct‐17 Nov‐17 no date no date May‐18Public SafetyYFire Station 50 GMP Contract to City CouncilOct‐16no date Oct‐16 Oct‐16 Complete Complete Complete Construction CompletionDec‐17 Dec‐17Dec‐17 Dec‐17 Dec‐17 Dec‐17 Dec‐17 Dec‐172018‐01‐25 VM Jonson 1st Qtr FY 18 annotated.xlsx 4 Printed 1/25/20184:09 PM City of Clearwater Projects ‐VM Jonson ‐ Quarterly Report (1st Qtr FY 18)Date7/11/201610/4/20161/25/2017 4/4/2017 7/7/2017 10/9/2017Completed1st Qtr 2nd Qtr 3rd Qtr 4th Qtr 1st Qtr 2nd Qtr 3 rd Qtr 4th QtrUpdate ShowedUpdate ShowedUpdate ShowedUpdate ShowedUpdate ShowedUpdate Showed"= if next report date is later"=if next report date is earlier FY 2019Under Contract?Strategic Priorities FY 2018Public Safety (continued)YPolice Firing Range PermittingSep‐16Y Construction StartOct‐16Sep‐16 Oct‐16 Oct‐16 Complete Complete Complete CompletionOct‐17 Oct‐17Sep‐17Sep‐17 Apr‐17 Aug‐17 Sep‐17Oct‐17DEO Resiliency Pilot Grant Vunerability AssessmentAug‐16no date Aug‐16 Complete Complete Complete CompleteY Draft Adaption PlanFeb‐17Jun‐16Nov‐16Feb‐17 Complete Complete Report/RecommendationsJun‐17Sep‐16 Nov‐16 Apr‐17 Jun‐17Jun‐17 Complete FEMA CRS Level 5 ApplicationJun‐19new FEMA CRS Level 4 [unscheduled]no date no date no date no date no date no dateYFluoridation in RO1 and RO2 Notice of Florida Dept of Health GrantSep‐17Complete Design & Permitting (RO#1 & RO#2)Oct‐17Oct‐17Jun‐17 Jun‐17 Jun‐17Jun‐17 Aug‐17Oct‐17 Construction RO#1 CompleteJun‐18no date Jun‐18 Jun‐18 Jun‐18 Jun‐18 Jun‐18 Construction RO#2 CompleteJun‐18no date Jun‐18 Jun‐18 Jun‐18 Jun‐18 Jun‐18 Design & Permitting (RO#3)Apr‐19Oct‐17 Oct‐17 Oct‐17Oct‐17Apr‐18Apr‐18 Construction RO#3 CompleteApr‐19newCorona Street SS Project Construction Start/FinishJan‐18Jun‐18newYCommunity sidewalks (Annual Contract)Feb‐17 Feb‐18same same same same same sameCSXRailroad Quiet Zone Notice to ProceedJun‐16 no dateMar‐17Mar‐17 Complete Complete BeginsAug‐17 Complete Ends (Waiting on FRA Inspection)May‐18no date no date Apr‐17Jun‐17May‐18 May‐182018‐01‐25 VM Jonson 1st Qtr FY 18 annotated.xlsx 5 Printed 1/25/20184:09 PM DateCompletion CompletedProjectionDeliverableUS 19 Corridor PlanApr‐17 Public outreachAug‐16 Public Hearings on Comp Plan Amend.Dec‐16 DEO Agency ReviewMar‐17 Future Land Use Map AmendmentsDec‐16 DEO Agency ReviewMar‐17 Text Amendment HearingsApr‐17US 19 Wayfinding Plan ‐ Phase II Resolve FDOT Permitting Dec‐17?Final Implementation?Gateway Master Plan Streetscape Preliminary Plan ApprovalJan‐17 Streetscape Construction BeginsMay‐18 Streetscape Complete Oct‐18Street and landscaping fully completed in all aspectsNorth Marina Development Plan AECOM Conceptual Design Phase ‐ Boat RampSep‐16 Final Design Phase BeginsApr‐17 Construction PlansSep‐17North Marina Boat Ramp, Trail Connection, and park improvements Construction PermittingJan‐18 Construction Begins/CompleteMar‐18 Construction CompleteOct‐18Construction modifications and landscaping fully completed in all aspectsComprehensive Boating PlanJan‐16Bluff/Waterfront Master Plan Feb‐17 Kick offJun‐16 Public and Stakeholder Engagement Aug‐16 Action Plan CreatedNov‐16 Approval of Master PlanFeb‐17 Award of Engineering Design ContractContract Approval to proceed with phase one of the design [West of 28' line and Osceola / Cleveland Plaza (excludes the Current City Hall and Parking and excludes the commercial plaza, and apts or hotel between the library and the entrance plaza)]. Completion of Engineering Design ContractDec‐18 Deliverable is construction drawings ready for bidding for all facilities in phase one. Output may be delivered in biddable packages during this time. Construction completion of phase oneJul‐20 Note phase 2 and 3 will be scheduled laterAmend Downtown PlanStrategic Priorities2018‐01‐25 VM Jonson 1st Qtr FY 18 annotated.xlsx 1 with Deliverable notations Review Character DistrictsDec‐16 Working group meeting/Design Stds Final DraftSep‐17 Adoption ‐ Begins Nov‐17 Adoption ‐ EndsMay‐18Approval by City Council of revised Clw CRA and Redevelopmetn Plan and subsequent approval by Pinellas County of the extension to the CRA TIF Revisions to CDC for Downtown May‐18Modifications to the Downtown Distict Code rules to allow change of use by right instead of requiring DRC approval; Modificantions to sign provisions to allow projecting signs under canopy and awings as a right in addition to the attached parallel sign; and Modifications recommended by Streetsense to allow brighter colors on storefronts and other recommendations in downtown. Reference Council Worksession 2/13/2017.ED Strategic Plan ‐ Annual UpdateApr‐17Pelican Walk Garage CompletionMar‐17Relocate DwnTwn PO and Repurpose Discuss Term Sheet (TENTATIVE)Downtown Parking Joint Facility Coordination with county beginsMar‐17 Coordination with county: decisionSep‐18Decision to proceed with a shared use building / campus with City and CountyComplete Branding RolloutJan‐17New WebsiteJan‐17My Clearwater Magazine Sep‐17OngoingMissouri Median FDOT Grant Project Design Plans to FDOTAug‐16 FDOT ApprovalOct‐16 Bidding Process Begins/AwardDec‐16 Construction Begins/CompleteJul‐17Downtown Gateway ID Monuments Design and Construction Docs to FDOTJan‐18 Bidding Process Begins/AwardApr‐18 Construction installation completeMay‐19Staff is proposing only two gateway monuments at Court/Chestnut split on SR60 and the Split of Ft. Harrison and Myrtle. The later is likely not what ULI had in mind. Concern related to Silverboard on 11/30/17Downtown Wayfinding Implementation Design and Construction Docs to FDOTJan‐18 Bidding Process Begins/AwardApr‐18 Construction installation completeMay‐19Replacement of existing way finding signs with new signs through‐out the CRA district. This will be done as part of the City wide Way Finding project. It is recommended to break this into two party as the downtown portion needs to be acceleratedNeighborhoods/Public Spaces Placemaking Guide Approval Tactical Urbanism Project #1Jan‐172018‐01‐25 VM Jonson 1st Qtr FY 18 annotated.xlsx 2 with Deliverable notations Neighborhood Engagement StrategyMar‐17 Tactical Urbanism Project #2TBDTBDBicycle Paths and Trails Bayshore to WilsonMay‐15 Bicycle Friendly DesignationApr‐18Needs to be defined Druid Road Trail Begins/EndsAug‐18Construction complete for the Druid trail from Glen Oaks to the Duke Trail SR60 Trail Head LeaseDec‐17 Shifting Gears Plan UpdateApr‐18IT Strategic Plan ‐Connectivity Project Segment 6 ‐ Clearwater Beach Marina. Segment 8 ‐ North Loop ConnectorDec‐16. Segment 9 ‐ Ross Norton & SubstationDec‐16. Segment 10 ‐ Beach PD Substation. Segment 11 ‐ Fire #46 & Beach Rec.TBD. Segment 15 ‐ Fire #44 & Sailing CenterTBD. Segment 16 ‐ Clearwater East LibraryDec‐16. Segment 17 ‐ Joe DiMaggio ComplexDec‐16. Segment 18 ‐ SR 60 Loop Connector. Segment 19 ‐ Belcher Road LoopDec‐16. Segment 21 ‐ SW Transfer StationSep‐17. Segment 23 ‐ Morningside & McMullen.Gas Pasco Office Award of Design Services Contract????.Gas Pinellas Campus Award of Design Services ContractJan‐17 Selection of CM at RiskApr‐17 Construction Documents & PermitsDec‐17 Contract Award for Construction Phase IDec‐17 Completion of ConstructionTBDAll modifications completed and operating to include enhanced landscaping of the TraiJoint use Library SPC Construction Start/CompletionDec‐17 City Moves to New LibraryMar‐18New library open to patrons in a finished buildingGroundwater Replenishment Complete Public Outreach SurveySep‐16 Third Party Review ‐ SWFWMD ApprovalSep‐16 Complete DesignOct‐17 State Permit ApplicationsOct‐17 Construction ‐ Wells CompleteSep‐18 Construction ‐ Plant CompleteMar‐19 Implementation Test PhaseMay‐19????? Full scale production operation???No longer discharging xxx MGD per day into Tampa Bay2018‐01‐25 VM Jonson 1st Qtr FY 18 annotated.xlsx 3 with Deliverable notations RO #2 Renovation for Targeted Capacity 3rd Party Engineering EvaluationNov‐17 Deisgn of Solution ProjedtsNov‐18 Construction Start ‐ Phase INov‐18 Full operation at design capacity???Operation of RO 2 at original design capacity as funded by SWFWMDMarshall Street IPS Project (completion)Dec‐17Full production operation of reconstructed headwaters facility and all bypass piping removedPerformance Measurement City Platform CompletionApr‐18Uncertain of scope at this time. Likely will use the Munis Financial System as a basis.Morningside Rec Center Design CompleteMar‐17 Council Award of ContractJun‐17 Construction CompleteMay‐18Building, parking, pool and site fully operational and completedIsland Estates Bridges Harbor Passage East ‐ CompleteJun‐17. Harbor Passage West ‐ CompleteJun‐17. Northbound Island Way ‐ CompleteJun‐17. Southbound Island Way ‐ CompleteJun‐17.Crest Lake Veterans MemorialMay‐16.Crest Lake Park Master Plan Public WorkshopsApr‐17 Plan Presented to CouncilJun‐17 Award Design Contract Oct‐17 Award Construction ContractJun‐17 Complete ConstructionJun‐19Park and facilities completed as designed and open to the publicFinancial System Replacement MUNIS Council ApprovalFeb‐17 Project KickoffFeb‐17 Completion DateMay‐18Full operation of the Munis Financial SystemFire Station 50 GMP Contract to City CouncilOct‐16 Construction CompletionDec‐17New FD 50 building fully completed and operational 24x7x365Police Firing Range Permitting Construction StartOct‐16 CompletionOct‐17Completion of all facility per the design specifications and ready for operationDEO Resiliency Pilot Grant2018‐01‐25 VM Jonson 1st Qtr FY 18 annotated.xlsx 4 with Deliverable notations Vunerability AssessmentAug‐16 Draft Adaption PlanFeb‐17 Report/RecommendationsJun‐17 FEMA CRS Level 4 [unscheduled]Fluoridation in RO1 and RO2 Notice of Florida Dept of Health GrantSep‐17 Design & Permitting (RO#1 & RO#2)Oct‐17 Construction RO#1 CompleteJun‐18Fluoridation 24x7x365 operation for all water processed at Plant 1 Construction RO#2 CompleteJun‐18Fluoridation 24x7x365 operation for all water processed at plant 2 Design & Permitting (RO#3)Apr‐18 Construction RO#3 CompleteApr‐19Place holder target dateCommunity sidewalks (Annual Contract)Feb‐17Railroad Quiet Zone Notice to Proceed BeginsAug‐17 EndsMay‐18Not ListedComplete Streets ProjectPinellas Trail ActivationDowntown Arts ActivationTransportation to the Beach2018‐01‐25 VM Jonson 1st Qtr FY 18 annotated.xlsx 5 with Deliverable notations Jan‐00Sep‐13May‐27Jan‐41Oct‐54Jun‐68Feb‐82Oct‐95Jul‐09Mar‐23Nov‐361Series1 00.10.20.30.40.50.60.70.80.91Diversify Economic Base Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: ID#18-4285 Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: Council Discussion Item In Control: Council Work Session Agenda Number: 13.4 SUBJECT/RECOMMENDATION: Historic, Old and Authentic - Councilmember Jonson SUMMARY: APPROPRIATION CODE AND AMOUNT: USE OF RESERVE FUNDS: Page 1 City of Clearwater Printed on 1/25/2018 Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: ID#18-4286 Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: Council Discussion Item In Control: Council Work Session Agenda Number: 13.5 SUBJECT/RECOMMENDATION: Winter Park Experience - Councilmember Jonson SUMMARY: APPROPRIATION CODE AND AMOUNT: USE OF RESERVE FUNDS: Page 1 City of Clearwater Printed on 1/25/2018 Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: ID#18-4242 Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: Presentation(s) for Council Meeting In Control: Council Work Session Agenda Number: 17.1 SUBJECT/RECOMMENDATION: Chi Chi Rodriguez Foundation - Tom James, Board Chair SUMMARY: APPROPRIATION CODE AND AMOUNT: USE OF RESERVE FUNDS: Page 1 City of Clearwater Printed on 1/25/2018 Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: ID#18-4243 Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: Presentation(s) for Council Meeting In Control: Council Work Session Agenda Number: 17.2 SUBJECT/RECOMMENDATION: USA Softball - Ken Ericksen, USA Softball National Team Head Coach SUMMARY: APPROPRIATION CODE AND AMOUNT: USE OF RESERVE FUNDS: Page 1 City of Clearwater Printed on 1/25/2018 Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: ID#18-4245 Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: Presentation(s) for Council Meeting In Control: Council Work Session Agenda Number: 17.3 SUBJECT/RECOMMENDATION: Outback Bowl Beach Day - Mike Schulze, Director of Communications and Sponsorships SUMMARY: APPROPRIATION CODE AND AMOUNT: USE OF RESERVE FUNDS: Page 1 City of Clearwater Printed on 1/25/2018 Cover Memo City of Clearwater City Hall 112 S. Osceola Avenue Clearwater, FL 33756 File Number: ID#18-4284 Agenda Date: 1/29/2018 Status: Agenda ReadyVersion: 1 File Type: Presentation(s) for Council Meeting In Control: Council Work Session Agenda Number: 17.4 SUBJECT/RECOMMENDATION: 2017 Florida School Crossing Guard Program/Agency of the Year SUMMARY: APPROPRIATION CODE AND AMOUNT: USE OF RESERVE FUNDS: Page 1 City of Clearwater Printed on 1/25/2018